2HMIA

Hiv-1 reverse transcriptase/fragment of fab 28/dna complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an antibody Fab fragment at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/dna
molecule keywords DNA (5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*G
total genus 135
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hmiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hmiA05
4CF2A 2A1SA 5KI6A 4MK8A 4BE2A 1WAJA 3P5JA 5L1IA 3DRPA 4F4XA 3ZCMA 1UWBA 3TQ1A 3S3MA 3KTQA 4DEZA 4U7CA 1TL1A 4CHZA 3ZSYA 4TQRA 1DTTB 4B8AB 1WSGA 4CHQA 4QWDA 1BHLA 4IFYB 1RT7A 4DTMA 1TKTA 5F8JA 4Z4EA 1B92A 3HK2A 2O5DA 2IM1A 3LZIA 4FJIA 4DQRA 3SQ1A 1TK8A 1CXQA 3MEGA 3VQAA 1QS4A 4BE0A 5HLFB 3K5OA 1CLQA 1WNSA 2UUWA 2W8LA 3SUPA 2J6TA 3UDLA 4KTQA 3HPGA 4FLTA 1JLCB 1RT5A 3DOLA 4CJSA 4BACA 3AVLA 1S1WB 4KHUA 3PHEA 3RRHA 2ATQA 4KO0B 3DLEA 5KFEA 4CIGA 3IRXA 2DFFA 4YNQA 2VG6A 3I0RA 4CHOA 2XWYA 2FJWA 4CJPA 1F21A 2DFHA 4O5BA 4NLWA 4E19A 1NJXA 3OYBA 3BSNA 3K5LA 2ZE2A 5HRSA 4BE1A 2OPRA 1HARA 1HYSA 4EP4A 3KLEB 3LP0B 5J2PB 4DQSA 2HNZA 4B9NA 1RT2A 2YKNB 1KTQA 4TYAA 4FLZA 1C1BA 3QEIA 4NLUA 2BGGA 4CGDA 1YTUA 2AJQA 2D7SA 3DDKA 4CHPA 2XGPA 4GMJB 3HVAA 1RTJB 3WNGA 2IM2A 5KFLA 2QV6A 4PWDB 2XI3A 4E7KA 4O44B 3CIZA 3TABA 3OYDA 4WXOA 3DRPB 4O4GB 1TV6B 3H5XA 4AHSA 2RKIB 3HJFA 3ULDA 3C6UA 3FSIA 1VSIA 4HTUA 5L1LA 1RA7A 1WSHA 4PA1A 2O4GA 3NH0A 4QAGA 3V9ZA 3OL8A 4Z4IA 3ZT4A 4DSLA 1BIUA 2Z1JA 1IKXA 4JV0A 2BANA 5KFXA 1NOYA 4RNFA 5EWEA 1WSIA 3P83D 3M8SA 5I3UA 3RAXA 2IMWP 4MIAA 4J9PA 2R8JA 4ED0A 4B9UA 3AVMA 5KRTA 3KLHA 3MAQA 1U04A 3ZSXA 1RTIB 1RT6A 1GX6A 2F96A 4FVMA 4FK4A 2IAJB 2HB5A 3NFAA 4IR1A 4BDPA 2ASDA 4KKOA 3ZSRA 3DOLB 2KFZA 4KHMA 4O3RA 5CZ1A 1RAJA 2VG5B 1UA0A 1S1XA 1JLFA 3LDSA 1VRTB 4FJMA 4R5PA 1U4BA 1Q8IA 3NAHA 2HNDB 2VA3A 5C42B 1TK0A 4I2PA 4ID5B 3H4BA 4TY8B 4JV1A 3OYMA 4B08A 3D28A 3VQBA 3VQDA 1ZBHA 3UIQA 1TKTB 3LWLA 3AO3A 4CERA 3FQKA 4J9OA 1D9DA 4AILC 2JGUA 1JL2A 3MXMA 4TLRA 3V6JA 5DLFA 3RMCA 4WXWA 3L2UA 3CM5A 4ICLA 3ITHB 2WTFA 1EX4A 2A1RA 3CFPA 5SWMA 4OVLA 1NK7A 5F8GA 4EBEA 3PW0A 3JSMA 1S1VA 2XCPA 2OH2A 4IRCA 1QQCA 1RT4B 4W5OA 2NUBA 3MEEB 3PO4A 3AA5X 4DSFA 5KFVA 1K1SA 5KFHA 2XHBA 5KFJA 3C6UB 2J6SA 4E7JA 5KFMA 4IOBA 5KFZA 3BSAA 5L1JA 4DTPA 1C1AA 1IKYB 4RW4B 4DFMA 1RBVA 2YV0X 3BQ1A 4KAIA 4IRKA 4Q5VA 1RYSA 5F8LA 2QXFA 4RZRA 2V0NA 3AVNA 1S6QA 1RILA 4DS5A 3O3HA 1NNDA 2FBTA 2IDOA 2C2DA 2G8WA 2YHAA 4JRPA 4I7FB 3NHGA 4ZVGA 3EYZA 3QO9B 5DGAA 4KHNA 4CGIA 4YR2A 4RNOA 1N6QB 1MU2B 2IC3A 4F4ZA 1TAQA 3PUFA 4QW9A 4W5QA 1S5JA 1JLBB 2P1JA 3SZ2A 4FYDA 4B3OB 1QTMA 4DFKA 4IDKA 5J2QA 5F8HA 1SKWA 3ZSOA 5HBMA 4PUOB 3KK1A 1IG9A 1TGOA 1VSEA 5D3GB 1VSDA 2RPIA 2D41A 3HVTA 2B6AA 3OHAA 4OLAA 2DY4A 