2GFBA

Crystal structure of a catalytic fab having esterase-like activity
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
QIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASSPYTFGGGTKLEILRGGAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic antibody Fab with esterase-like activity.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG2A CNJ206 FAB (LIGHT CHAIN)
total genus 54
structure length 214
sequence length 214
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 1994-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbA01
3QG7H 3UYRL 5F7EL 1UCBL 1QSFA 3REWB 4AG4L 4MJ6A 3HS0A 1L0QA 1HQ4A 1HE7A 2DQEL 3B9KC 5TFSH 3LN4B 4UZGA 4EIGB 4LPUA 1CR9L 4M48L 2GCYA 2Q86A 5FA3B 3RY6A 1TCRA 3TA3B 3DX7B 3QO1B 4LOUD 5EU6D 1ZK9A 2R39A 3BP6B 1BFOB 2GJZA 1OSPL 3HC3H 3SDXA 1PD6A 4JFOB 1OTSC 1TITA 5BV7L 5ISZE 3QEQB 3OV6A 2PN5A 1S9VA 5IJKC 1MFBH 1N0XL 2HJKB 5K9KB 4N9GA 3NVQA 1QQDB 5IMLA 3VG0H 2BC4B 1NKRA 3O3EB 5HYFA 4OD3L 4HF5L 5E0QA 5T1MB 2EYRA 5D1ZD 1QLRB 3S4SB 2CRIA 4GLRH 3AS0A 1QRKA 3VFNA 1A6UH 1I7RA 4YK4B 4LQFL 4OCSL 3SGEH 3WKNA 4NZJA 1IC7H 5TDNA 2Q87A 2NY7H 5BZDB 1H3PL 3MRKA 7FABL 1I1AC 1U8MB 2X89D 4BQCA 4LSUL 1X5YA 5SWSA 3LSOA 1AP2B 1KIQB 2Y6SC 1MQ8A 3C6SB 2XIDA 1F6LL 3KJ4B 2DKUA 3ULUE 3THMH 1ZOXA 1KXQE 2B5IC 4K9EH 1JHLH 2OQJB 4Y5YC 5L2KB 3QDMD 2MOVA 1W72L 3K2UL 1T7VA 3CC5B 5EBWB 1X5LA 5HHNB 5HDBF 4K3EH 1BD2B 3I9GH 3NCFB 4Y1AD 2NZIA 5DQDL 4LRNH 3S34L 4O51A 4YDJA 1FDLH 3FO2B 1SEQL 3MNWA 4G6ML 1LMKA 3SKMB 4XVSH 2HTLC 2XY2A 4HJ0D 2YRPA 5C07B 4FP8H 5AG8A 3RGVD 1HWGB 3EOBA 1F4XL 4Y16C 4H0IA 2PO6A 2VQTA 5KSBE 4N0RA 2ZJSH 4S1DC 4GO6B 4NUGL 1LP9A 3CFEB 3EYOA 4LHUG 2AJZB 4BA8A 3Q5YA 4O4YH 3ZHDA 1DN0B 4YXHL 4XHJD 2X6MA 2NTFA 3K2MC 3OXRB 4Y19A 3MV8A 3ULSB 1W0VB 4TQEL 2VLKE 5H94B 1EUUA 3UDWC 4D0DB 4BSWB 3B9AA 1LD9B 4OZHF 2NY0C 2ERJC 1IRAY 1T2QL 3R1GL 3UPAA 2JCCB 4F8QA 2E7CA 1DBML 3ESVF 5ISZA 2ILLA 4I0CC 3M17A 4NQCA 5I1KL 1HNFA 3QUZB 4L8SA 1S78D 4TVPL 2CQVA 5HPMB 4RWYH 4TUKL 3H9SA 1DBAH 2EE2A 2JCCA 1RZKH 1Y6MR 3RGVC 1F13A 4OUUB 4ZFOA 2VLJA 4H8WH 1RIUL 3WKMH 5A3ID 3T0EE 2XTJC 3MCKA 4BELD 2HTLD 1CQKA 2I07B 5CGYD 3BWUC 3MV8B 4FFVC 5C7XH 3DBXB 1WEJL 4I18B 2DQIH 1CD1A 1UA6H 2EDXA 4KU1A 3TWCH 2PUQT 3OZ9L 2CXKA 2WMPA 3E6HB 4F33B 4P23D 4NWTL 3OAZH 4YE4L 5C07A 2IPUK 4QHKI 1JGLL 5FK9B 4R0LA 2HH0L 5DO2C 1YNKH 5D72L 5JOPD 1CE1H 4UUJA 1IEBA 2J1KA 2NY1B 4QF1A 5GHWH 3GSOA 1I7TB 3L3HA 5BZWA 5BRZB 3EYUH 1MVFA 3L3KA 5ID0B 3E3QC 4LLVB 5DQJA 4UIKH 5DRXA 2I9LB 3ILQD 5CZXC 1X9QA 4Q9BA 1SVCP 4TSAH 3QJFB 2C4FT 5DGRA 1T7XA 5MI0B 3BVNA 3TN0B 4ZUSA 2XZQL 2CXGA 1MI5B 4JPIA 5I1IL 1X5JA 3BJLA 1T3FA 3OJMB 5FXCH 4G7YH 2DDQL 5DK0A 2CDEB 4WJ5A 1A9EA 3PDGA 2DOCA 3MJ6A 4TNWK 2RIKA 4KKLC 4NQXB 4KXZI 2E9IA 2ZUUA 1KJ2L 4UDUB 5BW7A 4N9GB 4TRPH 5MEPB 3MYZA 2C4FU 4K55A 1F8TL 1T1ZA 4YDLB 4LSTL 1MAJA 1PAMA 1U95B 5JORB 3BZFB 2H2SD 3B9DA 3IFLH 4QRRB 1KJVB 3QDMB 5AEAA 3NZ8A 1QLFA 1II4E 4JR9H 4ETQB 4ZNEE 5C0AE 4JKKA 2HTKC 4P99A 2AI0L 1I85C 2ADJA 1WTLA 5EOQH 4AL8H 3QWOA 3C08H 2AP2A 3P4OA 4NRXA 1K8IB 5IFJB 4HG4K 2UVEA 2XWJA 3MRQB 4JEGB 4M7LL 2EC9U 5DZOA 3NPSC 3V0WH 1DVFB 4IJ3B 4XVUC 3C09C 3DSFL 4OM0H 4JB9H 1NCAH 1YY9C 4HIHA 2DYPA 2EE6A 4ZQKA 3V5HB 3G6JE 1GZQA 4NBXB 1HZHH 1XGQB 2F15A 5HI3D 3WS6A 4E0RA 5LGHH 2I27N 4H0HB 2OTUB 3GBML 3QI9A 5J6GA 3GMOB 4ZG1A 2ZJSL 1GSMA 2NY3B 2PXYB 3L6FB 4X99A 1JN6A 5BQ7A 3QDJB 1R3JA 4WU7A 4PJAA 4JCMA 3OWEA 4QLRA 1NLBH 4U1JA 2XRAL 3MSPA 4G6MH 2NZ9D 2DICA 1JMZA 1S5HB 3ZKND 3I84A 3FHAA 1HXYA 1TPXC 5DJXA 3NA9H 1RK1B 4G80A 2PR4L 3R06B 3X3FH 3KR3L 3QEGH 3FOLB 5A1AA 2OCFD 2IFFH 2NY2D 4LDLB 2UUDK 4NN7B 4P5TD 4ZFZB 1CFSB 3BH8B 4LCIH 3LEVH 1HH6A 4N8VG 1VKXA 1JYXA 1QFUL 3VXQB 1AO7E 5GRUL 1NGXA 1IC4L 2F54B 4CL7A 4LSUH 4ODXB 1EEYA 5JXEC 5I66B 4XP6L 3ULVD 1RZFH 4NNXB 3I2CL 1IILE 1RMFL 3AMLA 1IGFH 4JHZA 3HZVB 1JPFA 3C9NA 4JPWL 2XI9A 1NC2B 2C5DC 2BNUB 4EZMA 3C6LA 2X70A 4EOWH 3C60C 5I1KH 4JVUA 3HI1B 4PLJD 1N7ML 1NGYB 3WFZA 1TNNA 4EI5B 4OT1H 2X9YA 2Y5TA 3O9WD 4DW2L 4PLOB 2FLRT 1FHGA 5A3IC 3NFPB 2XWTA 2X5PA 4LIQH 1IL1A 3FB8A 1XCTB 5JQHC 4YHPA 4M6OH 4X4ME 3RL1A 2BERA 3MJ8A 2BOCB 2AAVA 4LLYB 4LPCA 1MJJB 2ED9A 2B1HL 5F7FA 1HHJA 5IVZB 3QUZD 1UEYA 4JFFA 1CR9H 4XP5H 5LAXA 3EIFA 3BAEH 4DK3A 1KJ3H 2PW2B 1DLHA 4ZS7H 3OB8A 3LV3A 3MRCA 5EUOF 3HAEB 2YWZA 1MAML 2HMIC 2BP3A 4D9QD 1FN4B 3ALPA 2WUCH 1BVLB 4GXUM 1G1CA 1OTTC 3MPCA 1FVCA 4MCYA 3GSQB 3TBYB 5EC2A 4PJEE 3NIDF 1JTOA 2JELH 3HE7A 5AZ2H 3D9AH 3IJHA 1S7VB 4Y4FC 2JJSA 5AYUH 3KNBA 5D6DC 5ETUA 1RFDH 1X4ZA 2LAAA 4QOKD 5I8EB 3INUL 1I8IA 2XACC 1TZGH 2DWEB 4GBXB 4WEBL 4Y2DC 5E8PB 1D9KD 5ERWA 2FWOB 3V5DA 2F8VA 1RZ8B 5D2NE 1IEAB 2X2YA 4P2OA 4FQCH 4HFUL 5EU6A 2D9CA 2RB8A 5E8DL 4HIEB 4N90E 4NJ9H 2H1PH 1ZVYA 3MRJB 4JY5L 5C08A 3ULUC 5J12B 5C0BE 3T0BA 1DANT 3G5YB 3P0GB 1F97A 2GHWB 1RD6A 1A1NA 2AXJA 3KHQA 3W11C 3TJHD 4X6BA 4LSPL 1MFAH 4KI1A 4PJ8A 4PJGF 1BD2E 3SJVA 3BXNA 1F4YL 5ANME 1MFBL 3DHJA 2CLZB 3QZWG 4XP4L 5FKAA 5B21A 3RX8A 5HVHB 2IANE 4J1UA 3UTPE 4KAQH 4HFUH 3RWEB 2OTWA 2B0SL 4OSUH 3KPRD 5HTSA 5SWZA 4ZFFB 1T0MB 3CIQA 3EOTH 1RJYA 4N0FB 