2GC7B

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 29
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc7B00
1MG3B 2AH0D 2HJBD 4O1QC 2HXCD 2H47B 2OJYD 2I0RD 2I0TD 2IUPD 2OK4D 3SLEC 2H3XB 4FA1C 3PXWC 4Y5RC 2HJ4D 4FAVC 1MAEL 2AGZD 2GC4B 2IURD 2MTAL 2IUVD 3L4MC 2AGXD 3SXTC 2OIZD 4L3GC 2AGLD 2AGYD 3C75L 4FA9C 2I0SD 4L1QC 2AGWD 2J56L 3RN0C 2HKMD 3RMZC 2AH1D 2MADL 2Q7QD 4FA4C 4FA5C 3SWSC 3SVWC 1MAFL 2GC7B 3RN1C 3SJLC 2IAAB 3L4OC 3PXTC 3RLMC 2BBKL 4FANC 4FB1C 1MG2B 2J55L 4K3IC 4L3HC 1MDAL 2IUQD 2J57K 2HKRD 2OK6D 3PXSC 3ORVC
chains in the Genus database with same CATH superfamily
1MG3B 2AH0D 2HJBD 4O1QC 2HXCD 2H47B 2OJYD 2I0RD 2I0TD 2IUPD 2OK4D 3SLEC 2H3XB 4FA1C 3PXWC 4Y5RC 2HJ4D 4FAVC 1MAEL 2AGZD 2GC4B 2IURD 2MTAL 2IUVD 3L4MC 2AGXD 3SXTC 2OIZD 4L3GC 2AGLD 2AGYD 3C75L 4FA9C 2I0SD 4L1QC 2AGWD 2J56L 3RN0C 2HKMD 3RMZC 2AH1D 2MADL 2Q7QD 4FA4C 4FA5C 3SWSC 3SVWC 1MAFL 2GC7B 3RN1C 3SJLC 2IAAB 3L4OC 3PXTC 3RLMC 2BBKL 4FANC 4FB1C 1MG2B 2J55L 4K3IC 4L3HC 1MDAL 2IUQD 2J57K 2HKRD 2OK6D 3PXSC 3ORVC
chains in the Genus database with same CATH topology
1MG3B 2AH0D 2HJBD 4O1QC 2HXCD 2H47B 2OJYD 2I0RD 2I0TD 2IUPD 2OK4D 3SLEC 2H3XB 4FA1C 3PXWC 4Y5RC 2HJ4D 4FAVC 1MAEL 2AGZD 2GC4B 2IURD 2MTAL 2IUVD 3L4MC 2AGXD 3SXTC 2OIZD 4L3GC 2AGLD 2AGYD 3C75L 4FA9C 2I0SD 4L1QC 2AGWD 2J56L 3RN0C 2HKMD 3RMZC 2AH1D 2MADL 2Q7QD 4FA4C 4FA5C 3SWSC 3SVWC 1MAFL 2GC7B 3RN1C 3SJLC 2IAAB 3L4OC 3PXTC 3RLMC 2BBKL 4FANC 4FB1C 1MG2B 2J55L 4K3IC 4L3HC 1MDAL 2IUQD 2J57K 2HKRD 2OK6D 3PXSC 3ORVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 B;  2AH0 D;  2HJB D;  4O1Q C;  2HXC D;  2H47 B;  2OJY D;  2I0R D;  2I0T D;  2IUP D;  2OK4 D;  3SLE C;  2H3X B;  4FA1 C;  3PXW C;  4Y5R C;  2HJ4 D;  4FAV C;  1MAE L;  2AGZ D;  2GC4 B;  2IUR D;  2MTA L;  2IUV D;  3L4M C;  2AGX D;  3SXT C;  2OIZ D;  4L3G C;  2AGL D;  2AGY D;  3C75 L;  4FA9 C;  2I0S D;  4L1Q C;  2AGW D;  2J56 L;  3RN0 C;  2HKM D;  3RMZ C;  2AH1 D;  2MAD L;  2Q7Q D;  4FA4 C;  4FA5 C;  3SWS C;  3SVW C;  1MAF L;  2GC7 B;  3RN1 C;  3SJL C;  2IAA B;  3L4O C;  3PXT C;  3RLM C;  2BBK L;  4FAN C;  4FB1 C;  1MG2 B;  2J55 L;  4K3I C;  4L3H C;  1MDA L;  2IUQ D;  2J57 K;  2HKR D;  2OK6 D;  3PXS C;  3ORV C; 
#chains in the Genus database with same CATH topology
 1MG3 B;  2AH0 D;  2HJB D;  4O1Q C;  2HXC D;  2H47 B;  2OJY D;  2I0R D;  2I0T D;  2IUP D;  2OK4 D;  3SLE C;  2H3X B;  4FA1 C;  3PXW C;  4Y5R C;  2HJ4 D;  4FAV C;  1MAE L;  2AGZ D;  2GC4 B;  2IUR D;  2MTA L;  2IUV D;  3L4M C;  2AGX D;  3SXT C;  2OIZ D;  4L3G C;  2AGL D;  2AGY D;  3C75 L;  4FA9 C;  2I0S D;  4L1Q C;  2AGW D;  2J56 L;  3RN0 C;  2HKM D;  3RMZ C;  2AH1 D;  2MAD L;  2Q7Q D;  4FA4 C;  4FA5 C;  3SWS C;  3SVW C;  1MAF L;  2GC7 B;  3RN1 C;  3SJL C;  2IAA B;  3L4O C;  3PXT C;  3RLM C;  2BBK L;  4FAN C;  4FB1 C;  1MG2 B;  2J55 L;  4K3I C;  4L3H C;  1MDA L;  2IUQ D;  2J57 K;  2HKR D;  2OK6 D;  3PXS C;  3ORV C; 
#chains in the Genus database with same CATH homology
 1MG3 B;  2AH0 D;  2HJB D;  4O1Q C;  2HXC D;  2H47 B;  2OJY D;  2I0R D;  2I0T D;  2IUP D;  2OK4 D;  3SLE C;  2H3X B;  4FA1 C;  3PXW C;  4Y5R C;  2HJ4 D;  4FAV C;  1MAE L;  2AGZ D;  2GC4 B;  2IUR D;  2MTA L;  2IUV D;  3L4M C;  2AGX D;  3SXT C;  2OIZ D;  4L3G C;  2AGL D;  2AGY D;  3C75 L;  4FA9 C;  2I0S D;  4L1Q C;  2AGW D;  2J56 L;  3RN0 C;  2HKM D;  3RMZ C;  2AH1 D;  2MAD L;  2Q7Q D;  4FA4 C;  4FA5 C;  3SWS C;  3SVW C;  1MAF L;  2GC7 B;  3RN1 C;  3SJL C;  2IAA B;  3L4O C;  3PXT C;  3RLM C;  2BBK L;  4FAN C;  4FB1 C;  1MG2 B;  2J55 L;  4K3I C;  4L3H C;  1MDA L;  2IUQ D;  2J57 K;  2HKR D;  2OK6 D;  3PXS C;  3ORV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...