4Q8EA 3PX6A 4RUAA 4O55A 4IG0A 3DLRA 3LZJA 3SQ4A 3K57A 3IGNA 2OZMA 4HUEA 5C24A 3LPTA 3M9NB 1KVAA 4KBIA 1RA6A 3LP3A 4NLVA 4N76A 4RW7B 2FJXA 4ED8A 3L3VA 2KFNA 5JXSA 3LP1A 1I3AA 1WSEA 1REVB 3LPUA 4R5PB 3EZ5A 3SUOA 3TVKA 1MMLA 1Z25A 1TVRB 4GC7A 4CIEA 4WYWA 1VSJA 3NCIA 2E9ZA 3KLGB 3VQCA 1VSMA 4DSJA 4I2PB 3HL8A 1U47A 5KFSA 2UUTA 3SYZA 3TANA 4CIFA 2VWJA 3MR2A 1S9GA 4RW6B 1WN7A 4N56A 3Q8RB 1KFDA 1LV5A 2FVCA 4ZPDA 4Y3CA 3MECB 3SV3A 1JIHA 3DM2B 2OZSA 3U3GA 3IG1A 4ICLB 1QE1A 3H5YA 5KT7A 4W5NA 4CJLA 3M8QB 3T5LA 4ZPBA 4JS4A 1HNIB 1JXLA 3KLVA 4IG3B 3MEEA 1SH3A 1LW0B 3D0PA 1R0AB 5KT5A 4FJ7A 3OYNA 2W9CA 5F8MA 1RYRA 3EZUA 3KLEA 4IKFA 2I1RA 3OS2A 4YQWA 3KD5E 3IGVA 4HYKA 1NK6A 4FJ8A 4DG1A 3H98A 2D3UA 5I3UB 4J9NA 3RMBA 1FKPB 3LANA 2CJQA 1HYZA 2IC3B 1ASUA 4WE1B 3F73A 1KHWA 3QZ7A 3QGHA 1NKBA 1JLBA 2F8TA 1JLQA 5CYQA 4NCGA 3QIOA 2C2EA 4ECSA 3MFIA 1HNVB 4J9LA 5JS2A 2E4LA 1GOBA 4M41A 1FK9B 2WCXA 3KKSA 3RBDA 4PUOA 5KGXA 5KGWA 4DU4A 1LWCB 1VK0A 3TWHA 1XC9A 2YKMB 3CJ2A 4TXSA 4E7IA 3JYTA 4CJVA 2XGQA 3SPYA 2XO7A 5F8NA 3K2PA 4CFAA 2X78A 4FJGA 3QINA 1IKWB 4FXDA 3CVKA 4MIBA 2BR0A 3K59A 3NAIA 1ASVA 5DG8A 3TAQA 1RDDA 3TARA 3RMDA 4FM0A 1S48A 4YP3A 2XY6A 4QOZB 4URSA 3ITHA 4H4OB 1RT5B 4ZHRA 1B9FA 3DMJB 4J9SA 1XWLA 1GOAA 4KTZA 2FVQA 4Z4FA 2HHUA 4ZTJA 1C0UB 2D0AA 3SJJA 3HP6A 1S6PB 1NJZA 2HNDA 4K4ZA 4G3IA 1SL2A 3AVKA 4TY8A 4E0DA 5EWFA 3L2QA 2FVSA 4FLXA 3T5JA 5K14A 1XHXA 1S9GB 1FKOA 1N56A 3TAFA 2Q3SA 3MXJA 3I8DA 4FJJA 1VRTA 2RDJA 1NJWA 2YNFB 1A5VA 4WZQA 2GBZA 4O3NA 1TQLA 3V6DA 2QE5A 3MEDA 3KIOA 1NK4A 4MKBA 3MEDB 4J9QA 1FKPA 1RT7B 5DGBA 4NLYA 5KG6A 4CF8A 4YMEA 3DRSA 2JEIA 2XCAA 4DLEA 4DTSA 4LSNB 4DFPA 1J9AA 1HNIA 4DTOA 1C6VA 3ISND 2FBXA 4ZPAA 4RW4A 5J2QB 1KCFA 4FZYA 3NH1A 3GYNA 1HQUA 5DK5A 4CEQA 1X9SA 1BISA 2GUIA 3NAEA 4E7HA 2F8SA 4G1QB 1EKEA 1X9WA 1JLGA 4EZ9A 2WOMA 4DTUA 1TL3A 4E3SA 4MK7A 3GILA 1SKSA 4DTNA 4FW1A 5JS1A 1RT3A 3KHRA 3P1GA 4OKJA 4O3PA 1N6QA 5F9NA 2BQRA 3CQ8A 5F8IA 1TKXB 4ED1A 1SL0A 4ZHRB 1TKXA 4K4SA 1NKEA 2OPQA 1DLOB 1KHVA 3K58A 3AO4A 1DLOA 3H59A 3V4IA 1C0UA 2BE2B 2CKWA 2BE2A 1U45A 4FJXA 4YR0A 4Y1DA 4I9QA 5CYMA 2P51A 3UR0A 2GIRA 4F4WA 2VG7A 2RKIA 3UQSA 1UAXA 1KVBA 3GV5B 4ED6A 4IFVA 4PQUA 2JEGA 2OPPA 4NLQA 1L3VA 4KHYA 2X74A 1SKRA 4CF9A 1S9EB 4URQU 2AGOA 1IO2A 4E1MA 2HWHA 3CJ0A 4YR3A 4JLHA 3OYCA 4NLRA 2ILZA 4RNNA 4EYIB 1RBSA 2IGIA 2KZZA 4KO0A 5KFUA 5FRMA 2Z1HA 4ZTFA 5E41A 1XR7A 2DPIA 2VWKA 4UQGA 4DF8A 4CFBA 3L2RA 1T05B 4ZMMA 3OYFA 2ZD1A 3PV8A 3OVNA 4B9LA 5DLGA 1S1UA 3I5AA 1Q9XA 3PW4A 4DS4A 4FLYA 2HVIA 4M3WA 4IH5A 3T1AA 3FQLA 1KVCA 1XHZA 3QGGA 1KLMA 2YNHA 1WNEA 3F9KA 1BQMB 3M8PB 2HHQA 3RR7A 1UWBB 3IS9B 3QLHB 3ZSWA 5J2PA 2FBVA 3IN5A 4W5TA 1NK8A 5EDWA 4NRTA 3E01B 3KLFA 4FW2A 3MECA 