2V5SA 2B7DT 4HGWA 1OD7A 1VPOH 3ZT7A 2IPTH 3DV4B 4FXKB 4XGZB 1WZKA 3RX5A 3VRIA 1FFNB 4FQLL 3D69B 1CD9B 4OBSA 4OFYD 3MV01 4C59B 3RKDC 1I1YA 1OF2B 3FN3A 4AK1A 1MREH 4MDJB 5I1GH 2FSEA 2YD9A 3RVWD 2PYEA 4KZEL 2QSVA 3GSVB 4P59H 4U1KB 2R0WL 3GSNA 5L9DL 5ACLA 4KFZC 2E27H 4F15C 5DQ9B 5I74B 3D3VE 2DQFA 4H8WC 1WIOA 2J6EL 5F96H 2E7BA 4POUB 3ZMRA 2G9HB 3WHXB 4HV8B 3PV7A 4MMZC 1FJ1A 4ISVA 4PBVC 4NM4H 5KAQG 4CMMA 1TLKA 2C3WA 3RHWK 1TJIL 5JXEA 3SQOH 4RIRB 3U4AA 4X80H 3U7WL 4G6KH 9CGTA 3W0WA 4K8RH 4LFHG 4JKPL 1OTUD 3DYPA 2V17L 4H5SB 2QHRH 4S2SB 1CG9A 3BW9A 5DURB 3QHFL 1ES0B 4RX4D 3MLSL 4JREC 3KJ6H 2J3SA 1UH4A 4H25A 4EI5C 1KB5H 4HK3J 4XP6H 2DM2A 1ZLSH 1A4KA 2GTWB 4NCC1 4JDVA 1BAFL 4G8GB 5ANMA 3BQUB 4M7LT 3EO9L 5DYOB 2R1XB 4BQ6A 2A9NL 4JY4B 4K3GA 1KCVH 2P7TB 3ZSSA 4PRIE 1CG9B 1CZ8H 4G8EA 3CLFL 3IDGB 3GSXB 1EHNA 3Q2CA 1F11A 3JWOC 3O41A 1YEJH 5C0GB 1OAQL 2XYCA 2GJ6D 4G3YL 4XVJH 1KTRL 4JDTH 1PZ5A 1E27B 3C2AL 1DP0A 1ZA3B 5BVPL 1WV7T 4CMMB 2BX5A 4XMKH 4ISVB 2D2OA 4XCCH 1TZGL 2UY7A 3L3OB 4WNQB 2F53E 3HZYB 2ITCA 5EFIA 1TETH 4ONGL 4WGVB 3HA0A 1OAXH 2EH8L 2NXYB 3HE7C 3P0YH 1HK6A 3RA7H 4PRBA 3PWPD 4RFNC 1YEIL 3ZLQC 3BKMH 5LWYL 4PY8J 4YHIB 3SDXF 1KG0B 1MWAA 5GSRB 1DJSA 4MAYB 4FXGA 1OAKH 1IAIL 2BY0A 4XB8A 4HH9A 5JPNB 3QPQD 5D6CA 5HI5C 2FSEB 4MLSA 1H5BB 4NGHH 2Z31D 1I9IH 1DTUA 2J4WH 2XKSA 3ABZA 3QRGH 1PQZB 4XP5L 3CAFA 4J2XA 1DQLH 2FJFA 3O8XD 1KCUH 2F54E 5F7LB 4GSDH 4HBQA 5CJXC 3EJYC 5FUCE 4UOW0 4XCFL 5SWZB 1I1RA 4YBLB 3BPLC 2HYMA 2OTWB 3RWEA 2ZKHL 4M4PA 1P69B 1U8HB 4EN3C 4P0DA 4OFVA 4KI5D 1HSAB 2UWEB 4JG1L 5CBEA 5EIIB 3BXNB 4UIMA 4QHLA 1HINL 4PJ8B 4LCYA 1UH3A 3U79A 4TVPE 1A0QH 4PJEA 5HD8D 3VWJA 4Z0XA 2EIZA 4YFEA 4LNRA 5DK3A 1ZA6B 2Y07L 4FQJL 2WBJC 1U3HB 1NDGB 4HWNA 5LJYH 3WIIH 1DR9A 4FQ1L 2VKXA 2W9LA 4I5BA 3Q5OA 3RWGB 4Y5XB 3OG6B 4FFVD 3KPSE 5GJTH 3Q5TA 3PDOB 1CK0L 3V4UH 5DWUH 2GQHA 4I77L 1FVEA 2WM0A 3SHSA 3MV7E 1MNUH 3FO0L 4LEXH 3JZ7A 1FNAA 2W59A 4R2GB 5FHBL 3JWDL 3ARFD 5I75B 1LP9F 1NBZA 1OWRM 4P5MA 1C5DB 1NFDE 5EZLB 1PEWA 2JJSC 4NFDA 5BS0E 1U0QA 3VXUA 3AAZA 4ONFH 1MHPH 3BUTA 1A7BA 1XF3A 2VR5A 1I8IB 4PP1C 5KVDH 5A2FA 3TJEL 2AVGA 3JWDH 1NCCH 1YEHL 3RY6C 3VH8A 1BHGA 4M7JL 1KFAL 5E2VH 3S6CA 3VWKD 2XRAH 3CXHK 4EI5D 4QXUL 4BFEA 1U8LB 3FRUA 4FZ8H 3VRJA 4AQ1B 1VFBB 1FZMA 1A1OB 1F45A 3B9KA 5IOPA 4OLVH 4ZUVB 3HPLB 1OAQH 1FVCB 4KHXH 1U3HD 2VSDA 1I3GL 8FABA 4IMLA 4MMXC 5EU7C 2MHAB 4NWTH 2IQAA 4CJ1A 1FN4A 2YPKA 2Z92B 5GGQL 3VFRB 3WNPA 5JIPA 4L29A 4MGXA 4P2QA 1IM3B 2DQIL 5D5MA 4JQXC 2X4RA 2IQ9H 1HHJB 5IVZA 3GSRA 3KPRE 2I25N 5HXMA 5T33H 4TUJA 4WV1B 1PZUB 2PW1B 3S88L 4RMWA 3CSPA 4Y7MA 4PTUB 3VFSA 1YC8A 3F6LA 1ZKAA 5SWSE 1A22B 4M5YL 3BKCL 4J3WA 4EI5A 3E3QE 5FOBA 4KUCF 5C2BL 3HI1A 3A6CL 1J1OH 4FQXB 3GMLB 4PG2A 5EBMA 4DTGL 3QQ4B 2VIRA 1NC2A 3GM8A 4EVNA 1UT9A 2UWEF 1DQQA 1DUYA 1F8TH 3I50H 2VDOL 3FT2A 3SDAA 4NHUB 3VI4F 1GHFH 5LVEA 3QSKB 4GW4A 3RKDD 4Z5RA 3WIFA 5JHLH 3TVMC 1CS6A 5I2IA 3VFWB 3SDCA 3U0PB 2NY4D 3C8DA 4ZOCA 1KNOB 4XZUA 3RVXC 5LGKA 2F54A 5DD0L 4JFFD 3IFPB 1BECA 1BFVH 3VXQA 1B9ZA 4ODVH 2D4DA 3QCTH 5ICYB 1UWEH 2FEEL 1JPGB 4Y5VA 3QUML 2CUMA 4U31A 4PJGA 1PX4A 3O45A 4LDOB 3R06A 5KJRH 4F7PA 5FYKL 5IK3A 3BKJL 4WUUB 1N59B 1ZE3C 3CCHA 2ZOLB 2YD1A 1PGRB 4GRLB 1CE1L 1YQVH 3TO2B 2ZUSA 1KBGL 3QDJA 3TCLA 5T1LA 3THML 3V0VA 4AEIH 3GMNA 4YC2B 3GMOA 4NQEA 3TBSB 2MPAL 1S8DA 4XP4H 4EUPG 3IU4H 3SKJL 4OI7A 1H8OA 4WUKL 2OMBA 1K4CA 1G7LA 3STBA 2VZ3A 2VZSA 5DJ0B 1QYGL 4JM4L 1DSFH 4GKZB 2BMKB 1AFVL 3QQ3A 4RFNB 5IJVA 5C71A 4NOBA 1ZHBB 1DVFA 3GIZL 3VFTB 1T20B 4PGDB 3RWHA 5IT2H 3CFDA 5ACZB 5CCKH 5IFJA 3KLHC 1JBJA 3P4OB 2ZCHH 4NRXB 3C5JA 1CIDA 3MQIA 3HCVA 3I3EA 1D6VL 1Y6KR 3CU1A 4HLJA 5B22A 3C6LC 1MCSA 2F74B 1E4XL 3HR5A 5C07E 4QRRA 4M3JA 1IC5H 2YSSA 4QHMB 3MV7B 4JDZB 5F3BA 3SDAD 4MA1B 1DBMH 5CJ5A 5MEPA 3IJSB 5ITFA 1NL0L 4PFEA 2ZCLH 3TBVB 1ZT4A 3QHTC 4XH2B 1FPTL 3ZE1E 4JFXA 1OGTB 2YS4A 3ETBF 4LLWA 5DC4B 3O6MH 1A9EB 2CDEA 4WJ5B 3O4LE 1NCWH 3P0VH 4WTXA 4NQDE 3OKNB 2QADB 1UWXH 3KDMA 2LTQB 1W0YT 4OZ4A 5E94A 2IANA 2DL2A 1EFQA 3UYPA 1MAKA 3O6ML 3CD4A 2FYYA 1F4XH 3DXAB 2A6DB 3DUHA 4LL9A 4H1LA 4RFOL 5D7JC 3F58L 3X17A 4Y4KD 4U1MA 3RY5A 3ZKSD 5CEZH 5HHOB 4LLVA 3RWDA 1TZHA 4GRWE 5BZWB 3QFJD 2H41A 4L4TE 4LRNL 4ZUTA 3GSOB 1RHFA 5C0DA 2YBRB 5F44A 4NN6C 4Q7DA 3W82A 3SGDH 2VZOA 3CH1B 2ITDA 2W65A 1HSBB 3F5WB 2CKBB 4PJBA 5KAQF 1NDMA 4Q9QL 3MYJA 3JUYA 3WUWG 2ICWA 4G7VL 4MA8L 4X6EB 4LAQL 4B7LA 1X7QA 2D31B 1L6ZA 3O6KH 5D2LA 5ICXB 3VRLE 4W6YB 5IIEA 3X14A 3ZDYF 4NT6B 1GJIA 1NBVL 4JO3L 4MQXD 4PV9B 4AMKH 5IHBA 4P9HH 3H3PL 3RZCA 3HRZA 4OCRL 2JJTC 2DBJA 1QD0A 3IU4L 3VXUE 5EU5A 2CGRH 4ZFGL 4O2CB 4OD3H 1A8JH 1B0GB 4X9FA 3TIDA 3L5HA 5E8DH 3SKNA 2XY1A 1ZSDB 1RK0B 3QIUC 2NLJB 2QJDA 3VGGA 1UGNA 5E5MA 1FL6A 1UACL 3K74B 4FXLA 2KH2B 3INUH 1DDHA 4D3CH 5KG9A 1UZ8B 2X4OA 3SGJA 2QV2A 3EYVA 3I6KA 1OP5K 3LKNA 3MRHA 3GI8L 4G8GE 3EJJX 3O4LA 2I60H 3MRFB 1RURL 3Q6FB 1CU4H 1ZGLB 3X3GL 4C4KO 3OXRA 4Y19B 2YK1L 2UVFA 1X5IA 5D71H 4BKLA 1WZ1L 2EDDA 5DD1H 1NBQA 3D25B 4ZAKC 1EHLL 3OXSA 4HHAB 3MJGX 1AQDB 1H0DB 2P5WB 5DUML 4ZTOL 5JHDD 1UENA 1KJ3L 2PO6B 