2GC4B

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc4B00
3SLEC 2BBKL 4FA5C 2AH1D 3SWSC 2HJBD 2J55L 2Q7QD 2I0TD 4O1QC 2H47B 2IUVD 4FAVC 2IURD 2HKRD 2MADL 4FB1C 3PXWC 3SJLC 4FANC 3PXSC 3RLMC 1MG3B 4FA4C 2J56L 1MDAL 2I0RD 3SXTC 4FA9C 3L4OC 2H3XB 2OIZD 2IUQD 2GC7B 2J57K 1MG2B 2OJYD 2AGZD 2I0SD 2OK6D 4L3HC 1MAEL 2AGWD 2IAAB 3L4MC 4L3GC 3RMZC 3SVWC 1MAFL 2MTAL 2AGYD 3C75L 2GC4B 3ORVC 2AH0D 3PXTC 2AGXD 2AGLD 2OK4D 4L1QC 3RN0C 3RN1C 4FA1C 2IUPD 2HJ4D 4K3IC 2HKMD 4Y5RC 2HXCD
chains in the Genus database with same CATH superfamily
3SLEC 2BBKL 4FA5C 2AH1D 3SWSC 2HJBD 2J55L 2Q7QD 2I0TD 4O1QC 2H47B 2IUVD 4FAVC 2IURD 2HKRD 2MADL 4FB1C 3PXWC 3SJLC 4FANC 3PXSC 3RLMC 1MG3B 4FA4C 2J56L 1MDAL 2I0RD 3SXTC 4FA9C 3L4OC 2H3XB 2OIZD 2IUQD 2GC7B 2J57K 1MG2B 2OJYD 2AGZD 2I0SD 2OK6D 4L3HC 1MAEL 2AGWD 2IAAB 3L4MC 4L3GC 3RMZC 3SVWC 1MAFL 2MTAL 2AGYD 3C75L 2GC4B 3ORVC 2AH0D 3PXTC 2AGXD 2AGLD 2OK4D 4L1QC 3RN0C 3RN1C 4FA1C 2IUPD 2HJ4D 4K3IC 2HKMD 4Y5RC 2HXCD
chains in the Genus database with same CATH topology
3SLEC 2BBKL 4FA5C 2AH1D 3SWSC 2HJBD 2J55L 2Q7QD 2I0TD 4O1QC 2H47B 2IUVD 4FAVC 2IURD 2HKRD 2MADL 4FB1C 3PXWC 3SJLC 4FANC 3PXSC 3RLMC 1MG3B 4FA4C 2J56L 1MDAL 2I0RD 3SXTC 4FA9C 3L4OC 2H3XB 2OIZD 2IUQD 2GC7B 2J57K 1MG2B 2OJYD 2AGZD 2I0SD 2OK6D 4L3HC 1MAEL 2AGWD 2IAAB 3L4MC 4L3GC 3RMZC 3SVWC 1MAFL 2MTAL 2AGYD 3C75L 2GC4B 3ORVC 2AH0D 3PXTC 2AGXD 2AGLD 2OK4D 4L1QC 3RN0C 3RN1C 4FA1C 2IUPD 2HJ4D 4K3IC 2HKMD 4Y5RC 2HXCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SLE C;  2BBK L;  4FA5 C;  2AH1 D;  3SWS C;  2HJB D;  2J55 L;  2Q7Q D;  2I0T D;  4O1Q C;  2H47 B;  2IUV D;  4FAV C;  2IUR D;  2HKR D;  2MAD L;  4FB1 C;  3PXW C;  3SJL C;  4FAN C;  3PXS C;  3RLM C;  1MG3 B;  4FA4 C;  2J56 L;  1MDA L;  2I0R D;  3SXT C;  4FA9 C;  3L4O C;  2H3X B;  2OIZ D;  2IUQ D;  2GC7 B;  2J57 K;  1MG2 B;  2OJY D;  2AGZ D;  2I0S D;  2OK6 D;  4L3H C;  1MAE L;  2AGW D;  2IAA B;  3L4M C;  4L3G C;  3RMZ C;  3SVW C;  1MAF L;  2MTA L;  2AGY D;  3C75 L;  2GC4 B;  3ORV C;  2AH0 D;  3PXT C;  2AGX D;  2AGL D;  2OK4 D;  4L1Q C;  3RN0 C;  3RN1 C;  4FA1 C;  2IUP D;  2HJ4 D;  4K3I C;  2HKM D;  4Y5R C;  2HXC D; 
#chains in the Genus database with same CATH topology
 3SLE C;  2BBK L;  4FA5 C;  2AH1 D;  3SWS C;  2HJB D;  2J55 L;  2Q7Q D;  2I0T D;  4O1Q C;  2H47 B;  2IUV D;  4FAV C;  2IUR D;  2HKR D;  2MAD L;  4FB1 C;  3PXW C;  3SJL C;  4FAN C;  3PXS C;  3RLM C;  1MG3 B;  4FA4 C;  2J56 L;  1MDA L;  2I0R D;  3SXT C;  4FA9 C;  3L4O C;  2H3X B;  2OIZ D;  2IUQ D;  2GC7 B;  2J57 K;  1MG2 B;  2OJY D;  2AGZ D;  2I0S D;  2OK6 D;  4L3H C;  1MAE L;  2AGW D;  2IAA B;  3L4M C;  4L3G C;  3RMZ C;  3SVW C;  1MAF L;  2MTA L;  2AGY D;  3C75 L;  2GC4 B;  3ORV C;  2AH0 D;  3PXT C;  2AGX D;  2AGL D;  2OK4 D;  4L1Q C;  3RN0 C;  3RN1 C;  4FA1 C;  2IUP D;  2HJ4 D;  4K3I C;  2HKM D;  4Y5R C;  2HXC D; 
#chains in the Genus database with same CATH homology
 3SLE C;  2BBK L;  4FA5 C;  2AH1 D;  3SWS C;  2HJB D;  2J55 L;  2Q7Q D;  2I0T D;  4O1Q C;  2H47 B;  2IUV D;  4FAV C;  2IUR D;  2HKR D;  2MAD L;  4FB1 C;  3PXW C;  3SJL C;  4FAN C;  3PXS C;  3RLM C;  1MG3 B;  4FA4 C;  2J56 L;  1MDA L;  2I0R D;  3SXT C;  4FA9 C;  3L4O C;  2H3X B;  2OIZ D;  2IUQ D;  2GC7 B;  2J57 K;  1MG2 B;  2OJY D;  2AGZ D;  2I0S D;  2OK6 D;  4L3H C;  1MAE L;  2AGW D;  2IAA B;  3L4M C;  4L3G C;  3RMZ C;  3SVW C;  1MAF L;  2MTA L;  2AGY D;  3C75 L;  2GC4 B;  3ORV C;  2AH0 D;  3PXT C;  2AGX D;  2AGL D;  2OK4 D;  4L1Q C;  3RN0 C;  3RN1 C;  4FA1 C;  2IUP D;  2HJ4 D;  4K3I C;  2HKM D;  4Y5R C;  2HXC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...