4LH5A 1DTTA 4Q8FA 3CJ3A 2AWZA 4M45A 4XIUA 4FJ9A 3KLIA 4JUZA 3ZSZA 1RTHB 3V1OA 1A5XA 4PWDA 3V9XA 4NLGA 3ZT1A 3LWMA 4F50A 3AVBA 2W7PA 4DSKA 2IM3A 1RT2B 4CGGA 4WYLA 1HMVA 4N47A 4CJEA 4O3QA 4HCBA 4NCBA 5KG1A 4XPCA 2R8KA 1FK9A 4BWJA 4Y1CA 2HW3A 4R8UA 2W8KA 3ASMA 2DPJA 4ZVHA 3KK2B 4Y2AA 2XY7A 4G1QA 1VRUA 5L9XA 3C94A 3CJ5A 4KFBB 3NKYA 3JYTB 1HPZB 2HVHA 3G6YA 1RT3B 1D9FA 2OPPB 4IG0B 3DRRB 3QEPA 3BDPA 1QAIA 2IBKA 2YHBA 2ZE2B 4ECRA 1HYSB 3PW2A 3PW7A 3MTKA 2G8UA 1WSFA 1JLQB 2E6LA 1S97A 3T5KA 3OL6A 2JLEA 1ZBIA 3EY1A 1D8YA 1BGXT 4AH9A 2YNIA 3OYEA 2PYLA 4DSEA 3SUQA 3QNOA 3AO2A 4CEOA 2WB4A 1SUQB 4K4VA 4XO0A 1LWCA 1BCOA 1JXBA 4K50A 2XY5A 1HJRA 4CJRA 4CECA 3BJYA 3AVIA 2AU0A 1RNHA 3U3YA 3MR5A 1N4LA 4O4GA 4EZ6A 3PJXA 4RUCA 1ITGA 4AHTA 5KRSA 2Y1JA 1ASWA 5KFRA 4RG8A 3L8BA 4HVJA 4FJLA 3GV8B 4ECTA 4TSXA 3SFUA 4DL4A 1TKDA 2W42A 2BANB 2ITGA 3ZSQA 3ZT0A 2C22A 4CF0A 5J1EB 2E9TA 1S0OA 4CEFA 4KAZA 2XC9A 1N5YA 4RW9B 2IOCA 1CZBA 5FROA 4FS2A 1BL3A 4DF4A 4RW8A 3VQSA 4Q0BB 5KFBA 3PX0A 3DLHA 4H4OA 1C0TB 1ZBLA 3RB3A 1QSSA 1NJYA 3ISNC 4QW8A 5KFQA 3DLEB 3KHHA 4M94A 4KFBA 4LQ3A 3NGZA 3DLKB 2YNGA 1UOCA 4ZP7A 2BDPA 4ZP6A 3V9UA 1LW2B 2QKKA 3B6PA 1RDBA 4KTWA 2E6MA 2PY5A 2BQUA 4DL5A 2B4JA 2YNFA 2OPQB 5CY4A 1QHTA 4W5RA 3FFIB 4QPXA 3BR9A 4KHSA 2R2UA 1QUVA 2GIQA 4FS1A 4NRUA 4F8RA 4FK0A 1RTDA 3NMAA 1ZBFA 4FLUA 3C95A 2AX1A 3N6LA 4H8KA 3KK1B 3NGDA 5D3GA 3V81A 4J2AA 2B6AB 3HVTB 1JLAB 1JXEA 3BQ0A 4NCAA 1DTQB 2B5JA 4NLPA 3H5SA 1WLJA 4GVMA 5KFGA 4J9RA 3DI6A 3RB4A 2C2RA 3MXIA 3KHLA 2ASJA 2W9BB 3G86A 2JEJA 3FDSA 5J1EA 3DMJA 3VQEA 4CEZA 1ZTTA 3HKWA 3H08A 4C8LA 1IH7A 5HLFA 5HROB 3CO9A 2KTQA 3OHBA 1I39A 1MU2A 2ETJA 3OYAA 5J2MA 3CDEA 3HP9A 4B9MA 1IM4A 4EO6A 3CFRA 3E51A 4IFVB 3AVJA 3OYKA 4NLOA 5KG3A 1ZETA 4IDKB 3OS1A 4CJQA 1RT1B 3T3FA 4KI6A 4NYZA 3SQ2A 1QAJA 3LP0A 2JC0A 1L5UA 3KK3B 1IKWA 4L8RB 3KMSA 4WZMA 4PY5A 5KFNA 2OPSA 3KD1E 2ZKUA 4LD0A 1BQNA 1HQEA 4RW6A 3QNNA 3KJVA 1NK9A 4Q0BA 3EPIA 3HYFA 3OLAA 4F4YA 5KG0A 4KHRA 1KLMB 3H2LA 4CESA 2X6NA 1J5OB 1WAFA 3ZT2A 3IG1B 4RU9A 3QESA 4KV8B 4ECQA 4GW6A 4CFCA 1C0MA 4CJ4A 4AHCA 1HPZA 4QCLA 3MR6A 3NBPB 5KFPA 4KSEB 4CJFA 3TAPA 4B9SA 1Z4UA 4O0IA 4O3OA 4GC6A 5KT4A 3DLBA 2QKBA 3TAEA 4Y34A 3U6FA 5CZ2A 4CEEA 5EWGA 4WE1A 3RTVA 2HNZB 4C8OA 3QZ8A 5FDLB 3VQQA 4KRFA 3H4DA 5FDLA 2GC8A 5KFTA 4M42A 4OKKA 4ECVA 4BWMA 3DOKB 4I7FA 3D5MA 4CGFA 1C1CA 1YT3A 1FXXA 4DL3A 3KLHB 4OPJA 5DQGA 4LY7A 2HNYB 2FVPA 4MK9A 2LSNA 4ELVA 4DU1A 2D3ZA 4O44A 3TAMB 2AGPA 4IRDA 5C25A 3TI0A 4EP5A 4ECWA 4CE9A 4PQUB 4YFUA 4CGHA 3KHGA 4M3RA 5KFWA 2P5GA 3SQ0A 1KLNA 3NF8A 3QEWA 4B9TA 1S6QB 2Z1IA 5DQIA 3AVAA 3PX4A 3G6XA 4C8NA 4KB0A 5JUMA 2RF2B 3T19A 4MQ3A 1SV5A 3PR5B 1J54A 1HYVA 4K4XA 3WNHA 2OPSB 5KFOA 2HHSA 2AQ4A 