4YBLC 2A6IB 1KCLA 3NCJH 1NCWL 4IM8A 1CXKA 1T83A 5F7UA 1P7HL 2M26A 4DUWA 4E41E 2OJZH 2IH3A 2JTDA 1OTTD 1NCAL 2X1OA 1PG7X 4YDJB 3D2UD 2X4QB 3KYMB 3B83A 1AXSB 4HFWB 2VH5L 4IMKC 3REVB 3WIHL 5JA8B 1VB9A 3B9VA 4KKLD 3X11A 1F2QA 3TGXA 4NHCL 3T65B 3IS1X 2OQJA 5L2KA 4FFYL 4HKJB 3LRSA 4NO0D 4QY8A 4Z78A 2O5ZH 4H20H 2P47B 1I8LA 2NX5B 1AP2A 3BN9D 4PV8B 1WSST 5GRYA 2WWKT 1CGWA 4PLJC 2A0LC 3H9YA 4X6DB 5CEXB 4QTIL 5DGQA 3BD4A 3OXSB 4LRIA 4UNTA 1MCNA 5FECA 4R7NB 2PNDA 1QFUH 4I0PC 4JRWA 5CLWA 1FL3B 4AM0B 1BOGA 4YX2H 1S7XB 3K1DA 5D5MF 4N1EA 5I8CA 5IV2B 3MJ7B 4K8RC 5K9KA 2HJKA 1DBBH 1IT9H 5CZKA 1EERB 1XFPA 3S97C 3SBWC 2IC2A 3T4AB 3EYVB 4LHUB 1BEYL 2NW3A 1DDHB 1J1PH 2X10A 4LBEB 1AD0B 3SO5A 1EEZA 1QR1A 3WFDL 2JJVA 1TCRB 2HJFA 4L8SC 3MGTB 2X7LA 1FFOA 4RQQB 1DFBH 4NKOB 4D9RE 3JV6A 4B5EA 5ABDE 2LU3A 1MJ7L 2GITB 4PRIB 4YHLL 5FUOH 1FZJB 1V3MA 5EZOL 2FX9H 4MXQD 3MODL 3UTTE 5JOEA 4WEMB 3M8OH 3C5ZC 1AKJB 1J8HD 1RULL 5F6IB 2EDTA 2A74B 3NABH 1QEWA 4F7CB 5J9PB 3PUCA 3G6JF 1T5WA 1WCBA 4ELKA 5FCSH 5L8LB 1B0RA 1T21B 2BVEA 4IRJD 4ZS7L 5D2LB 2V2XA 5ICXA 2P1YA 4WHCA 4HBCH 3KPOB 5D1ZB 1CTOA 3BWAA 1LK2A 1N6QH 1EBAA 2FECI 3LH2L 1MPAL 1KIPA 4QKXB 2VDRL 4WU5B 5D1QB 1MCDA 3IXTA 5IGXL 3GK8H 2R4RL 1MHEA 4K7PY 4PJBF 4PJBB 3PABB 3T8XA 1H5BC 3MFFB 3CFJB 4JO2H 3IFNL 4P48A 3QHZL 4O2EA 2P5ED 1OM3L 1NANI 4BZ2H 2R2CA 1RIUH 5FUZH 1UJTA 3MMEB 4JAMB 1L0XA 43CAA 3NN8A 3WDHA 2ARWA 4UV7H 5FGSA 1CGSH 5KANI 2CIIB 2PETA 3BOVA 3GNML 2X1WL 3VFVB 4RCAA 1HNGA 1HILB 1DQLL 3LQAH 4OBRA 4UNUA 3GIVB 5IFAL 1MCWM 5AG9A 3PWPA 5C0NC 3CLEL 1UJ3A 1YNTB 5FO7A 2QKIA 3VXNB 3ZT5A 5E6IA 4OZ4B 1ERNA 1BZ9B 1B4RA 4JM2C 1CCZA 3RUGF 1BWMA 2LFGA 4LLWB 5IHZB 3KLSA 4JFXB 4HMCA 3UTSB 3PWLA 3S36H 5C0AD 2EIDA 1PKOA 3RWCA 2B1AH 2L0DA 3IJSA 3NAAL 3D39E 1WBXA 5EZJB 4FP8L 4KI5C 1ZTXL 5F3BB 3GI9L 4HKBA 1HKLL 1R3KB 2H9GA 2ZUQC 3OKOA 1CDBA 3EO1B 2BVUA 1NC4D 1PG7H 4MD0A 1U6AH 5F8QC 4D2NA 5FYKD 5GRXG 3STLA 5KVDL 3BD5A 4LAJH 4ZS6C 5D2LE 4K3EL 5B3JF 4JLRB 5C0JA 4PTTB 1N64L 1U8OB 3C8KA 3HAEG 4WHTB 1A6WH 3O9WA 2PF6A 4UT7L 2A9ML 1Y0LB 2ZWLT 3AS1A 1CZ8L 5IJVB 3QQ3B 4Y4FB 2DI9A 2IBZY 3IAQA 3F8UB 3RDTB 3TIEA 1T4KB 3DHMA 5DS8B 1P7QA 5E2UH 1OTSD 3JTSB 2YUXA 4OGAD 4LSSH 1JV5A 2A2QT 4NZRH 3WIIL 1P4BL 3SE3A 2DS4A 2JJTA 2H32B 4WY7H 1BQHB 3BP7A 5F7DA 1P9MA 4OZGB 3V0VB 4PGCB 3KPMB 3OR6A 4GRLA 3WO4C 1KULA 4XNQB 1R3IL 3O6FD 4WUUA 2XFXA 1T22A 4JFFE 4L1HA 3VI4E 5JOFA 4HUMB 2FEEI 3V0AC 1R3LA 4MA1C 4PJXA 1BM3H 3O45B 4LPXA 3NPZB 3QXAA 3IB4A 1YEDB 5H2BB 3G5VA 3HFML 3AXLB 5FUCC 4GG6A 1IGYB 1KJ2H 4XRCA 4Y1AE 2QSCL 2YRLA 5FYJE 5CWSA 4P4KD 4KRMB 3QG7L 2BCKB 1OCWH 5DVMA 1U41A 4ZYKB 2EDLA 5TE6H 5I2IB 2CKNA 3QCUL 2FCBA 1IVLA 3OF6A 1OSZB 3DUUB 4UOJA 5EG6C 3MLUH 3KLHD 4OD1L 4MB4A 2NXZC 2IG2L 1FNLA 1X5GA 3WNLA 4KDVA 4OKDA 1DFBL 1FVDB 2DJSA 2EYTB 3L3IB 3SJVD 1Z9MA 1D5IL 3VXOB 1KLFA 3W2DH 1RZJH 2DLHA 1VHPA 5KS9A 3F12A 4HLZG 4GFTB 1J1PL 5FOJA 2UZXB 5B4MC 1XGYH 4YAQA 2P5WE 4KJPD 1H8NA 2APBA 4Z0BL 1IGML 2EECA 2VQ1A 4EXPX 4NJAL 1AQKH 1LO0H 3HB3C 1QSEE 2MTPA 4UQ2B 1GGCL 1H9VA 2OM5A 1AGEA 3ROLA 3ZTNH 1P2CB 3UTQA 1P7QD 4RRPG 4ODBD 2Z91A 3OGCA 1MRDH 3VW3L 5ILTL 1G7QB 1OAYL 2IAMA 4ZTPH 4TSCL 4LKXA 4L29B 4GAYB 4DVRL 4EIZC 4LSPH 1YPZA 4GXUN 4RAVA 3OF6D 3QUKA 3B3IA 4QXGL 2BDNH 4FG6C 1XF2B 2EXYD 5CIPH 3DSNA 1RJLA 3VFOB 3E0GA 2AXFA 3WKML 3K4DA 4MWFA 3LD8C 5EB9A 1HOCB 3L5WA 2F5AL 2JK5A 1CT8B 4IRJB 2BY3A 3FRUB 4PRNB 3HMXL 3H7BB 3HZKB 4Z7OE 2P49B 1NC4A 3SCMD 3FTGA 1T0NB 4JY6A 3MLTA 1C08B 3VXME 3R4DA 1NBYB 5D1ZC 5EA0L 3AAZB 3J8F7 4DQOH 4E41D 2HRLA 3P4LA 4HCRL 4XI5D 1HHKA 5C09A 4PRAB 1C5DA 4LQ1A 4OCWH 3QBTB 5GS0C 1N2RB 5FDWB 5E6ZA 3UYRH 1XGPA 3VFMA 1KC5H 1L7IL 4WCYH 3ARBA 5EO9A 4G8FA 5DC9B 4R97B 4U6HA 4ESKA 2QLVB 3LQZA 5KN5A 3R8BB 3ESUF 4O4YL 2I26N 1UKSA 1KACB 5CJQH 1ZLWH 4JRXE 1AC6A 3IDXL 3PGDA 4PPTA 1T83C 3C60B 4ZFOL 4LGRB 4KZDL 2B2XL 1MCQA 4POYA 1NJ9B 3MRRA 1IM9A 4N68A 3KYAA 3IVKB 1TJGH 1LE5B 2J2ZA 4MNHA 2MJWA 4XVSL 3GZKA 3SGEI 3GI8H 4BK5A 1H3XA 3DUSB 1M4KA 5LCVH 4EJ1C 1HSAA 4KHTH 4F9LC 2B39A 1EFXD 1D6VH 4AIZB 2BVOA 1BIIA 2DJUA 4Y2DD 5C3TA 5C92A 5E8OB 2CIKB 2E7MA 2FJFB 1HN1A 3OKYA 4HLZH 3ZDYE 1R5IA 4MNGB 5KANG 4LHUD 2G60H 1BVKB 4WWKB 1OARL 3MROA 2BOBA 1PVHA 4LSRL 5GSVB 3EYFB 1NAMA 2W0KA 3K1KC 2IALB 5E1AA 4NO0A 2MNUA 5DEGB 4U49A 5T1DH 1VFUA 5HGHB 3A0OA 4FXGB 4YLQT 1N5AB 4Y4HC 5HI4D 4LAQH 4EEEA 4MXWH 5LGJB 3G5ZA 2NY5H 2R9HC 2BSRB 1TQCC 4JM2A 2VABB 4J4PD 2R23A 3VD3A 1RZKC 4P57A 3KWWA 1XCQA 1KPRA 3MV9A 2ITCB 5GXBB 4BH8A 1C12B 4M5ZH 5BXFA 1T1XB 1OAUL 4BFIB 3QULB 4YDIL 4D0CB 1JGVH 1FAIH 4WV1C 3CVHA 3QEUB 2FIKA 2WLZA 4MAUL 5E00B 4J23A 5DF0A 4C54A 4DGIL 1P5VA 1DLFH 1MJ8L 1ZWIA 1FGVL 1EVUA 4U3CA 1JZ2A 2P7TA 3MCLL 3BHBB 4UAOB 1M7IA 3WN5C 4I0KA 2GFBA 5E2TH 5GGVY 4NCDA 4WI4A 1PYWB 1KN2L 3MUZ1 2IFGA 2CMRL 5FA4A 5E24E 2FD6L 3HG1B 2V7HA 4M02A 3TPUB 2BVPA 3B43A 3BEWB 5AYQA 3C60D 3DROA 3BW9B 2EZ0C 2R2EB 1OB1B 1HHGA 3OKEB 2ZCKH 3QB7C 1FYTE 2VMFA 3VE0A 5M94B 5K9OB 1TMCB 3AU1B 1G0YR 5EO0A 1E4XH 5GPRA 5AUMA 5F9DC 4RIRA 3B5TA 1UM4L 3DTXB 4KKAC 3O6FB 1N6VA 1KTKE 4HUKB 5BO1L 5LBSH 5FGBA 3MRGB 2A83B 1MCWW 