2HJBD

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hjbD00
2I0SD 2J56L 2BBKL 2IURD 2AGLD 4L3HC 2I0RD 2IUQD 3PXSC 2AGXD 2MTAL 3SLEC 2I0TD 4FB1C 4FANC 2MADL 4L1QC 2AGWD 2Q7QD 3PXTC 4FA9C 1MAFL 3C75L 2HKRD 2GC4B 2J55L 4FA5C 3RN1C 2HJ4D 2GC7B 2HXCD 4FAVC 4L3GC 1MG3B 2OK4D 3PXWC 3RN0C 3SWSC 2AGYD 2OJYD 2HKMD 3RMZC 4Y5RC 4FA4C 2OK6D 2IUVD 3L4OC 4O1QC 3SJLC 4K3IC 3ORVC 2HJBD 2AH1D 4FA1C 3SVWC 3SXTC 2AH0D 2J57K 3RLMC 2H47B 2IAAB 2OIZD 3L4MC 1MG2B 2AGZD 2H3XB 2IUPD 1MDAL 1MAEL
chains in the Genus database with same CATH superfamily
2I0SD 2J56L 2BBKL 2IURD 2AGLD 4L3HC 2I0RD 2IUQD 3PXSC 2AGXD 2MTAL 3SLEC 2I0TD 4FB1C 4FANC 2MADL 4L1QC 2AGWD 2Q7QD 3PXTC 4FA9C 1MAFL 3C75L 2HKRD 2GC4B 2J55L 4FA5C 3RN1C 2HJ4D 2GC7B 2HXCD 4FAVC 4L3GC 1MG3B 2OK4D 3PXWC 3RN0C 3SWSC 2AGYD 2OJYD 2HKMD 3RMZC 4Y5RC 4FA4C 2OK6D 2IUVD 3L4OC 4O1QC 3SJLC 4K3IC 3ORVC 2HJBD 2AH1D 4FA1C 3SVWC 3SXTC 2AH0D 2J57K 3RLMC 2H47B 2IAAB 2OIZD 3L4MC 1MG2B 2AGZD 2H3XB 2IUPD 1MDAL 1MAEL
chains in the Genus database with same CATH topology
2I0SD 2J56L 2BBKL 2IURD 2AGLD 4L3HC 2I0RD 2IUQD 3PXSC 2AGXD 2MTAL 3SLEC 2I0TD 4FB1C 4FANC 2MADL 4L1QC 2AGWD 2Q7QD 3PXTC 4FA9C 1MAFL 3C75L 2HKRD 2GC4B 2J55L 4FA5C 3RN1C 2HJ4D 2GC7B 2HXCD 4FAVC 4L3GC 1MG3B 2OK4D 3PXWC 3RN0C 3SWSC 2AGYD 2OJYD 2HKMD 3RMZC 4Y5RC 4FA4C 2OK6D 2IUVD 3L4OC 4O1QC 3SJLC 4K3IC 3ORVC 2HJBD 2AH1D 4FA1C 3SVWC 3SXTC 2AH0D 2J57K 3RLMC 2H47B 2IAAB 2OIZD 3L4MC 1MG2B 2AGZD 2H3XB 2IUPD 1MDAL 1MAEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S D;  2J56 L;  2BBK L;  2IUR D;  2AGL D;  4L3H C;  2I0R D;  2IUQ D;  3PXS C;  2AGX D;  2MTA L;  3SLE C;  2I0T D;  4FB1 C;  4FAN C;  2MAD L;  4L1Q C;  2AGW D;  2Q7Q D;  3PXT C;  4FA9 C;  1MAF L;  3C75 L;  2HKR D;  2GC4 B;  2J55 L;  4FA5 C;  3RN1 C;  2HJ4 D;  2GC7 B;  2HXC D;  4FAV C;  4L3G C;  1MG3 B;  2OK4 D;  3PXW C;  3RN0 C;  3SWS C;  2AGY D;  2OJY D;  2HKM D;  3RMZ C;  4Y5R C;  4FA4 C;  2OK6 D;  2IUV D;  3L4O C;  4O1Q C;  3SJL C;  4K3I C;  3ORV C;  2HJB D;  2AH1 D;  4FA1 C;  3SVW C;  3SXT C;  2AH0 D;  2J57 K;  3RLM C;  2H47 B;  2IAA B;  2OIZ D;  3L4M C;  1MG2 B;  2AGZ D;  2H3X B;  2IUP D;  1MDA L;  1MAE L; 
#chains in the Genus database with same CATH topology
 2I0S D;  2J56 L;  2BBK L;  2IUR D;  2AGL D;  4L3H C;  2I0R D;  2IUQ D;  3PXS C;  2AGX D;  2MTA L;  3SLE C;  2I0T D;  4FB1 C;  4FAN C;  2MAD L;  4L1Q C;  2AGW D;  2Q7Q D;  3PXT C;  4FA9 C;  1MAF L;  3C75 L;  2HKR D;  2GC4 B;  2J55 L;  4FA5 C;  3RN1 C;  2HJ4 D;  2GC7 B;  2HXC D;  4FAV C;  4L3G C;  1MG3 B;  2OK4 D;  3PXW C;  3RN0 C;  3SWS C;  2AGY D;  2OJY D;  2HKM D;  3RMZ C;  4Y5R C;  4FA4 C;  2OK6 D;  2IUV D;  3L4O C;  4O1Q C;  3SJL C;  4K3I C;  3ORV C;  2HJB D;  2AH1 D;  4FA1 C;  3SVW C;  3SXT C;  2AH0 D;  2J57 K;  3RLM C;  2H47 B;  2IAA B;  2OIZ D;  3L4M C;  1MG2 B;  2AGZ D;  2H3X B;  2IUP D;  1MDA L;  1MAE L; 
#chains in the Genus database with same CATH homology
 2I0S D;  2J56 L;  2BBK L;  2IUR D;  2AGL D;  4L3H C;  2I0R D;  2IUQ D;  3PXS C;  2AGX D;  2MTA L;  3SLE C;  2I0T D;  4FB1 C;  4FAN C;  2MAD L;  4L1Q C;  2AGW D;  2Q7Q D;  3PXT C;  4FA9 C;  1MAF L;  3C75 L;  2HKR D;  2GC4 B;  2J55 L;  4FA5 C;  3RN1 C;  2HJ4 D;  2GC7 B;  2HXC D;  4FAV C;  4L3G C;  1MG3 B;  2OK4 D;  3PXW C;  3RN0 C;  3SWS C;  2AGY D;  2OJY D;  2HKM D;  3RMZ C;  4Y5R C;  4FA4 C;  2OK6 D;  2IUV D;  3L4O C;  4O1Q C;  3SJL C;  4K3I C;  3ORV C;  2HJB D;  2AH1 D;  4FA1 C;  3SVW C;  3SXT C;  2AH0 D;  2J57 K;  3RLM C;  2H47 B;  2IAA B;  2OIZ D;  3L4M C;  1MG2 B;  2AGZ D;  2H3X B;  2IUP D;  1MDA L;  1MAE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...