1XR5A 3LP2A 4NLXA 3WNFA 3DLGA 1X1PA 4Z4CA 1S1UB 3A2FA 3S3NA 5C24B 1S4FA 3SCXA 4IKAA 4WFXA 4DL7A 2WHOA 4EBCA 1GOCA 5KFAA 4EO8A 1U49A 3LP1B 4B3OA 4DL2A 2WONB 2FLNA 4ID1A 1VSHA 1JKHA 3KLFB 4ED7A 2BRLA 1LAVA 3KLIB 3RRGA 3M9OB 1RCHA 1I6JA 3QIPB 5DG9A 4DSIA 1L3TA 3GQCA 1D0EA 2OPRB 4OPKA 3CFOA 4U6PA 4M3XA 2F8EX 4Q45A 1FKOB 1D1UA 1D5AA 3LALA 3G6VA 5KFCA 1HQEB 4QWCA 1Z26A 4EBDA 3HM9A 3DOKA 5KG5A 3AA4A 3V6DB 3OYJA 2D5RA 4K4YA 3AA3A 4KV8A 3NE6A 3VN5A 1TAUA 1X9MA 1IKVA 1LWEB 2FVRA 4TY9A 1G15A 1EP4A 3MEGB 3V6HA 4CJ5A 3HHKA 4ZVFA 4K8ZA 3BQ2A 1TKZA 2WK4A 3I0SA 4ELTA 1SH0A 4OGEA 3HPHA 1BCMA 1YVUA 2R2SA 3C6TB 2DTUA 3S3OA 2R2RA 4ECYA 3GIMA 1L3UA 3I5CA 1ZTWA 3L2WA 2V9WA 5L1KA 2VA2A 3V4IB 4HCCA 4FK2A 3RB0A 1TP7A 3OS0A 4MFBB 5KFIA 4CEAA 4TQSA 2ILYA 3NGYA 4IG3A 4EYHB 5HRRA 1HNVA 1U09A 4LSLA 3ICLA 5F9LA 1LWFA 3OY9A 1REVA 2BQ3A 2IA6A 1O1WA 4C8MA 3OYGA 1JX4A 2W7OA 2QK9A 3NF9A 2G8FA 5HP1B 1GX5A 4J9KA 4O3SA 1WSJA 3VA3A 1HRHA 2YKMA 3QIDA 1JLGB 2R8HA 1TL3B 3V9WA 2RF2A 2G8KA 1YVFA 3VQ7A 2OA8A 1QSYA 3LAMA 4Y2CA 5J2NA 3M9MB 3SUNA 3HXMA 5FRNA 4KKOB 2KZMA 4RW7A 3AVHA 3KMQA 1Q9YA 2EC0A 3HO1A 4H54A 2ATLA 1K6YA 4CJKA 1NKCA 1S1TA 1S1WA 3OLBA 3Q8SB 4FBTA 3QGIA 4ELUA 1S1TB 3AVFA 4O0JA 1S1XB 3VQ8A 1EP4B 4CJUA 4IQXA 4FM2A 4J9MA 3L2VA 1JLEB 3QEXA 4HKQA 4XPEA 3E01A 3RR8A 1T05A 3HVWA 3EPGA 1EETA 1RBUA 3OYIA 4ID5A 1JKHB 3QEVA 4RNHA 1EETB 2EX3A 4KREA 3S9HA 5KT6A 2J6UA 5T7BA 2OYQA 1QSLA 5KT3A 2VG7B 1BQMA 3M8PA 4NZ0A 4NYNA 5K14B 2C28A 4CEDA 4DQPA 5SZTA 4F2RA 3C6TA 3KJVB 3LAKA 2UVVA 2YNGB 3N6MA 1BI4B 5DG7A 4KE5A 4M95A 5EUHA 4IFYA 4NYFA 1RBRA 2HNYA 4CF1A 2R2TA 3T5HA 2FLPA 1ZBUA 3VQ4A 4Z0UA 2DFEA 3HPOA 3M8QA 3NL0A 1LW0A 1EXQA 3Q8QB 1TV6A 4CJWA 4K8XA 2G8VA 4AHRA 3GIJA 5KG2A 3QYYA 3CDUA 4IH6A 3V1RA 4JS5A 2KW4A 2W9CB 4CK1A 1VSKA 1J5OA 1R0AA 4E7LA 4DTXA 3O3FA 3JSMB 3OSNA 1NHVA 3O4NA 3B6OA 4F2SA 1K1QA 5HRNA 4H4MB 3PVXA 3K5NA 2YKNA 2EHGA 2P5OA 2R7YA 4BDZA 4N5SA 2W9BA 4ECZA 4ED2A 4OKEA 2X6SA 4WFZA 3FRZA 1SL1A 4FLVA 4Z4GA 2ASLA 3TR8A 4Q44A 3PO5A 3QO9A 2G8HA 2B5JB 4MFBA 5KT2A 2AGQA 3QETA 3DRSB 3H40A 3RB6A 4FBUA 2KQ2A 3VQPA 5CYQB 5J2MB 3DI6B 4BDYA 2O4IA 4OL8A 4LSNA 3PW5A 1NOZA 1S0MA 1W25A 4JV2A 5I42A 1BIZA 3M8RA 5KTQA 4I2QA 4MH8A 2IJNA 1Y97A 1JLFB 1JLEA 2HMIB 1S6PA 5KG7A 2HMIA 4N41A 1RT1A 1B9DA 5KFFA 2WOMB 4CEBA 1KFSA 3VQ6A 5DMRA 4M3UA 3OYHA 4FJNA 2B43A 4MKAA 4EEYA 4CJ3A 4CJTA 5J2NB 2FJVA 2XY8A 4URGA 4RNMA 3SI8A 4ZPCA 3BSOA 2IM0A 1N48A 4HHTA 1ZYQA 4FJ5A 4IH7A 3OYLA 4ECXA 4WFYA 3PR4A 3ZT3A 1JLCA 1C0TA 1CZ9A 2G8IA 4X2BA 1SV5B 2JC1A 3V9SA 4M3TA 4CCHA 1T03A 4KB1A 4CK3A 1SUQA 4AHVA 2ZD1B 3PZPA 3IRXB 3DLKA 3MFHA 1BQNB 3DYAB 2R8GA 1U48A 3DYAA 4F4KA 3HSTB 1RBTA 3QIPA 2PZSA 3ZSVA 3GIIA 4CHYA 2V4QA 1KRPA 2XRIA 4FCYA 