1QSVA 3BT2H 3UTTA 1NGWB 3DXAE 4MXVE 43C9B 2A6KA 1V7NL 4NP4H 1FJ1B 2KQNA 4PJFF 2VZVA 3O11A 4S0SD 2JB6B 3ARWA 3PIQB 2Q7YB 3SDAC 4TRPL 1BMGA 4HIXH 1GZPA 2FL5A 1QYGH 1IGCL 3SCMB 2QEJA 2XG5A 2DLFL 3ZTJH 3BH9A 4KVNL 5MENB 5HHPA 4U1HA 3SKJH 4K7PH 3SDCD 3BH9B 3IRZA 1U2CA 4MCZA 5HGBA 3NCBB 3HNTL 2DQTL 1NGZA 4X6FB 4QGTA 1EAPA 3CH8A 2Q7YA 4UBDD 4L8CA 3FOMA 1LK3L 3MV8E 3FFCB 4KDTC 2Z93A 3MOBL 2M2DA 2Q8BL 43C9A 5EORL 2HRPH 1ZLUK 1RUKH 4Z0BH 2R0LH 3DOSA 4M1DL 2AJXL 4RAUA 2HTKD 4KXZH 2HT2C 1VENA 3MRIA 4GRLD 1ZV5A 4P9MH 1ZT7A 4ZFFA 4Y1AB 2HKFL 4M43H 4WUUD 5I18L 3EFDH 5FM4A 4J1UB 2JLLA 1I8KB 1X3DA 5J13B 1YN6B 3I75B 2CLZA 5FKAB 1JWUB 1BQUA 3KG5A 4YIQA 1G7IA 4LSQH 4X8XA 4PD4K 5DWUL 2HG5B 1KCKA 4P5TA 4LHQB 5TH2A 5GZND 1I3RA 3VH8G 1MLCA 3X12A 1KEGL 1NUNB 4DEPC 1CD8A 3NTCL 3V6OE 5GISL 1J9CT 3TF7C 2GFBB 1C8PA 1FYTD 5J56B 1R24A 1BFTA 1ND0A 1QR4A 2YZ8A 4R0LC 1IGJB 5FF6B 4XC3H 5C0IB 4M1GL 4I3SH 4NKDB 4PRHD 4K7FA 5B8CB 2YXMA 1I7UA 5HHVH 5JW3H 5FYJU 3KPSB 1HXMA 2GJ6B 4UV7L 5I8EA 4LP5A 2OXGA 5EOTB 4DFHA 3T0XA 2EYSB 4Z7QE 1D9KA 4RMRA 1R3IH 1QP1A 3QXTA 3FHQA 1XH3B 2DM3A 1HDMB 2C1PA 4PJ9B 2VZUA 5CUSL 4LSTH 3MO1B 1WFTA 1YA5A 5CJBA 2UV3A 5GS0D 5A16B 4P57B 3QG6A 5IGXH 1XR8B 4KMQA 4MX7A 4WY7L 4LCWA 5CZXD 3SDXE 2A1WL 3OJDA 4IRSB 3O6LL 5CP7A 3FAXA 4HPOH 4DKFH 4NUGH 3ARQA 5I19L 4HQQL 2VTFA 2PW2A 4NO0B 3MTRA 4MS8D 4JFFB 2CRZA 4R7DA 4U1IB 2HLFD 3IDMA 3QYCA 3DJ9A 1WWCA 5BS0D 2J8UF 2BOBB 3MJ8B 4FTVD 4OLUL 1JGUL 3UTPD 4ENEC 4L3CB 1B3JA 5D7SL 5GS1B 1HH9B 2CDFB 2DKMA 3LKRB 4NPYA 1ZANL 3FB8B 5BMFL 2XWTB 3IT8D 5F71A 5BVPH 3TNNA 4IHOB 3ARVA 3O3DB 3QQNA 3QFJB 3NH7H 2Y5TB 1I85A 3MGAA 2ZPKH 3SY0B 3WFDH 4XVJL 2OL3H 3CMGA 4FQPA 1A1MB 1CQYA 2VL5B 3LOWA 4CGTA 3L9RB 4OI9A 1LILA 3DO7B 3NIDE 1IKNA 1YEGL 4HWEH 4OLUH 1KCVL 4FN0A 4JGJA 2RJMA 5CD3B 2O5XH 3LN5B 3BMVA 1CYGA 4A6YB 5IEKB 4LKCB 2IPUG 5DHXB 2B1AL 5B4MD 3WIHA 2FRGP 3IVKA 4XHJC 4K7PL 1R0AH 1D5ZA 4U6TA 2H32H 3TA3C 2VC2H 4TNVF 1JTTA 1NEZA 1FBIH 1A47A 1ZS8B 3BYTA 4DOHE 1NGXB 2YPVL 4GRMB 1I1FA 1INEH 2NXZD 3QHFH 4D0BA 1BD2D 4U6HB 3EW3B 3BH8A 1RIVL 1CFNA 4QOKE 4Y4FD 1FNGB 3GSNH 2I9TA 4WFHD 3UZEA 5FDWA 4Y19E 2N7AA 2E9WA 3QIBB 5TJWK 3EGSB 1P4LA 2R8SH 4GKSB 4S1RL 4RWYL 2BHUA 1E6OH 4P4KC 4XPGH 2XKNB 5FYJD 4ZD3L 4NN7C 4GRLC 1ZT1A 1NBYA 3EZJB 5D1XA 3RVVC 3PQYA 1IGIL 4CAGA 3Q6GL 1LHZA 1A7PH 4NO3B 3CK0L 5EOCL 4BZ2L 4LCWE 5C0EB 4XB7A 1HKFA 1DQMH 4LU5H 3SBWA 2QSQA 5F7EH 4HJ0C 1PW3A 4J3UA 5DVKA 1ZLVH 4ZAKA 1F2XK 3ARUA 3HNVL 3DX6A 3QUKB 1XF2A 3B5GA 2NTSP 3MRPB 5MERA 1FZKB 4YHOH 4GAYA 3K8KA 3V5HA 2W0FA 5FYKE 4XVTH 1B2WL 1VGKA 2I24N 3TZVC 3U1SH 3KS0J 1P2CA 3UTQB 3WXVH 4JG0H 2BSTA 3S7GA 5INDA 1RURH 3MRQA 2GEEA 5FUOL 3QPQC 1MLBA 2Y6SD 2CR6A 4HXBH 5E2WL 4HWZA 3WDJA 1NFIB 4X6DE 4YXKL 2APFA 1NCBL 1P4IH 4MB3A 1GC1H 4WI6A 4KVCL 2MKLC 5KS9B 3CFCH 3NZ8B 1NH6A 1QFWI 3RNKB 4DUVA 5DMKA 3BZFA 5JW4R 1U95A 2D7NA 2CDGA 1CFTB 1DEDA 3B9KD 5FO9B 5DFWH 2Z8RA 3AUVA 5J3HD 4MJ5B 2J88L 4ODWB 2NY5L 3MLXH 1QFWH 4APQC 4CKVX 4MJIB 1OSZA 3MV11 1MWAL 1O5DT 3P9MA 6FABL 1NAKL 1SYVB 2YRZA 2FO4B 3GMQA 2R4SH 2PXYD 3CSGA 4YNYA 1EIBA 2BCKA 4RA3A 2A77L 1U8KA 2R0KH 1QKZH 3MLSH 4N8VA 4OIAA 2B4CL 6FABH 4NM8L 2YUZA 4XP9L 5HYJA 3G04A 4L4VD 3MLXL 3NACH 5DRXB 4X0KA 4FQCL 3D87B 4XNZC 4HXAL 5DMIL 4PR5A 3MOAL 1EX0A 1H3VA 4Q2ZA 4YUEL 4PBWD 4JZOB 3BQUC 5IROA 4QF1B 5IQ9A 5KSAD 5JO5B 3GRWL 4KHTL 5IHUL 2VJXA 2KL6A 1KIRA 5EDXA 1EJOL 1GGBL 1MF2L 3KPMA 4HULB 3UAJC 2VXVH 2DTML 3UBXI 2QQLL 1CLOL 2CUIA 3B8YA 3IFOB 4PJXE 5TE7H 1FZOB 4F7EA 5CKAA 3NCJL 1WWWX 1P1ZA 3O3AA 4BQBA 2GTZA 4N0UB 3ZE0E 2YOCA 3MXVH 4P46B 3D5OF 4OUUA 3LMJL 3GJFH 2AKRA 2D0FA 3TFKD 1G0XA 3V4PH 1MIMH 4XNMB 5I1LB 2X44D 4JLRA 2RGSA 3B2VL 4LLMB 5MEQA 1HYSC 1QBML 4PG9A 3FFCD 2CO6B 2AABH 4Z7UA 1QA9B 3WV0A 1EK3A 3AREC 4LARL 2YMXH 1HCFX 1J05A 5TE4H 3QZWB 5L2JB 4ZO8A 1C1EH 5CP3A 4F2MB 1QFPA 5JIKA 4XTRD 4UT6L 4JREB 3U2SB 5GRWA 1D5MB 1YZZA 1LO4H 1RMFH 1Q9LA 4EUPH 1AC0A 1EFXB 3LD8B 1SM3H 3A6BL 5C86A 5DLMH 3CSYB 5HDQL 4UU9B 3WFBH 3TNMB 3N1QC 1N6UA 1CL7H 1MFCH 1LO4L 4PJ8D 1D5XB 1B88A 5SX4H 4RA0C 5J4MA 5DTFA 2AXGA 4FA8A 5GGUA 2NCMA 5BRZE 5E6YA 1UQSA 1UVQB 3S3PA 5E2JA 3BSZL 1AD9A 1RZIA 4HS3B 4EUPB 3SDYL 1F3DJ 1JPST 5D1XC 5I1JH 2N7BA 1YYMH 1YJDH 4R4BB 2A0LD 3H42H 2HN7A 3V8OA 5D1QC 1UZ6E 1LEGB 1SJEA 3OJ2C 3MGOB 3WHE1 4YXKH 4TN9A 4LLUB 3BN9C 1RHHB 3GBNH 3GMPB 2WWMD 4D8PA 5CGYC 1IQDB 3LSOB 4U6XB 12E8L 1JZ5A 5DJ2A 5JDSA 3K3QA 5TE6L 5C0CB 3BWAB 4G9FA 1UC6A 3FO9B 4ZMAT 3P9LB 2ZG3A 4WVRA 2Y06L 4KJYB 5EIQA 1QLRA 3S4SA 4ELKB 3E2HC 3JV4A 4NQSA 2OR9H 3RRQA 1X4YA 3WLBA 3DURA 5EULV 3CVHH 5D2NB 2DMBA 4PREB 5IHUH 2PCPA 4LCCB 1JYWA 2R1WB 4GAJL 2OZ4H 4PRIA 1N3NB 1S9VB 4K71C 3O2WL 4GKNA 1G9MC 4OT1L 5I8OH 3TM6A 4I2XA 5HDOA 4ALAH 1KXVC 3PP4H 4H88H 5FV2A 2E6PA 5DVLA 3T0EA 1JZ7A 2GCYB 5D7IF 2Q76B 2VLKB 3TA3D 4QHNA 4U0RB 4YR6A 4UTBL 2J8HA 5DD3L 1WFNA 3IKCA 1JNLH 1HI6B 1SJHB 1UXSB 3GIZH 2J8OA 3QIBD 3U36B 4IDLA 4R7NA 1NAKH 2A6JB 1WIUA 4YGVB 3WS3B 1OAZH 1KLGA 5J57B 3ORJA 5I76B 3W9DB 3QDME 5IB1A 3QUZC 4LF3B 2XV6B 1NSNL 4F37F 4JRXA 4X7FC 2X1XR 5E8NA 1AH1A 4Y5YB 3GMPA 4ENED 4N0CC 3MGOA 