2GC7B

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
total genus 29
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc7B00
1MAEL 4FB1C 2OIZD 3SLEC 3L4OC 2J56L 3RMZC 4FA1C 3SXTC 2J57K 2AGXD 4L3HC 4K3IC 2OK4D 4FA9C 2HJBD 4FA5C 2OK6D 2HKRD 3SVWC 2IURD 3RN1C 4FA4C 2H3XB 2H47B 3L4MC 4L3GC 3PXTC 2MADL 2IAAB 2I0SD 2MTAL 3ORVC 4O1QC 3RLMC 1MAFL 2AGLD 3SWSC 2Q7QD 1MDAL 2AGYD 2GC7B 3SJLC 2HXCD 4FANC 2OJYD 2AGWD 2AGZD 2IUVD 2HJ4D 2IUQD 4L1QC 2I0TD 3PXSC 2AH0D 2IUPD 4FAVC 2GC4B 1MG2B 2BBKL 2I0RD 3C75L 4Y5RC 3RN0C 1MG3B 2HKMD 2AH1D 3PXWC 2J55L
chains in the Genus database with same CATH superfamily
1MAEL 4FB1C 2OIZD 3SLEC 3L4OC 2J56L 3RMZC 4FA1C 3SXTC 2J57K 2AGXD 4L3HC 4K3IC 2OK4D 4FA9C 2HJBD 4FA5C 2OK6D 2HKRD 3SVWC 2IURD 3RN1C 4FA4C 2H3XB 2H47B 3L4MC 4L3GC 3PXTC 2MADL 2IAAB 2I0SD 2MTAL 3ORVC 4O1QC 3RLMC 1MAFL 2AGLD 3SWSC 2Q7QD 1MDAL 2AGYD 2GC7B 3SJLC 2HXCD 4FANC 2OJYD 2AGWD 2AGZD 2IUVD 2HJ4D 2IUQD 4L1QC 2I0TD 3PXSC 2AH0D 2IUPD 4FAVC 2GC4B 1MG2B 2BBKL 2I0RD 3C75L 4Y5RC 3RN0C 1MG3B 2HKMD 2AH1D 3PXWC 2J55L
chains in the Genus database with same CATH topology
1MAEL 4FB1C 2OIZD 3SLEC 3L4OC 2J56L 3RMZC 4FA1C 3SXTC 2J57K 2AGXD 4L3HC 4K3IC 2OK4D 4FA9C 2HJBD 4FA5C 2OK6D 2HKRD 3SVWC 2IURD 3RN1C 4FA4C 2H3XB 2H47B 3L4MC 4L3GC 3PXTC 2MADL 2IAAB 2I0SD 2MTAL 3ORVC 4O1QC 3RLMC 1MAFL 2AGLD 3SWSC 2Q7QD 1MDAL 2AGYD 2GC7B 3SJLC 2HXCD 4FANC 2OJYD 2AGWD 2AGZD 2IUVD 2HJ4D 2IUQD 4L1QC 2I0TD 3PXSC 2AH0D 2IUPD 4FAVC 2GC4B 1MG2B 2BBKL 2I0RD 3C75L 4Y5RC 3RN0C 1MG3B 2HKMD 2AH1D 3PXWC 2J55L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAE L;  4FB1 C;  2OIZ D;  3SLE C;  3L4O C;  2J56 L;  3RMZ C;  4FA1 C;  3SXT C;  2J57 K;  2AGX D;  4L3H C;  4K3I C;  2OK4 D;  4FA9 C;  2HJB D;  4FA5 C;  2OK6 D;  2HKR D;  3SVW C;  2IUR D;  3RN1 C;  4FA4 C;  2H3X B;  2H47 B;  3L4M C;  4L3G C;  3PXT C;  2MAD L;  2IAA B;  2I0S D;  2MTA L;  3ORV C;  4O1Q C;  3RLM C;  1MAF L;  2AGL D;  3SWS C;  2Q7Q D;  1MDA L;  2AGY D;  2GC7 B;  3SJL C;  2HXC D;  4FAN C;  2OJY D;  2AGW D;  2AGZ D;  2IUV D;  2HJ4 D;  2IUQ D;  4L1Q C;  2I0T D;  3PXS C;  2AH0 D;  2IUP D;  4FAV C;  2GC4 B;  1MG2 B;  2BBK L;  2I0R D;  3C75 L;  4Y5R C;  3RN0 C;  1MG3 B;  2HKM D;  2AH1 D;  3PXW C;  2J55 L; 
#chains in the Genus database with same CATH topology
 1MAE L;  4FB1 C;  2OIZ D;  3SLE C;  3L4O C;  2J56 L;  3RMZ C;  4FA1 C;  3SXT C;  2J57 K;  2AGX D;  4L3H C;  4K3I C;  2OK4 D;  4FA9 C;  2HJB D;  4FA5 C;  2OK6 D;  2HKR D;  3SVW C;  2IUR D;  3RN1 C;  4FA4 C;  2H3X B;  2H47 B;  3L4M C;  4L3G C;  3PXT C;  2MAD L;  2IAA B;  2I0S D;  2MTA L;  3ORV C;  4O1Q C;  3RLM C;  1MAF L;  2AGL D;  3SWS C;  2Q7Q D;  1MDA L;  2AGY D;  2GC7 B;  3SJL C;  2HXC D;  4FAN C;  2OJY D;  2AGW D;  2AGZ D;  2IUV D;  2HJ4 D;  2IUQ D;  4L1Q C;  2I0T D;  3PXS C;  2AH0 D;  2IUP D;  4FAV C;  2GC4 B;  1MG2 B;  2BBK L;  2I0R D;  3C75 L;  4Y5R C;  3RN0 C;  1MG3 B;  2HKM D;  2AH1 D;  3PXW C;  2J55 L; 
#chains in the Genus database with same CATH homology
 1MAE L;  4FB1 C;  2OIZ D;  3SLE C;  3L4O C;  2J56 L;  3RMZ C;  4FA1 C;  3SXT C;  2J57 K;  2AGX D;  4L3H C;  4K3I C;  2OK4 D;  4FA9 C;  2HJB D;  4FA5 C;  2OK6 D;  2HKR D;  3SVW C;  2IUR D;  3RN1 C;  4FA4 C;  2H3X B;  2H47 B;  3L4M C;  4L3G C;  3PXT C;  2MAD L;  2IAA B;  2I0S D;  2MTA L;  3ORV C;  4O1Q C;  3RLM C;  1MAF L;  2AGL D;  3SWS C;  2Q7Q D;  1MDA L;  2AGY D;  2GC7 B;  3SJL C;  2HXC D;  4FAN C;  2OJY D;  2AGW D;  2AGZ D;  2IUV D;  2HJ4 D;  2IUQ D;  4L1Q C;  2I0T D;  3PXS C;  2AH0 D;  2IUP D;  4FAV C;  2GC4 B;  1MG2 B;  2BBK L;  2I0R D;  3C75 L;  4Y5R C;  3RN0 C;  1MG3 B;  2HKM D;  2AH1 D;  3PXW C;  2J55 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...