2YNHB 3NDKA 4J2BA 3AV9A 3RMAA 2VG5A 1C2PA 2WONA 4E89A 1TVRA 2RN2A 3VQ9A 3NF7A 3NF6A 3CJ4A 4FJHA 1BI4A 2D0BA 1RTJA 1C1CB 3VA0A 4DL6A 4IBNA 3NH2A 2E9RX 1S49A 2UVWA 3GIKA 1L3SA 3CG7A 2UVRA 4NLDA 3RBEA 4KHWA 1N5YB 4NCGB 2FBYA 3KOAA 3I0SB 3TAGA 4HUGA 3DM2A 3OJUA 2PYJA 3L3UA 1DTQA 4F3OA 1VRUB 4DQQA 3BGRA 2Y1IA 1T94A 2I5JB 5CYMB 3NGIA 2I5JA 4KB7A 3TAMA 2GV9A 4NLSA 4OLBA 3CDWA 4DFJA 4LH4A 3V1QA 4K4UA 1T3NA 4ZP9A 3HT3A 1NHUA 1VSLA 4F3TA 3WNEA 1IKYA 2HHVA 2HHTA 5HROA 3ALYA 3GV7B 4DQIA 4JRQA 4KHQA 4KI4A 2HHWA 4ECUA 1VSFA 4ZP8A 3MR3A 4OGCA 1CXUA 4CGJA 2AX0A 4I2QB 1HMVB 4LQ9A 5I42B 4QWAA 4AHUA 4HUFA 4R8UB 4FJKA 2JEFA 3OJSA 3KK2A 3THVA 2IAJA 4FM1A 3KLGA 3VQ5A 1RDRA 4LSLB 2ZQBA 3HVRA 4IR9A 2RDIA 2UVUA 4DLGA 2FC0A 1TL1B 1LAWA 1XI1A 3AO5A 2FLLA 1T7PA 4QWBA 4TYBA 3CWJA 4Z4HA 3V6KA 5HRPA 4ED3A 4DMNA 3G10A 3SI6A 3SFGA 5KFYA 4M3ZA 4KPYA 3OSPA 3BREA 4K4TA 1QE1B 1S1VB 4J2DA 5KFDA 2IS3A 3PJWA 1RT4A 2HAIA 3O3GA 3H5UA 1T03B 3CYMA 4I9LA 2HWIA 3LP2B 4RW9A 3BSCA 4K4WA 5C5JA 3PY8A 3RWUA 1S9FA 4RW8B 4CFDA 4DTJA 1JL1A 1KSPA 3IAYA 1OS5A 1HQUB 2BRKA 4C8KA 1W9HA 2ALZA 1S0NA 1RDAA 3SPZA 3AO1A 4M3YA 3IS9A 3QLHA 2WRMA 2VG6B 3O4QA 2Z1GA 3N6NA 3OL7A 4DG1B 1TKZB 3I0RB 5C42A 2IJFA 4NLTA 4CK2A 1CSJA 1LW2A 4O4RA 1J53A 1RTHA 5EU7A 3CM6A 1NK0A 3RAQA 1SH2A 4Q43A 4E1NA 3KK3A 3KKRA 2V4RA 5C25B 1UA1A 2YNIB 4B9VA 4OJRA 1A5WA 1S10A 5DQHA 3UPFA 5HBMB 4ZVEA 3Q8PB 3MF5A 5KFKA 1IKVB 1LWEA 1RTDB 1RDCA 3BGRB 5KG4A 3V81B 3G0ZA 1XR6A 2D0CA 1NK5A 1JLAA 2W9AA 3NBPA 4B8CA 1T8EA 3I5BA 3SV4A 3QERA 4DTRA 1LWFB 4R0EA 1TK5A 4J2EA 1W0HA 3K5MA 4FLWA 3DRRA 2XI2A 5HP1A 3DLGB 1S9EA 3KNAA 4DU3A 5T14A 4H4MA 3D45A 4TN2A 4QWEA 1IKXB 1C1BB 3OL9A 4FZZA 2R8IA 3FFIA 1YTAA 3AVCA 3SNNA 1RT6B 1RTIA 3AA2A 2HHXA 4CHNA 4DWIA 3AVGA 4FZXC
chains in the Genus database with same CATH superfamily
4HH1A 3M2RA 3LDOA 1T9VA 1O13A 3O6WA 1OMSA 5KI6A 4W90B 3PEJA 1WAJA 5L1IA 3CE8A 3SAHA 1T0TV 2HQFA 3J7A1 3FCHA 5B0CA 4OZ3A 2QYGA 4CHZA 1B70B 2X51A 3HSCA 4BRNA 3HCXA 1YKWA 4QWDA 2Y1RI 1BHLA 4IFYB 1TKTA 5F8JA 1B92A 5M1PA 3HBTA 4L75A 5T41A 3PSIA 1LWXA 2BM1A 2X7IA 3MEGA 4OJ3A 2W8LA 3I55S 4X4PA 3RU0A 2GJIA 3VZHA 4KTQA 3A8KA 3HPGA 4FLTA 4YOTA 3TYTA 3Q8UA 4KO0B 4DUZK 1ZOTA 2VL1A 4LF4K 2AP6A 3IRXA 1S0VA 4YNQA 2VG6A 2OEMA 4YN3B 4YDUA 1NUEA 3I0RA 1H6KX 5E33A 4CJPA 2AYBA 2IY5B 2MLYA 3BSNA 2ZE2A 1UFKA 2OPRA 1AROP 3FJ2A 1JXVA 3G4SS 2CNNB 2HNZA 4NA3A 4B9NA 4TU8A 1KTQA 5JMVA 4NLUA 1YTUA 2O3DA 2OP5A 4CHPA 3HVAA 1WOQA 4IXCA 3MHYA 3LW5C 3IWLA 2IM2A 3R5JB 3TA1A 4O44B 3TABA 3OYDA 1CS4A 2VODA 4O4GB 3QJLA 3ULDA 1HBNB 2V63A 3FSIA 3NGSA 4HTUA 1DY3A 4PA1A 3IR5B 3V9ZA 3OL8A 1YBTA 5AZJA 4Z4IA 5H9EJ 4XDDA 1BIUA 2Z1JA 5EX5A 1IKXA 1LXJA 2KVQE 2BANA 2GIFA 2X1BA 2MKKA 4RNFA 2E44A 