4YFLF 2O5YL 5KTEL 3DX8A 3DIFA 4UAOC 3WN5B 4QRPD 1D5IH 1UCTA 1ZTXH 3ZDZF 5JDJA 4RDQF 1GH7A 3SOBL 1MCLA 2X09A 1CVRA 2X4QA 3KYMA 3W0WD 4YHZL 4OD1H 1BGXH 4YZFE 4OZHA 1IFHL 1E28B 1F6FB 4EKXA 3ZSTA 1JGUH 2YD4A 5GQBA 4QRTA 4Y16B 5A43C 2VR9A 3HNTH 5I16B 2FX8L 3VGBA 3MBEA 5CJOH 4F7TA 2J8UB 5B38B 5HHXL 4U4BA 4LLQB 5CBAB 1T1YA 5IB3A 3TNMA 4FQQA 1RVFL 5BV7C 2X05A 4CN6A 4K3JH 3BRFA 1RAMA 2EIEA 4OGXH 2ATKA 3WS6C 5A2IH 1FFPA 5DJYB 3RBSA 3FFDB 3LQAL 1S9WA 5CILH 1RQ5A 1GAFL 5E4EC 1K3IA 2JIXD 2D7TL 3W5NA 4RAHA 3RTQC 2V5YA 4XBPA 1BBJA 5I8OL 1G6RL 1K9TA 4I4WB 3ILPA 4DVBB 3PHOA 2NLJA 4LLMA 5K93A 5MEQB 1GAFH 3KPNA 5C0ND 3CSBA 4MD4B 1ZSDA 1IGTB 4QRUA 4MSWA 3OR7B 1RJZB 4HEPG 2AKRB 5KOVC 4NQDA 3U4BL 3TIDB 5I74C 4OGXL 3VWJD 3D48R 3HN3A 4Z7WB 4S11A 4OFYA 5MHSD 3NCEB 4NDMA 4HWBL 4U7SA 4X4YB 4LSSL 3T2OA 1EPFA 5FB8A 4ZSOA 2XZQH 3T04D 4J3TA 5I1HH 5K59E 2O5XL 4M8QB 2ICEA 1C5BH 5EH1A 2ICWB 2X4UB 3QJHB 3SKOA 3ZE1F 3ULUH 4X6CF 3V6FA 1OQXA 3IRPX 4S10A 2W60A 1SEBA 1I75A 1WIPA 3EJZD 4DGIH 3NH7L 1TTGA 3JXAA 3L7EB 3V8CA 3ZYJA 5LQBH 4XCYA 5GS0H 3SE4C 2BY1A 3KPRB 3BZ4A 2CKBL 4WO4A 4OF7A 5HYQA 3S96B 5C0DB 5D7SH 3D2UB 4NUJA 3HNSH 1ADQA 4Y8DC 5FCUH 1TZHB 1KGCE 3GFUA 5TDOB 3RWDB 4QT5B 2HFFA 4X0KB 1CICA 1KB9K 4YZFF 4ERSH 1T6VN 3JSSA 3WFHA 1S5IH 4H1LB 2QTEA 1KPVA 3G04B 5ADOL 1VERA 4NZTL 1KTDA 1A7RL 1E4JA 5EOCJ 3O6LH 4LPWA 1JUFA 5JLZB 3KVQA 3KDMB 4YNYB 5CMAB 4CJ0A 5C7XL 3ULVH 3I6LE 1A3RH 1LE9A 1SYVA 1FIGL 3N85H 2CPCA 4Z77B 1SJVA 3ARDD 2ORBL 2V5RA 3KYNB 4XH2A 5FYKU 1C16B 3MV8D 3E1F1 4ODWA 5CKGA 3B6SA 1OGAB 5FO9A 3BMWA 4FFYH 2D0HA 3K0WA 4JKPH 4JDZA 1SMOA 5DMKB 4TNWF 4GMSL 3PNWA 4U05A 3RGVA 2QR0A 3VXUD 1FG2A 4JO1L 1CDIA 5FUZL 5LBSL 1NFIA 3UTSE 3ARDC 1RZJC 4Z7UF 4OZFH 4JJHA 4PGDA 3RVWC 5INDB 2ADGA 2BSTB 4JFQB 3PE9A 2BMKA 2XZCL 3OAYH 1QLEH 2AJ3B 2IAMC 3IJYA 5E8EB 2P48B 3WNKA 5DJ0A 4BQ8A 4RNRB 5IESL 1FZKA 3MRPA 5MERB 5INCB 2AERT 2ESVB 4X8JA 1CLYL 15C8L 4ZAKB 5SWZE 1FLRL 3LKPA 1U42A 3HC4L 2CK2A 4NQEB 4KK6C 3QO0B 4NNYA 2KDGA 4DN3L 1UM6H 1FDLL 4GMTH 5I30H 3BP5B 4M7ZC 3LN9A 4NO3A 3TO2A 1D3CA 2V2TB 3FB7A 4G42B 4F7MA 4O5LL 4PRHB 1EGJL 4ZOBA 3CCHB 2Q8BH 4PS4L 4LPVA 5IK3B 3T77A 3G6JA 1SBSL 1YEFH 3W11D 3N1GC 2FEDD 1HQRA 5DEFB 3DMMA 4M5ZL 4GOSA 4S1QL 4UOW1 3D39B 5F72S 4AT6B 5I8KH 1ACYH 1K5NA 3AS2A 3HE6A 3LKSA 1AJ7L 5BVJA 3VD4A 3D6GA 3WL9A 4OLZL 4V1DD 1CDYA 3VCLA 1JK8A 2YEZB 3W9EA 2EDBA 4QCIA 5EN2A 3OGOE 4Y16D 2HVKA 3WYRA 4R4NC 4LVNB 5DHVB 3V6BR 1RV6X 3L3DA 1MI5D 5MI0C 3FT2B 1INQB 4RBPH 1UB5A 4QXTA 3P77B 1QBLH 1OARH 3T4YA 5TE4L 4J3XA 4OZIA 4P2OC 3GM0A 2NPLX 4GBXD 3ZHLA 1GC1L 2GSIA 3QUYA 5EUOA 2X41A 3MLYH 4FQXA 4FS0A 4OCMC 3SY0A 1JHTB 2EEDA 1Q9WB 3IDJB 1RIHH 3O3DA 3DVNB 5SV4A 4WFEE 1WJ3A 1W8NA 2E7LC 3QIUD 5TFSL 1A6AA 1RFDL 3GMMA 4N8CL 1YMHB 5C0FA 2DQCH 4MJ4A 3RUGA 5D7IA 4L3CA 5DUPL 5GS1A 1F4HA 1X5KA 2OJZL 5DC0A 1LEKB 2BNQB 1SY6H 5ESQA 4OGAC 1XGUB 3QUXD 4K23H 2HWZL 3WEXA 2AV1B 2XA8H 2VLRA 5F96L 2Z35B 2VKWA 1YECH 4PJ8C 4XNXL 5CSZA 1CIUA 3DO3A 4K9EC 3MCLH 1JF1B 5L88L 2OK0L 1TQCB 5CP7B 2YK1H 3L95A 2QQLH 4PJ7E 2DQCL 4KZEH 5IP4A 5D2NC 1XR8A 2XQBL 4U1LB 2OR8A 3OHXB 3WJLC 5J8OA 2GJ6E 4KGLA 3U46A 5JMOC 1MFEL 1TFHA 1EJOH 1GGBH 3JWNC 3MO1A 3LEXB 1FGNH 1DBJH 1KT2A 1U8LA 5HI5D 2ZSVB 5DUPH 1EMTL 1RUMH 1MHHA 1J5OH 1CGXA 5EOTA 5C1MB 2QQQA 1WBZA 4QOKA 4XNUH 3DX9A 4FZEL 1Q0YL 2QADC 1I7UB 2VDQH 3MA9L 4U1GB 5L6YH 2X42A 2ZOKA 4R90L 4QNPF 5DRZA 2AJYL 4XXDB 1B6UA 4HKXA 2R69L 4R26H 2R1YB 4I0PA 4BSJA 4G9FE 4WFED 3QIWD 4HK0A 4Q6IC 4L3AA 2OBGA 3GUTA 3P4NA 1F4YH 4LASL 1F5WA 3D85D 3OL2A 3HUJE 5LXGL 3CFKB 1FIGH 2VC2L 2HP4A 4Y5XA 4NZRL 3EDKA 5J89A 3GJFB 3HRPA 3X12B 4QXGH 3DRTB 4LSRH 5DJZA 4X6CB 4YHNB 1ZA6A 1YN7B 1QFWL 1VCAA 4ZXBC 4YH6A 3WJJA 3RU8H 5SWSD 3ZZ1A 4HK0B 1SBSH 3FO1B 3E2HB 3WLWD 4J3VA 3I75A 1JWSA 4H1LG 4PS4H 4XNYL 4HWBA 4WI8A 5F1NA 1EBPA 5TQ0H 3X3FL 5KOMC 4NKMB 5F70A 4CNIA 2AQ2A 3C6LD 1ZT7B 3O8XB 1MEXH 2YZ1A 3ARZA 4OQ1A 4DOHB 4MYWB 2X9WA 4WEBH 2Z8VC 1JHKH 5CEZL 2Z93B 3PV6B 1BQLL 5EC1A 3UJTH 2JE8A 6CGTA 4L8BA 1G6RA 3QCTL 2B2XH 3NAAH 1EAPB 4X9HA 1YEKL 1NGZB 4KRPD 3VI3F 4UT9H 3CX2A 4HQQH 3VA6A 2BXYA 1A3LL 2UZIL 3L95B 4LRIC 2OYPA 2OX5A 3TO4D 4MCZB 5HYSB 1C7SA 4Z7QF 5F9JA 3BKYL 4GT7A 4UQ3A 1CLYH 2Z31A 1KJ2A 4MAYA 2YPLD 4DGYL 4Z7VB 1HZHL 1QFWM 4X5WA 2NXYD 1J1XL 4PRBB 2NX5D 1UEMA 4K2UL 4W4OC 2FL5B 3RNQA 4D9LL 2BNQA 1LEKA 3BAEL 4M8VA 5IR1B 3MJ9H 4P2QD 1U9KA 3V0WL 4G6JH 1HWHB 4NCC2 4OLWL 5DXWA 3VXPB 2DMCA 4RGMB 2VB5A 1AHWC 3BPCB 3V5DB 3VJ6A 1KOAA 4KTDL 1ZA3A 4TSBL 1UWGH 3HMXH 2GSIB 3L5IA 2B20A 4JR9L 1S9YB 1MCRA 1CE6B 5EO0B 2ESVE 3HMWH 3PGFH 1AO7A 1V3LA 2AW2A 4OZIB 3T4YB 4D94A 3F7QA 1F58L 4QXTB 5C0GA 2F5BH 4NQCE 2IQ9L 3DROB 4L4TA 5EU7E 4E5XB 4TVPD 4YK4C 4JM4H 4OFIA 2BVPB 5I1CH 4HPYL 5ANMB 3OAUL 1MRDL 3G6AA 4WI3A 3VW3H 3UBXG 1K8DB 1T7YA 3ULVL 1R0AL 1YEEL 3FCTA 5CIPB 1OPGL 4ERSL 3ECBA 3FQTA 3WL9B 4CMHC 3KJ4C 2BHYA 4ACPA 3NABL 4JFHE 4PRID 5GRUH 1LP9E 1WK0A 4M9PA 4WWKD 3HNSL 3O3UN 5ADOH 2YD2A 1A6ZA 2Q6WB 4O02L 1ZWIB 4NRZB 3DMMB 1T66C 3RKPA 4M93C 3P73A 4NYLA 2X4NA 1M05B 2GSGA 4UIKL 3VD9A 4HMDA 3B5HA 3P11H 1NAMH 4I3RL 3EYUL 