2HKMD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 27
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hkmD00
2H47B 4O1QC 1MG2B 2IUPD 2OK4D 4FANC 2IUQD 2GC4B 2HJ4D 4FA9C 4L1QC 2IURD 3SJLC 2IUVD 3SVWC 2Q7QD 2J55L 2J57K 2OK6D 3C75L 3RLMC 2AGZD 2AGWD 3PXSC 2IAAB 2GC7B 2AGYD 2AH0D 2J56L 3SXTC 4FA5C 3PXWC 3L4OC 3PXTC 2H3XB 2OJYD 3ORVC 3RN0C 2OIZD 2HKMD 3L4MC 3RN1C 1MAEL 3SLEC 3SWSC 4L3HC 1MG3B 2BBKL 2HJBD 1MAFL 2AGXD 4L3GC 3RMZC 2AGLD 4FAVC 2HKRD 4Y5RC 2HXCD 2MTAL 2I0TD 2I0RD 2MADL 4FA1C 1MDAL 2AH1D 4K3IC 4FA4C 4FB1C 2I0SD
chains in the Genus database with same CATH superfamily
2H47B 4O1QC 1MG2B 2IUPD 2OK4D 4FANC 2IUQD 2GC4B 2HJ4D 4FA9C 4L1QC 2IURD 3SJLC 2IUVD 3SVWC 2Q7QD 2J55L 2J57K 2OK6D 3C75L 3RLMC 2AGZD 2AGWD 3PXSC 2IAAB 2GC7B 2AGYD 2AH0D 2J56L 3SXTC 4FA5C 3PXWC 3L4OC 3PXTC 2H3XB 2OJYD 3ORVC 3RN0C 2OIZD 2HKMD 3L4MC 3RN1C 1MAEL 3SLEC 3SWSC 4L3HC 1MG3B 2BBKL 2HJBD 1MAFL 2AGXD 4L3GC 3RMZC 2AGLD 4FAVC 2HKRD 4Y5RC 2HXCD 2MTAL 2I0TD 2I0RD 2MADL 4FA1C 1MDAL 2AH1D 4K3IC 4FA4C 4FB1C 2I0SD
chains in the Genus database with same CATH topology
2H47B 4O1QC 1MG2B 2IUPD 2OK4D 4FANC 2IUQD 2GC4B 2HJ4D 4FA9C 4L1QC 2IURD 3SJLC 2IUVD 3SVWC 2Q7QD 2J55L 2J57K 2OK6D 3C75L 3RLMC 2AGZD 2AGWD 3PXSC 2IAAB 2GC7B 2AGYD 2AH0D 2J56L 3SXTC 4FA5C 3PXWC 3L4OC 3PXTC 2H3XB 2OJYD 3ORVC 3RN0C 2OIZD 2HKMD 3L4MC 3RN1C 1MAEL 3SLEC 3SWSC 4L3HC 1MG3B 2BBKL 2HJBD 1MAFL 2AGXD 4L3GC 3RMZC 2AGLD 4FAVC 2HKRD 4Y5RC 2HXCD 2MTAL 2I0TD 2I0RD 2MADL 4FA1C 1MDAL 2AH1D 4K3IC 4FA4C 4FB1C 2I0SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H47 B;  4O1Q C;  1MG2 B;  2IUP D;  2OK4 D;  4FAN C;  2IUQ D;  2GC4 B;  2HJ4 D;  4FA9 C;  4L1Q C;  2IUR D;  3SJL C;  2IUV D;  3SVW C;  2Q7Q D;  2J55 L;  2J57 K;  2OK6 D;  3C75 L;  3RLM C;  2AGZ D;  2AGW D;  3PXS C;  2IAA B;  2GC7 B;  2AGY D;  2AH0 D;  2J56 L;  3SXT C;  4FA5 C;  3PXW C;  3L4O C;  3PXT C;  2H3X B;  2OJY D;  3ORV C;  3RN0 C;  2OIZ D;  2HKM D;  3L4M C;  3RN1 C;  1MAE L;  3SLE C;  3SWS C;  4L3H C;  1MG3 B;  2BBK L;  2HJB D;  1MAF L;  2AGX D;  4L3G C;  3RMZ C;  2AGL D;  4FAV C;  2HKR D;  4Y5R C;  2HXC D;  2MTA L;  2I0T D;  2I0R D;  2MAD L;  4FA1 C;  1MDA L;  2AH1 D;  4K3I C;  4FA4 C;  4FB1 C;  2I0S D; 
#chains in the Genus database with same CATH topology
 2H47 B;  4O1Q C;  1MG2 B;  2IUP D;  2OK4 D;  4FAN C;  2IUQ D;  2GC4 B;  2HJ4 D;  4FA9 C;  4L1Q C;  2IUR D;  3SJL C;  2IUV D;  3SVW C;  2Q7Q D;  2J55 L;  2J57 K;  2OK6 D;  3C75 L;  3RLM C;  2AGZ D;  2AGW D;  3PXS C;  2IAA B;  2GC7 B;  2AGY D;  2AH0 D;  2J56 L;  3SXT C;  4FA5 C;  3PXW C;  3L4O C;  3PXT C;  2H3X B;  2OJY D;  3ORV C;  3RN0 C;  2OIZ D;  2HKM D;  3L4M C;  3RN1 C;  1MAE L;  3SLE C;  3SWS C;  4L3H C;  1MG3 B;  2BBK L;  2HJB D;  1MAF L;  2AGX D;  4L3G C;  3RMZ C;  2AGL D;  4FAV C;  2HKR D;  4Y5R C;  2HXC D;  2MTA L;  2I0T D;  2I0R D;  2MAD L;  4FA1 C;  1MDA L;  2AH1 D;  4K3I C;  4FA4 C;  4FB1 C;  2I0S D; 
#chains in the Genus database with same CATH homology
 2H47 B;  4O1Q C;  1MG2 B;  2IUP D;  2OK4 D;  4FAN C;  2IUQ D;  2GC4 B;  2HJ4 D;  4FA9 C;  4L1Q C;  2IUR D;  3SJL C;  2IUV D;  3SVW C;  2Q7Q D;  2J55 L;  2J57 K;  2OK6 D;  3C75 L;  3RLM C;  2AGZ D;  2AGW D;  3PXS C;  2IAA B;  2GC7 B;  2AGY D;  2AH0 D;  2J56 L;  3SXT C;  4FA5 C;  3PXW C;  3L4O C;  3PXT C;  2H3X B;  2OJY D;  3ORV C;  3RN0 C;  2OIZ D;  2HKM D;  3L4M C;  3RN1 C;  1MAE L;  3SLE C;  3SWS C;  4L3H C;  1MG3 B;  2BBK L;  2HJB D;  1MAF L;  2AGX D;  4L3G C;  3RMZ C;  2AGL D;  4FAV C;  2HKR D;  4Y5R C;  2HXC D;  2MTA L;  2I0T D;  2I0R D;  2MAD L;  4FA1 C;  1MDA L;  2AH1 D;  4K3I C;  4FA4 C;  4FB1 C;  2I0S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...