5EWEA 5JVGQ 5I3UA 4ZITA 2IMWP 4J9PA 3CQXA 1XNQK 3ZSXA 2F96A 4FVMA 3SSQA 1O5JA 2P9KA 3SMPA 4BDPA 2ASDA 3KHYA 3QPIA 4O3RA 1X9JA 2FSNA 1RAJA 2VG5B 1HNXF 1UA0A 4ISFA 1VRTB 4K8RA 4LVOP 2Q1NA 1JCGA 1ZAWA 5C42B 4B3RJ 2UUAF 5CR4A 2VFVA 2LQ8A 2QWRA 3AO3A 4JI0J 4CERA 4G6VB 4AILC 2JGUA 1RWWB 1JL2A 3SMSA 1NJIO 4TLRA 3E8OA 2RT3A 4O23A 1B4SA 3L09A 2PMHA 2A1RA 3GL1A 3L7PA 3O9RA 4EBEA 3JSMA 1S1VA 2OH2A 1DHMA 1XN9A 4Z7YA 4K41A 1QUPA 3R6GB 1ITPA 2EI5A 1U1QA 3MXHP 4JI8J 3LA0A 5KFHA 5L38A 5KFJA 4H0YB 2J6SA 4E7JA 4ZOSA 5KFZA 1GXLA 1JK9B 3QICA 2MQNA 5MLCV 1VK8A 5C0YA 5A8KB 2O8CA 4IRKA 2DGOA 1DQ9A 4YEAA 1LFWA 2IRYA 1WHVA 1S6QA 4KR0B 2Q31A 2MY7A 2FBTA 4JYAJ 1RXOB 2G8WA 2V67A 1K8AO 5EGYA 1YIJS 2H1YA 1HI0P 4JV5F 4CGIA 4YR2A 2ADBA 1N6QB 3B8AX 4OYBA 1TAQA 4F4ZA 1XMQF 2D1KA 1YJRA 2HBYB 1Q79A 3J81j 4B3OB 1TL7A 3ZSOA 2JLFA 4OI1A 1GFWB 2ZHOA 1QQNA 2LXFA 1I94F 3MDQA 1VSEA 1VSDA 2D41A 2B6AA 2UUCF 4OLAA 4RUAA 2Z2ZA 1DKGD 2EFPA 2KVIA 3K57A 1TMMA 2VH7A 2F9WA 1YLXA 3LP3A 4NLVA 2NZ4A 1SIWB 4N76A 3MD3A 4ED8A 5CA5A 2KFNA 1WSEA 2NPFA 1REVB 2LLZA 1O0PA 4R5PB 4XAKA 1CZAN 4LF7K 1MMLA 1I5OB 2OJ3A 2HRTA 1FTRA 1VQ4N 3IR6B 3BEXA 3M1FA 2E9ZA 3KLGB 4JI6F 4OX9F 4X4UA 2UUAK 2UUTA 4BRPA 2YWGA 1JJHA 4CH7A 1N5QA 2VWJA 3AOBA 1S9GA 1CJTA 4N56A 4CW7B 5CCLA 3DXKB 3SV3A 2IVPA 1JIHA 1QZ5A 3DM2B 1WC4A 3BF4A 4ICLB 1YUWA 2LEPA 4MYUA 1UEVA 3UO0A 2GW8A 4ZPBA 2PD1A 4JS4A 3UB5A 4DB3A 3SAFA 2WAQD 3EJMA 4LC9B 1OVQA 3D0PA 2IMOA 5KT5A 1Y5IB 4H03B 5D78A 1CJUA 3HHEA 1HKBA 1FI4A 2B8QA 3KWIA 3WUHA 1FRKA 3EZUA 4YQWA 3A8IA 4RLEA 3HLUA 2KHDA 4M7YA 1U24A 3H98A 2VKZG 5I3UB 3I9ZA 3W63A 2DXDA 3HOSA 1TYQA 1HNWK 4WP8A 3QGHA 4NXNK 1NGHA 2F8TA 4O5FA 2C2EA 4ECSA 3MFIA 5JS2A 1YHQN 3L95X 2QWNA 1FK9B 4QIGA 5IXUA 1WG1A 2WCXA 4PUOA 4OHZA 1IVZA 4DU4A 2CQCA 3EE3A 5D77A 1XC9A 2YKMB 3G96A 2MZ1A 2O01C 4JKEA 3HHLC 3CERA 2XGQA 3ZX2A 1DGKN 1K73T 5F8NA 4CFAA 2GVDA 3TJ9A 2Q6BA 3QINA 2F4FA 1IKWB 4FXDA 3CVKA 2CQDA 3HFZB 3NAIA 1RDWX 4NI2A 5DG8A 3TARA 2N7YA 1BO5O 4F3QA 1S48A 4YP3A 2XY6A 3ITHA 1S4EA 2E8AA 5F1XA 1YTYA 4BR9A 1IWAA 1B9FA 2Z4PA 4DR1K 1GOAA 3PIPL 3FZKA 3IM8A 4J8FA 4FWMA 2HHUA 3SAGA 4YY3F 5H1SV 1S6PB 5A2QO 2NRZA 1SB6A 1NU0A 5MLCQ 3HMJG 1S57A 5IQ6A 2BKPA 3AVKA 2PFDA 3AARA 2MMYA 5K14A 3CCSN 4HEA9 5HVHA 5E3RA 4FJJA 5CYJA 5EY4A 1TTHB 1Q16B 3ETMA 2RDJA 3IC1A 3SQOP 2ZKTA 3QGPA 2QO3A 3VEOA 2JX2A 2C2MB 4RUBA 3BZKA 4J9QA 3MEDB 1X60A 2AMCB 4NLYA 1PAUB 1EB0A 4YMEA 1LFPA 1NH7A 3D0IE 3UNGC 3VOVA 2CJKA 2AYGA 4DFPA 2MY8A 4DOZA 3ISND 4RW4A 5J2QB 1PC5A 1KCFA 2QWOA 1Q7YT 5KPZA 4MJKA 4CEQA 1F1BB 1BISA 3NAEA 4NZ6A 4DTUA 4ES1A 5C2DA 4E3SA 4MK7A 4AE5A 2HLTA 5C2CA 3LDQA 1RT3A 4V19X 3R5GA 3KHRA 3P1GA 1AT1B 3LOUA 2VZ9A 3DRXA 3CSKA 2YKOA 4OKJA 3P4UB 2BQRA 4JI3F 1TKXB 