5FYKH 5D93C 4WTZA 4L3EA 2A73A 4BH7A 3FONA 2YUVA 2FHFA 2WIIB 4D0CA 4JPVH 5KTEH 2ATPA 3AC0A 5D7LD 4X7TA 5BXFB 4WRLA 1C12A 3BP5A 3MRBA 5J1AA 1NLBL 3MRMA 1QHOA 1CLCA 4P2OD 4U1SB 5HGDB 3QIBC 5DSCA 2DQJL 5IVOA 3PWPE 2VABA 3V6OC 2VZTA 1JZ8A 5I17B 3GKWH 2DQFB 1C5BL 1G84A 1T89C 1F3JA 3EYQD 4HMEA 4X8JB 2P5EE 1BVZA 4ZO6A 3MC0A 3GSNB 4WDIA 1ORSA 2YR3A 3GSVA 5SWQA 1IARB 4P2RA 3O2VL 2PYEB 2GK0B 2PTTB 3S35H 4MNGE 1SHMA 1WVZA 1PJ9A 1QUNA 2ADGB 1I1YB 3U0WL 3MROB 3IDUA 1RZ7L 5KSAC 2P5EB 4HZLA 4PJEF 4D9QE 1A6VL 1FIEA 2O5ZL 5C0CE 1S7UA 1GGTA 3GHEL 2HMID 1Z9LA 3PWNA 5DMJB 1FG2B 1MI5E 5EPMA 4A6YH 3PWJB 2G2RA 4J8RB 5MHSE 3BPLB 3KPLB 5KSAB 3EYSL 1LO3L 3U0TA 4YDVA 1K85A 5IMOB 1G6RH 3EOAB 2PTUA 3MRLA 4MVBC 1OGAD 5T3XD 1AGFA 2OL3B 4KY1L 2HFGH 1S7TB 3SQBA 4JN1L 1VDGA 4NN5B 1JWMA 1LE5A 2R56H 5ADPL 4BJLA 3VDCA 4ZDHB 3T08A 2F19L 3MV9E 4KMTH 4TULL 3BKYH 2CLVB 2F58H 1U8JA 1RVFH 1GYAA 5LWYH 5CGMA 3L7FA 3QISA 5D1QD 3MCG1 2H3NA 3SKUD 5D71L 1A6WL 4JGMA 1CFQB 2IAMD 3LQZB 3MRJA 1Q8MA 3OKKB 4I13B 4HT1L 1F4WH 3EUUA 3MODH 1UZ6F 4Q6IB 1KPUB 2H26B 4KRLB 3KYOB 1L9NA 1PG7L 4NUJB 1I1AD 1IEAA 4RX4A 3O2DH 4ONFL 3FB5B 4PRAA 4OZIF 4CADB 3FT3A 3BZ4B 4OLYL 4Y4KC 3MREA 1P7KB 1RZGA 4HS6B 3SE4A 1PEZA 5I1JL 2YC1B 3VXSB 5DUBB 1L9MA 5KVMC 1VEOA 4PRNA 2P8MB 3U6RB 4A2MA 1ZAGA 3KPQA 2HH0H 3V52H 5FYLD 1S7QA 4MCYB 1B4JH 2FH8A 1RJLB 5H35B 3D85B 3TH4T 2VSCA 4NNPL 1XZ0B 2FX7L 4LMQE 3CPLA 3VA2C 1AHWA 1IC7L 2VLLA 1E4XI 3B3IB 4OZHE 3H3PH 2K3TA 1A6UL 4FQJH 1E0OB 2Y07H 5K9JL 3CLEH 1WTGT 1IGCH 1AXTL 4XP1L 2F9BT 3V2AR 1A2YA 4P23B 1EVTC 3OGCB 2Z91B 3U4EA 3QDGD 3L1OH 3DARA 4CN4A 2BRRL 3RVVD 3ROLB 3I02A 3DI3B 4NQDB 2BOCA 4LLYA 1RJZA 4RFEA 3Q1SH 5JTWA 2DIAA 1CF8L 4MD4A 2WINB 2VDLL 2DI7A 3NFPA 1EAJA 3SE8H 4IRSC 5J13C 3ILPB 4DVBA 2VDNL 2WUBL 2O93L 3M1BA 3NPSB 1U58A 2LQRA 1R5VB 3WUWB 4XBPB 1XIWB 4KQ3H 2DWDB 1QBMH 1G7PB 4QRQB 3CXHJ 5TPWL 1FVDA 1AGCA 2EYTA 3L3IA 1FO0B 4PJDF 1S9WB 4NSKB 4JRYA 2DQEH 1I9IL 3F58H 2IPKA 1YMME 4PRPB 1UCBH 5IF0B 5J06A 5T5FL 2DQGH 4G5ZH 5D93B 3OMZA 4NNXA 5L7XL 1AHWB 4EN3B 2WBJA 4EBQH 1IZKA 1EXUA 3FN0L 3SDCC 4YXHH 1BF8A 4L9LC 3LHPH 4ODXA 3WBDA 3M8OL 1JGEB 4F7TB 5AZEH 12E8H 1T03L 3MLZL 5I1DA 3ZE2E 1TTUA 4OZIE 1XF1A 3ZKMD 1VSCA 1CLOH 1FGVH 2DBLL 4X5LA 3RWFB 3VXSA 4OZHB 1CFSA 5SX5K 1TETL 1J18A 2IF7A 4ONGH 1RPQA 2XA3A 4ZFZA 1YEDA 3UC0H 4Z7VF 1X6NA 4Y5VC 1I7ZA 5F1KC 3TT1L 4FNLH 4LVNC 2DD8H 4L4VB 1TNMA 4QRPB 1DBKL 1MEXL 2ZUYA 1A9BB 2XFXB 3LPGA 1DANU 3SGJC 2EIBA 4Q6IA 3C5ZD 1X5XA 5E4EB 3ME0A 4ZUUB 4G6AD 3S37X 1WFUA 3AMKA 1CFQA 5IROC 3Q1SL 4GXVH 3U9UA 4OZGA 2EZ0D 4X99B 3FQRA 3CDGA 3VXTA 2NY4C 4FHBD 3LQMA 1U8JB 5J3HC 2ZUVA 2AEPH 4CDHA 2CLVA 5HJ3B 4PRPD 3QUMA 5DLML 2NY7L 2OTUA 3WS3A 1JV5B 1ZLSL 4WFHE 1OAYH 1I3UA 5HGAA 4U33A 3HLAB 5M7QA 4GXVL 4P9HL 3TIEB 2DYPB 3RIAK 1JZ3A 3WFBL 5GGVH 4H20L 3QQ9D 3IKCB 1U8NA 2DRUA 1SM3L 3A6BH 4ZSOE 1S7RA 4K3DL 3VFPB 4LSVL 4YR6B 3O9WB 3SJVE 4WHTA 4N0UE 1QRND 3U0TB 1YEFL 2FZ3B 1HHHB 4UMGA 5KVFL 4PJCA 4CVUA 5JNYB 5KVGL 1V7MH 5EPMB 2GYSA 5K59F 2HVJB 3OB0K 4QHUB 3STLB 1QLFB 4ETQA 3BDBA 1BLNB 1IAMA 5T3XE 5AYUL 3RTQB 4GKNB 4JFZL 2VE6A 1DQDL 5JORA 4IDJH 1T1ZB 1UB6A 4OZFG 5EZJA 2PCPB 3MLUL 1FV1A 4X7SH 1E6JH 2CLRB 4BFBD 4HIJA 5D2NA 1AO7D 2GK0A 4G8IA 2CSPA 2EH7H 2W0PA 3OJVC 4RFOH 3UTSA 3EZ8A 5H8DA 4NQXA 2DAVA 5H37H 3MLVL 5L9DH 4L8DB 1L6XA 2VXSH 5HVWA 4MNQD 3P9WB 2HT3C 2VDPL 3FRPG 5CJQL 3LHPL 4G9FB 4P3DA 5ELIA 1GVIA 1YNLL 2NY6D 4XCNB 3BVNB 3TN0A 4NO2B 5DSCB 2V7NB 1Q9KA 4IIQB 1G9NH 4FQIH 1KC5L 4M03A 4OIIL 2QSTA 4JQIL 4FQLH 2RBLA 3CU7A 4J3SA 1AGBB 3QXDA 2ATPB 4QNPE 5DZNA 5DQJB 4PB0L 1NGQL 5KSUB 4PY8I 1RIHL 4WEUD 5CSBA 5KVGH 3PWUA 4H26A 3D1MC 3RAJH 3NBNA 3ULUF 4R96A 4Z95L 5DJCA 4PYGA 1CF8H 4R4BA 3C5SB 3BKCH 4PJBE 4XPGL 7CGTA 3PWUB 4H26B 3UXFA 3MMEA 1NQBA 1RU9L 4P4KB 2ZCHL 3MFFA 1M7XA 1RZ7H 3WD5H 5T33L 2AXGB 3BJ91 1Q9KB 4PRHE 5DR5L 3D0LB 4NO2A 1RUQH 3WMSA 1INEL 3OBAA 5FYJH 2AEPL 4PG2C 3G6AB 2V2XB 1B4JL 3QNXB 1WISA 1IC4H 5E1HB 5TF1H 5C07D 4HX1A 3U7YL 4FABL 3NZHL 2HT3D 2ADFL 5KSVB 4F7CA 2FX7H 1ACYL 4LCIL 3UTZA 1Z0MA 4G8IB 4HG4J 3FT4A 1Y18B 3U2SA 1A3QA 5GGRB 5C0RH 1UB6B 2GITA 2HT4D 3NA9L 3QIUB 4HK3N 4MXVF 1J05B 5L2JA 3ARTA 5T3XL 3H9SB 4XAWH 5F88B 5HPMA 1NCCL 1YEHH 5HDLA 4Z7UB 3MGTA 3T2PA 1MHPL 4NQCB 4NC1E 3QNYB 4LBEA 3H6JA 5ISZB 5GGTA 5IR1A 2Z31C 3D9AL 2ZUQB 5CHNB 4RZCB 2WP3T 4G6AC 4YPJA 2IADA 4HDIB 4MJ2A 3MJ7A 3FMGH 4RBPK 4Z7VA 2QQKL 4YFDB 1T6WA 2Z31B 4ODTH 4AM0A 3VFGH 4X9BA 1DN0A 1F42A 2ZNXA 4NQED 3HLAA 5HYSA 5HGAB 5E9DA 3N9GL 3TN0D 5FECB 4KQ4H 2VOTA 4CRPA 2QQNH 3QUMB 2J7LA 4K7PX 2NX5E 3F6IA 3IFOA 5DMYA 3CDGB 3KXFD 4L8BB 1S9KC 3FQRB 2ZZUT 2EDNA 1J10A 1Z2KA 4P2RD 1M6OA 3JBG7 4M6OL 1GHFL 5CEZE 4ORGA 4ZUUA 2Y25A 2DIBA 5DJ6A 1UM5H 2FB4L 3EFFB 3ZDXE 4Z78B 4QY8B 3F7YB 1EZVY 4JFHD 4XPHL 4KJPC 3H9HB 4ELMF 5AAWA 1A9BA 1R6VA 1YY9D 1X5FA 1J1OL 3DLQR 4JZOA 5IQ7L 1FSKC 1OM3H 1JWSB 2NY1C 3RPKA 1E6OL 3FO1A 2H8PB 4J3OC 1AXSA 1CGUA 1JNNL 5SX5H 1A6VH 5CLTA 1I8LC 3DV6A 5BOPA 5C70A 5HYJB 3N85L 4MQTB 1IAII 2MCPH 1RIVH 1RZFL 3ARBD 4NBYB 3GJFA 1U8KB 3JV0A 1J1XH 2ESVD 4MAYD 3RUGE 2A6IA 3BQUD 1VFOA 2WBJB 3MJ9A 1NFKA 3MNZA 3T3MF 3M07A 4NKIH 5T1MA 3BKML 2DJ4A 3IDYC 2JB5H 3I85A 1U8PA 3Q6FA 1ZGLA 2BC4A 2D7QA 3ALXA 4NSKA 1H3TA 1K6QH 1MH5A 1TZIA 3KR3H 3QEGL 2CDGB 4QRQA 1G7PA 3FQNB 4YO0B 4QOKB 3DGGB 3QDGE 5JUEL 4OV5A 3TJEH 3BP6A 4IRZH 1U6AL 4PJ9C 4JJ5A 5C0BA 3DX7A 2ZPKL 3TA3A 1UKQA 4LFHD 3DRQA 1RK0A 3QPXH 5EORH 4XMPH 5MEND 3LZFL 4WW1B 4RFEB 1KB5A 1QHPA 1DEEB 5JZ7C 5BMFH 1D7FA 3SKNB 1HQ4B 3E6FA 4YE4H 3CLFH 3HS0B 4LCCC 4AY0A 1QSFB 3REWA 4LEXL 1VGKB 4O2CA 1JF1A 1YUHA 5CSZB 5CD5D 4BSVB 1UA6L 4NFBA 4AIXA 4QTIH 3HE6D 1WICA 3TYGH 3RZCB 4U1NA 5HHQA 2VLRB 3WEXB 2ZG1A 3NOIA 2WNGA 3CXDL 5IIEB 1ZHLB 2KZWA 3IXAA 4KY1H 2DLFH 4TVSa 3BEVB 3EJYD 4YQXH 5ESQB 3U48A 2D31A 4H8WL 4APQB 4GG8A 3RIAF 3KPQB 1QNZH 1NDMB 2P44B 4OCXH 5BW7C 4J4PA 5HHVL 4Q97A 5JW3L 5DUBA 4FFZL 1W8OA 4UI2A 1LDPH 4PJ5A 1F58H 1Q9OB 3PQYB 3JVGC 4GBXC 3QA3A 4JG1H 4UILL 1XR9B 1CGSL 3MREB 2BNQE 1ED3B 3FL7A 4XNUL 4J7RA 1UM4H 2ARJA 5EO1B 3DYOA 1INQA 1F02I 1M1SA 3MOQA 5DO2D 1J5OL 4JFEA 5HHOA 4OLWH 3CVHL 5EU4B 4IOSD 3OKKA 1G9NL 2HVKB 5D7JB 1VACB 5IBTL 4PGEB 5IM7A 1WGOA 3QNZB 1J7VR 2H3NB 2ADIB 3BN3B 5DUMH 3BO8B 5CP3H 1OQOA 5DHYA 1Q0XH 5E94B 1N5YL 2W9EH 1NEZB 5DD1L 1YMMB 4HS8H 4OGYH 4OF0A 1R3HB 3KLAA 4ODTL 1NKOA 4R97C 4ZDHA 5IB2A 4LKCA 4A6YA 5KZCD 1T04A 3UPRB 2HWZH 1YEIH 2BSSB 1ZT4B 1BGXL 1SY6L 3BZEA 2W07A 3MRNA 1MCKA 3T1WA 1K3ZA 3MRLB 4IJ3C 3UZVB 3IAGC 2VL5A 2ZG2A 3H42L 3GBLA 5DVNA 2F74A 3G08A 3PWJA 3W5MA 3VGDA 2V2TA 4LEOB 3HCVB 5DZLA 2PO6D 4NQCD 3QEHA 1S7UB 4LSVH 1U91B 3PHQA 5FAAA 1LEIB 1P6AB 1QFOA 2BRQA 5T1KB 1HH9A 1PKQB 3LDBB 4PJHB 2DL9A 3DI2B 4HJGB 4XNYH 3LKPB 3ARSA 5F1IA 2EDFA 3V4UL 2ARJQ 3QDJE 4EDXB 1EGJA 3DNKA 4R7DB 4U1IA 4Z8FL 5FKPB 2PTTA 3RX7A 3C5ZA 4OAWA 4MXWL 4RNRA 1NBVH 4JO3H 1P84J 3LEYH 4WDIB 5AD0B 3J7HA 4OAWB 2VR4A 5DD5L 4GAGH 1FYTB 3QUXA 2Q20A 4G7VH 4MA8H 4EDXA 2FDBP 3O2DA 4ZXBA 2Z8SA 3TBSA 4XNZB 5T1KA 3GMNB 4PGZA 4GG6F 4Z7WE 4UTBH 3GEWB 2YPLE 3MRMB 4S1QH 5J1AB 5F9AC 1GOGA 1B6DA 4P5KA 2EYSA 4KTDH 1AY1L 3RGVB 3QWRA 1E4KA 4YGAB 3G08B 5MP6L 3T1FB 4F57L 2J5LC 3CJJA 3PGCA 3H9ZA 4N5ED 2A73B 4BH7B 4JVWA 4HC1H 2WQRA 1OW0C 4XT1C 4K7FB 5I0ZA 2OZ4A 4P46D 3O2WH 2BVYA 4AH2B 2X4NB 1OGAA 2J4WL 3QRGL 4I18C 1CWVA 3BZEB 5D4QA 4NM4L 4NQDD 5JIIA 1QBAA 4OIIH 1T04B 3UPRA 1JPGA 4MA7L 1D6EB 3HI6L 4EN3D 5F9OH 3BYYA 1FCGA 4LGPB 2Y36H 1ND0B 1FO0H 3K80A 4I0PD 4CW1B 5JLZA 5DHYB 1LWRA 3BO8A 2ADIA 4U6VH 4UT9L 1XF4B 3TO4A 3X13A 3P0YL 2EKSB 4X5XA 4KWUA 1I3RB 5TH2B 4PGEA 3SDCB 3EDFA 3VFWA 4YDKL 1OOAA 1CU4L 5D9SB 1TQBB 2K9UA 4E5XA 3WFEL 5EU4A 1WBYA 1AIFB 5TGBA 4YIQB 1F3DH 2R29H 1VGEL 3GBNL 1YN6A 4PJ9D 1I8KA 1AO7B 1CE6A 4OJFH 2VIRB 4M1CC 4Y1AA 1YPZF 2V9TA 4ODUA 4PLKC 3GSUB 3L7EA 4JHBA 1Q9OA 5FOBB 4O9HH 4PJ5B 2IMMA 4X4MA 1ETZB 4KRPC 2EDRA 3PHSA 3ZYOA 3V6FB 5DMIH 3VXPA 1ADQL 4OSUL 4GG8B 5SV3A 4WV1A 2ICEB 3QDJD 4G43B 2X4RB 5F7YC 4NWUH 5FB8B 2X4PA 1CL7L 4U7MA 5F9JB 2Z92A 4YHML 2YPKB 3EKCA 1J8KA 4B7IA 2BHZA 3E6FB 1ODAA 1GZPB 4NZTH 4H0GA 1KB5B 4MSWB 1VESA 1JNHB 1N0XH 5IOPB 3PL6A 4IS6B 3O11B 2EDWA 3O3BB 1UYWL 4FQXD 5F89A 3OPZH 3BFOA 3VDAA 4JJ5B 2ENSA 4TTDD 1CXHA 1U36A 2Q8AH 2VDKH 2AK4D 4CNIB 2BNRB 4NKMA 4LDEB 5EZLA 5K9OA 1A7NL 1FFPB 5DJYA 3PWVB 4JZNB 2XPGA 4Y8AA 2JCCE 1A4JA 1ZHNB 3DVIA 5GJSH 4X7EC 2IG2H 3MXVL 1REIA 1O0VA 3D18B 3EO0A 2V7HB 5CBAA 4YHNA 4X6CA 1ULVA 5AZEL 5FA4B 4OFPA 4KROD 1PYWA 2XA8L 4EBQL 5IBTH 1MY5A 5T5FH 4LNRB 5A40E 3I50L 2HFGL 1KXTB 1RI8A 2VXVL 4NQVB 1BQSA 1VEPA 2EDYA 2B1HH 3LKOB 5C8JB 1JYNA 2R1YA 4I0PB 3HI5H 1NUDA 1GOHA 4HKXB 3UPCA 5CBEB 4YWGL 2UWEA 5J12C 5MEOA 3DIFB 1QSFE 3DX8B 1IAKA 3I3BA 5C08E 5E03A 3DX9B 1CLZL 4ODHL 3SDDC 1WBZB 1T80A 4Y5YA 2NR6D 5KS9F 5DJ6B 4R2GD 1WITA 3QUXC 4WO4D 2E6JA 4FQHB 2VQUA 5EA0H 3BX7C 4LHJB 3MV9B 1M6OB 5DK2B 2OP4H 4ZNEA 4PD4J 2R23B 3S35L 3FN9A 3CGTA 5T3ZE 2BSRA 1AXTH 4MNQA 4XP1H 3BPNC 3LEYL 2CK0H 3LB6C 5E9DB 4YQXL 5GGQH 3RWIA 2P5WD 2DLGA 4G7YL 2QBWA 4JY5H 2ZSWA 4XBGA 4UNVA 3MZTA 1IGMH 1V8HA 2F53B 1MJUL 1NAMB 1MUJA 3OX8A 1XGUA 2HA1A 3P30L 5GS3A 2C3VA 5CHNA 4R9HA 3H2WA 4Y4HD 1RZJL 2W0LA 5IB5A 3DVNA 3IDJA 4CVZB 4I2XB 3T0VA 1IMHC 3UTTD 1XGYL 3TBWB 4AZ8A 4GG6E 3QUYB 4GMTL 2BVOB 5EUOB 1PZ5B 4LCCA 4OLXH 4ZOEA 1SBBA 3ELAT 5I1HL 3W81A 4G6FB 2AJVH 4G8EB 2C3HA 2VAAA 2RHEA 3CMOL 5KSVA 5CZVH 1XGTB 4HX1B 5DD0H 1NJ9A 3MRRB 1D9KC 1MVUA 2NMSA 2I5YL 1ZHKA 4QCIB 4R4ND 2YPLA 3P9LA 1JMXA 1A4KB 2GTWA 4Z7VE 3PGDB 1CL7I 5C0CA 5L8KB 4OZGE 2WWMC 1HINH 3LKSB 3CUPB 3MZGB 4U6XA 4X4XA 1K5NB 3HAEH 1CFBA 1J86A 4KK9D 4OD2A 3KS0H 3VFMB 1RHHA 1MRFH 4LLUA 5KS9E 4BM7A 5ESVA 1A7PL 3R0NA 1T2XA 1GPOH 1HQRB 5DRNA 2XQYG 3VMNA 1SY6A 4R96B 5DJCB 1BM3L 2WIMA 3G9AB 5FO8B 4A6YL 4BZ1L 1C08A 1WAAA 3MLTB 2W1NA 2ZUWA 1RZIB 4F7MB 4G42A 1GPOL 2PYFA 1UQSB 4LNVA 1FFRA 3UEZA 1GGIL 3D3VB 4HW6A 2JK5B 1HOCA 2V7NA 3QO0A 4NNYB 5C09D 4KTEH 2C7UB 2R4RH 3VFOA 4P3DB 4MXQC 5E2UL 3TYGL 3V4VL 2EEBA 3IDNB 1J8HA 1DE4B 1N6QL 4KRPB 2AGJH 3BIKA 5IVXE 3NFSH 2DB8A 1ACZA 1FYHB 2Y06H 2I5YH 5BRZD 3LEVL 1G7QA 2IAMB 1Q9LB 3VU2A 3K81A 3WXWL 5I1IH 1SYSB 3S35X 1N64H 2AJVL 4QHKJ 3IGAB 3TZVB 4JM2F 4OCYH 4R2GC 2VQ1B 3RTQA 4FQ2L 5IVXB 3MLRH 4PGBB 3ZKXC 5FGCB 