4J5OA 1F9FA 2QFIA 1SBRA 3SQGA 1DLOB 4Y0FA 3L7OA 1DLOA 2V8HA 3V4IA 4JNEA 1C0UA 1AXQA 2B4PA 1H2TZ 2HS3A 4H4KC 1FEEA 3SBMA 4YR0A 1NB7A 4E98A 5IT9U 2ZM6J 5CYMA 2MXYA 3J8AA 1H7WA 1WD6A 1RAAB 3P6YC 3L3CA 3UQSA 1IJEB 2JEGA 2KFYA 1L3VA 3BYRA 5C12A 3UKUA 1SKRA 3ZXWA 2AGOA 3D68A 3CW2C 3OFHA 5GIPA 2NXUA 4NLRA 4EYIB 4RNNA 1PAEX 4A8XA 4KO0A 4N8OA 5E41A 1XR7A 2DNMA 5EOYA 2YPZA 4CFBA 5M1KA 4ZMMA 2ZD1A 3GP9A 2ZBQA 3I5AA 1TU0B 4JI4J 4BROA 1FEHA 4ANEA 3BPDA 3GYXB 2KU7A 3M8PB 1QVGR 3AXMA 1UWBB 1RACB 4B3MF 1YJWS 5BRDA 2FC9A 1KTVA 3T41A 4GKJJ 3LPEA 2IFXA 4W5TA 1GTHA 4NRTA 2B0GA 4X4VA 3E01B 2DHXA 1DTTA 3CJ3A 2AWZA 4M45A 4FJ9A 4JUZA 3DDIA 3V1OA 2V8DA 2EK1A 3MWTA 3V9XA 2I2YA 5A8RB 1IM6A 4DV3J 3U7JA 1MG7A 1R7IA 4C8YA 1N33J 3C7NA 1JJ2M 1HKCA 4CGGA 7AT1B 2HQ3A 1MLAA 1U7LA 2HWTA 1N0VC 1PBAA 4BWJA 4Y1CA 2OFHX 4WTOB 5T7LB 5HANA 1ZH5A 4BRDA 4A48A 4ZVHA 3I9V9 2L9NA 2R7XA 4G1QA 3C94A 3VGLA 3CJ5A 3MM7A 3EKSA 5AQIA 3L0QA 1U1OA 2UV8A 2HVHA 4HVZA 1RLDA 2OPPB 5IWAK 2MKYA 2ZF5O 2BKOA 2KB2A 3TZZA 5I3PA 4XEIA 4D3HA 3TNVA 3MTKA 2E6LA 4JKGA 1S97A 5CHIA 1PIEA 1D8YA 1IBKK 2YNIA 3OYEA 4HL9A 3SUQA 4PKHA 4CEOA 2ZJQL 1SUQB 2HFUA 3T9NA 3H25A 1BCOA 2NUUG 2XY5A 1JXBA 1HJRA 1P90A 2DGSA 2UXCK 2KG0A 2AU0A 2DEIA 2FF3B 3MR5A 1Q1KA 2Y1JA 2P9NA 2ZFHA 3DXMA 2UUBJ 1OSDA 1X5PA 3SFUA 3SIPB 1VC0A 5EX0A 2C22A 5F2RA 2I9SA 3O4WA 2P9PB 1S0OA 1VQ6S 1IUJA 2P9PA 4OLPA 3IDHA 5D0HA 1YJ9S 4Q0BB 4I6MB 1U6ZA 1W97L 4I6MA 3BF1A 3RB3A 4B17A 5KOXA 1NJYA 3CO0P 4FOIA 1EAYC 2QGFB 1XUPO 4JYAK 5A0YB 4WK1A 1ZM3A 3KHHA 3DLLL 2BBEA 2MKHA 3DLKB 3NGZA 4FDFA 5F3TA 3MPWA 4KH5A 1T9TA 3MWPA 4ZP7A 1RDBA 3ILLA 4DR4F 1D4XA 1YVNA 2PY5A 4LT6A 3HM8A 1A0OB 3TUIC 4JK7A 1CJKA 5C7PA 1ZS6A 4QR1A 4PL7A 4ZVRB 1FD8A 2B4JA 1QHTA 1WBDA 3CJKA 2QFJA 4QPXA 2GIQA 5LMUF 1DFDA 4F8RA 4NXMF 1PJ5A 3GFZA 1H7XA 2EWSA 1RTDA 1N34J 3HHLA 1M1KO 3BF3A 2ZJPL 3BGUA 3I56N 4ETZA 3V81A 2B6AB 4DR6J 2F8HA 1JLAB 2E1ZA 1U8WA 1DTQB 1OY6A 1YJ7A 4B3SF 1VQON 3H5SA 2CZ4A 2CZVC 5FIIA 3CCTA 2V2ZA 3MXIA 2VGMA 2ASJA 2W9BB 3DMJA 4ENOA 4USJC 1ZTTA 1U1KA 1U25A 1C4AA 3OTOF 1YITN 1IH7A 5HLFA 3BZQA 1U2VA 1CQNA 3OHBA 1MU2A 4X4RA 4RR5A 4OV6A 3K89A 3HP9A 2ABYA 1IM4A 4EO6A 3BGFA 3E51A 3KJQB 3OV7A 1N88A 3N9UC 4I4BA 3Q22A 3RAMA 3P5BP 1ZETA 3P8BB 3AB2B 4DR5J 4AM7A 3THXB 3OS1A 3D1OA 1YAGA 1XNRJ 3MCPA 2MSTA 4NYZA 3SQ2A 3LP0A 2DR9A 4L8RB 2OPSA 1ZA2B 4FYYB 2P9UA 1RU1A 1LK5A 1HL6A 2VFUA 1FD2A 2CQGA 3HYFA 4USKA 4KHRA 1KLMB 1J5OB 1WAFA 4GO5X 4RU9A 4ZIWA 2BKNA 2ATCB 1C0MA 4CJ4A 4AHCA 3CCJN 4BCAA 3HRGA 1B7YB 3G8TA 1Z4UA 4BRKA 4N8NA 4OX6A 2RJZA 4GO7X 5KT4A 2QKBA 2VPZB 3FSXA 4CEEA 5EWGA 1IR2A 4IJNA 3H4DA 2V4JB 4OKKA 3IR7B 2EPIA 1WDTA 4UOGA 4ECVA 9RUBA 4BWMA 4I7FA 3D5MA 1CJVA 3CD6N 1J27A 2BJ3A 1BXNA 4YORA 1R0CB 