1T1WA 5E2VL 3GJFK 5CD5C 1QA9A 1HIMH 2AJSL 4FXKA 3DV4A 1QOKA 4XGZA 5IB4B 3QWQB 5E4IA 2GAZA 2FZ3A 3T0ED 3P11L 5JPMB 3I6LD 4WW2B 3DPBA 1W72H 5D2LF 1YJDL 3VFPA 1NEUA 5C9JA 1R5WB 4L9DA 4V1DE 1U8NB 1FNHA 4OCYL 3RU8L 2VITB 1EZVX 4XBEH 5ID1B 3SE9L 3KYNA 4ELMA 5GRJH 4WGWB 3PXHA 4NFCA 2V9RA 1LQSR 4TTGA 1P1ZB 4FQ1H 2BFVL 2OSLB 4P2YA 1KB5L 4F7EB 2MCPL 1FZOA 1PSKL 1KF9B 3AM8A 4OM0L 4MD5B 4JKLA 3VXTB 1U8QA 4AEHH 3ZE2F 1NUGA 1KTDB 3U9UB 1CDUA 2BNQD 2Y1VA 1PY9A 4FTVA 1X5HA 3VXMD 1X6LA 3WFHB 3G5VB 3K7UA 3L5XH 4XPFL 3QXAB 3HMWL 3PGFL 4X80L 3U7WH 1PLGH 4Z9KB 5EU6B 5FIEA 5IQ9B 3VWKC 1Z5LB 3MACL 4FZEH 1Q0YH 3D2UA 3KPPA 4PJAE 2G75B 1RZ8A 1Z5LA 4QRPA 4PP1D 1T22B 3VD5A 5JOFB 4I3GA 4L4VA 4XXCA 4ALAL 4LCUB 4GBXA 2OI9B 4Z95H 1BQHG 3VWJC 3NIFF 1P9MC 3LH2H 2CJUL 4GW5A 5D7LB 3GRWA 5JW4N 1JFQL 1S7VA 3ARFC 3IJHB 4FTVB 5TF0A 3SKOB 2X4UA 4N8VB 5F9WB 3SEPA 4KQ4L 4M8QA 1TENA 1KN2H 1EXUB 2OSLA 1W0WB 5FM5M 4ORZC 4ZSOB 1KEGH 4U2YA 4IRSD 1T4KA 3HAEA 3PP3H 1S3KL 2IPKB 2O26U 3ZO0A 2VITA 4YJZL 4Y4FA 5FM8A 5C9JB 1MJJA 1MJ8H 1BQLH 3GHBH 4QRUB 4GAFB 5JPMA 5GHWL 3WUWA 1R5VA 3AGVA 1U58B 1XCTA 2GAZB 1U8IA 1ORQB 1MFNA 3PHOB 4JFZH 2Q8AL 3I9GL 4KRNA 4KAQL 2WINA 1FRGL 5IVXA 1KCRL 4C56B 1JGLH 1R3KA 1V7ML 2MCG1 2FGZA 3RIFK 1CFVL 3IGAA 4QRSB 2FHBA 1WBXB 3FFDA 1EEQA 5KZCB 3TESA 4MZ3A 3RWCB 2W0FB 3LDBC 1DBBL 1FORL 1TVHA 5IHZA 5HDQH 4ZS6D 4Y0GA 3W0WE 1H3GA 3BIKB 3DX6B 3WO3B 5I15H 4U3XA 4LLQA 3CPLB 1XZ0A 1MFCL 1WAAF 1AJ7H 1S7QB 5I16A 1YNTA 2P4AB 4OUOA 1JGDB 3EDJA 2PYFB 4MQ7B 4F3FB 3BESR 5DDHA 2FECL 2R69H 1RZGB 5I1EL 4C57C 3FT3B 4CADA 4O9HL 5DJXB 1HXYB 1P4LB 1XAUA 3DMMC 3E8UL 3KYOA 1NCBH 2V6HA 2L7JA 5IBLC 1P84K 4O2EB 4OD2B 1CFNB 1J0HA 4K94C 3LPFA 5IW1A 3MLZH 4HGMA 4KDTA 3GHBL 3HC4H 3H7LA 4CMHB 3LMJH 5I76A 3OQ3B 4JG0L 1LK2B 4AIOA 3KPOA 5D1ZA 4EQ3A 5L88H 2OK0H 4M4RA 5HI4C 3CDFA 1KYOK 1MVUB 3IDXH 1XGTA 4HAFA 4KKCC 5I75C 3AFLA 5I6XC 1XGQA 4R6UA 4E0RB 1QEWB 2VAAB 4M6MH 2Z8WC 5C6TH 2BXZA 1AGFB 2VUYA 1N4XH 4GW1B 1FZJA 1TXKA 3DO7A 1Y6NR 3O0RH 2DMKA 1FE8L 3EOAA 2VZ1A 4DW2H 4PIRF 3GO1H 2EDJA 3QWOB 4RQQA 2G2RB 4J8RA 3ULVF 1CDGA 5KVFH 1IGIH 4HC1L 3CDCA 2RFXA 1T66D 1KENH 4K9EL 5IB5B 4UTAH 1JGVL 2NY1D 2DLEA 1AD0A 1OVZA 4NPYB 2CDFA 4KKBD 5GS1C 1X5ZA 2C3VB 1AR1C 4MS8C 4WUUE 4ZFGH 2F5AH 2R1WA 3H8NA 4PJDE 2R0KL 2F53A 5C09E 2YKLL 4HXAH 1P6FA 5HHME 3DURB 1WZLA 3ARXA 4DGVH 4LVOB 4H1LH 4UDUA 5D70L 5TQ2H 1ORSB 5F1SA 4NQSB 3QI9D 3JWOL 3RPIB 5DD5H 2WBJD 3JV4B 2B4CH 1V05A 2D3VA 5JHDA 1QPPA 1A7RH 4X6DA 5CAYB 1MI5A 4JPIB 5JW5A 1U92B 5M95B 1W72B 1MHCB 5E6ID 4N0YL 5HGDA 5DK2A 3O6KL 2KPNA 1HDMA 2C1PB 4JANA 4PV8A 2IFFL 5DJ2B 5JDSB 5KBNC 3TYFA 1DVFC 2WW8A 2W9DL 3FQUA 3KPSA 3FONB 3LRSB 3UP1A 4HKJA 3O8XC 4L3EB 1LEGA 1SJEB 3L3JB 1NCUA 3H9SD 2B4CC 2HN7B 3V4PL 5MEOB 1MCJA 5C8JA 3TLRA 5E08L 1OT1A 2ZUTA 1QACA 2JIXA 3REVA 1EHXA 4EUPA 4HS3A 3O4LD 1FC2D 5EZIL 5D1XD 4G9DA 1UVQA 1T03H 1Q94A 2Z4QB 3ECBB 3FQTB 1D5XA 3TO4C 4FMFA 3RP1A 4HEME 1FSKB 1L0YA 3ARGC 2SEBB 2NYYC 4MHHG 4HHAA 3D18A 3D25A 1QLEL 2F58L 2AXHA 3CSYA 3WJJC 2OI9C 3DBXA 4JO4L 4GQPH 1A4JB 1ZHNA 3MBXH 4L4JA 4S1SH 5F9OL 1JWUA 5TPWH 2XPGB 3V4VH 1OLLA 3OTTA 5DURD 3MCKB 1D5MA 1QG3A 1NCTA 4MJID 4G6FD 2D7OA 4F2MA 5CUSH 3I6KB 2DTSA 3U82B 4X7CC 3ZKXB 3CK0H 4HJJH 3S37L 4YUEH 5DEZA 3LAFA 1IBGH 2VDLH 4L8SB 3QUZA 4DTGH 3EJZC 1A7OH 1FL6B 1RUAL 3ARED 5ALBL 2BNRE 4PG9B 5E5MB 2P46B 5I1EH 5JW4Q 3U0WH 4ZD3H 3IDYB 4L8CB 1ZLVK 2Q7NA 4PP2B 1M71B 4YXLL 1IE5A 3UAJD 4XPAH 4NM8H 4W68A 3STZA 4X5WB 1MRFL 3I6GA 5HHOD 3WFCL 1CBVL 3UYOD 4MQSB 1BJ8A 2NTFB 3HRZB 5MENA 4N0UA 4MAYC 2GTZB 2VUOA 5FGBC 3O3AB 1FFQA 4WWID 3T2QA 1LP9B 1MCHA 3CFEA 5FYLL 4G43A 4DVRH 3SCMA 1KTLB 3GSWA 3VGEA 1X7QB 4DKEH 3EOBB 3PJSB 1YQVL 5EC1B 3MYJB 5I9QB 3H0TB 1CGTA 1FRGH 3TBTB 3ARDA 3FO2A 3MNWB 3CH1A 2WBWB 1KBGH 2EC9T 3N06B 5IBLD 4Q6YA 1BD2A 5I18H 2YBRA 3ARPA 1ZANH 5JO5A 5JUEH 4JGUA 3AB0C 3W2DL 2OL3L 3CC5A 3NA4A 1F4WL 4NRYB 1INDL 4MA3B 5FV1L 2VN4A 1EHAA 5L2KD 1AIFA 8CGTA 4IOIB 3FQWB 4E42A 4XVTL 1IZJA 2JB5L 1S3KH 1YEEH 1KIQA 3DXAA 1AKJD 3MBED 1MCPL 4M3KB 4NKIL 4HPOL 1XF4A 3TO4B 5BZDA 2F19H 4ODVL 5LGHL 4KUZL 1CK0H 1FC1A 1IAIM 1M7IB 4KTEL 3CZFB 3BHBA 2VDOH 2EO9A 3P4NB 3GUTB 1D6EA 2E5EA 2EYRB 3HG1E 4JFDA 2QSCH 3P9MB 4JN2B 2YA1A 4MJIA 3CFIC 3VXRD 3QP3A 3FZUC 3HFMH 1UWXK 5I71B 4MJ5A 1J12A 1LO3H 4TSBH 2ZOKB 1KCSL 3QEUA 4XC1H 3AREA 4Z7NE 4U6YB 2AEWA 1MELA 1MCFA 2R8SL 3PGCB 5IWLA 4OIBA 2OJEB 1NFDF 3IDIB 4G6JL 4X9GA 2XN9B 1T1XA 1G7HB 4JQXA 1IEHA 2D7TH 1S7WA 4HWZB 4K2UH 1KCSH 4XC1L 4D9LH 2Q86B 3U46B 3KWWB 1JI1A 5IVXF 1JE6A 4M6AA 3LN4A 5BV7B 2XTJB 4TQEH 3G5ZB 1MPAH 5LGJA 3UMTA 3VFUB 5GISH 5EU3B 2OR9L 3ARGB 2AV7A 4JO4H 4AENA 1ZGLP 4LCWD 2DDQH 5BS0B 1C7TA 4EXKA 3BGAA 5GRZA 5IKCA 5E1AB 5AWNH 3V95A 2AV1A 5GRJL 4KK9C 4HIIB 1OAKL 5HI3C 1S8DB 4YHYB 3BGFB 3QUYD 4XBEL 3V7AG 5F21B 1IC1A 5DA0B 5D7IB 1PKQA 1MSPA 1I3GH 3N1FC 3MXWH 3QEQD 4UT7H 5TDPB 5IEHB 5C0EA 3S34H 3LZFH 4LEOA 2R9HD 1JP5A 5HHMB 4PJHE 1NAML 1A7NH 4RRPA 3MV7D 1BIIB 5I0DA 3S36X 3OKLB 3CVIL 5FHBH 3FAWA 4FQ2H 4Z7WF 2GW5A 5CINL 3V7MA 1UB5B 2CO7B 3NCYP 2DQTH 1BZQK 5KSBB 4G3YH 2VWEE 2I9TB 4Y5VB