2HNYB 4X66K 3ENQA 4FSVA 3TI0A 1WC0A 4B3MK 4Z37A 4P71A 2CWKA 3RUBL 3Q0AA 3GJRB 4PQUB 3MAAA 1H74A 2DCUB 2R9LA 2P5GA 3SQ0A 1KLNA 4DR1J 5AFUA 5DDOC 1S6QB 5DQIA 1O51A 3AVAA 3WXLA 2KJVA 3D2FA 3PR5B 1ATNA 4USHA 4JI5J 2VASA 3GB0A 3IO1A 1S4FA 3SCXA 4IKAA 5GAEP 4YOWA 2OSRA 1GOCA 3QRPA 3BEGB 2HFOA 2RSQA 4EO8A 4LF8F 3A3PB 5D4LA 3LP1B 5A0YA 1U49A 1OY8A 3CD6S 4DV4F 4DV1J 4C9DA 2JVRA 1ZC6A 4X4QA 3KLFB 2QG9B 3BR8A 2BRLA 2M8HA 4C3MA 4Y65A 3KLIB 1RCHA 3QIPB 1NSKL 1L3TA 1MA9B 4LFAK 1QQMA 4B1VA 2L48A 1OH8A 1DQAA 1S72S 3LALA 1FXRA 3ZZPA 3UI3A 3G6VA 3C6HA 3AD8C 1Y7PA 1HQEB 1R6VA 4QWCA 2GJ2A 3DOKA 4Y28C 3OYJA 4P75A 1FE4A 1O6XA 4EGLA 2DT9A 1FXDA 1X9MA 1LWEB 2VCPA 2YQ0A 3FK4A 2NREA 4F9OA 1EP4A 5GAGI 3EE9A 4C98A 4WQ4A 4ZVFA 1AZSA 3BQ2A 5FLXO 4RWWA 1UPMB 2CNLB 4DCPB 4OGEA 2OMLA 3RGIA 1ZA1B 2O67A 2CGJA 2LFVA 4JI5K 2LCWA 1BCMA 2O8BB 4R79A 2W2NP 2HS0A 3VV2B 1NRKA 4ECYA 3M3ZA 4L76A 1RWPB 4ZN3A 5BR8F 3H3OB 1ZTWA 2CFXA 2ZM6K 4X62J 3M2UA 2V9WA 4A5BA 4OIXA 2KKZA 4FK2A 3M2UB 2IHR1 4IQMA 2V68A 4KJIA 3OS0A 5KFIA 2MZSA 3NGYA 4EYHB 5HRRA 2G2YA 3ICLA 1FNXH 1LWFA 1KXPA 3OYGA 1AYEA 3H0PA 1JX4A 2QK9A 2Q1LA 3PRVA 4J9KA 3NNHA 1WSJA 2QA1A 2XNQA 3ZO7A 2HBQB 3T1HK 5A8WA 2YKMA 2KXHA 2YY3A 2H5IB 4JI7F 3W61A 5AXNA 3H2UB 4DR6F 3OTDA 3GONA 4OZNA 1RISA 1S12A 2D3O1 2YX1A 3RBZA 5FRNA 4L74A 4C2MA 2KZMA 3KMQA 4NLCA 4H54A 2ATLA 2A42A 3OLBA 4QR0A 1LQ9A 4FBTA 3W9IA 2A40A 4OYXA 5IV4A 4CJUA 3HDSA 3PKMA 4BREA 2IPOB 3QEXA 5ETKA 3E01A 1T05A 2V8GA 2C2OB 3OYIA 4RNHA 2RVJA 3FFKB 4CLFA 3S9HA 1VQYA 1B0TA 2J6UA 2OYQA 4OZ1A 2HSTA 4NYNA 4DQPA 2A3JA 5SZTA 3TUZC 3KJVB 1S6OA 2KJWA 3VAKA 4WQ5C 3WT0A 5DG7A 2F7VA 3US5A 1T11A 2F4VJ 5BR9A 1RBRA 2HNYA 1TUWA 2DXEA 3M8ZA 2OTLN 5AQPA 1VBZA 3M8QA 5IWAJ 2QL5B 3A13A 4CJWA 5AR0A 2WB1D 4JS5A 3QBCA 1LCUA 3B78A 4E7LA 3JAMY 3RSEB 3OSNA 4F2SA 3MK6A 2LEAA 2LQ5A 2YKNA 2EHGA 2P5OA 4BDZA 1T3OA 3GSIA 5M1QA 2V50A 2X6SA 2HGNA 3B4MA 1ZPVA 3FRZA 2GX8A 4FLVA 2D3OR 4DV6K 1OH6A 4Q44A 3SLCA 1GMWA 2G8HA 1DURA 2E88A 2AGQA 4NEZA 2AJFE 3K0SA 4BDYA 4LRCA 2V7YA 1NJIT 3L7UA 1W25A 3GPAA 4H0VB 5I42A 3MMAA 3M8RA 2IJNA 1Y97A 1IG8A 1JLEA 5AJ3J 1R59O 3OW2R 2R7UA 3JQKA 2EFGA 4RKUC 2Q43A 5KFFA 2ZH3A 4WBFA 5AZIA 2J76E 1KFSA 4JHDB 2PFFB 4M3UA 5LY3A 2IVOA 5AZIB 2B43A 4FWPA 4MKAA 4EEYA 4CJ3A 2FJVA 1E6YA 1F9EB 3TOQA 1EQYA 5BYSA 3OTCA 5HVGA 1K0VA 3CDBA 3UFCX 4NO7A 4JI7K 4HHTA 2EXUA 3OYLA 1N0UA 4WFYA 4F04B 1CZ9A 2JC1A 3W0LA 1VQ7S 4M3TA 4DCJB 1KKHA 4AHVA 3IA0A 2ZD1B 3PZPA 4X62F 2HRUA 3ZZUA 5BR8J 2M0GB 2PI5A 2B9EA 1FF2A 3TSUA 1FDBA 2ZWHA 5LMNK 3M05A 2G0JA 2FGCA 2ZGZA 4FCYA 1UZDA 5BYQA 2VG5A 4CZLA 1JJ4A 4IEIA 1M90T 4PKDB 4NPOA 1RSCA 2A0FB 4B3MJ 3VQ9A 3NF6A 3OBWA 1NEEA 3R97A 1URRA 5JVHQ 2D0BA 2YX7A 1C1CB 1NNEA 2E1MC 3HSJA 4IBNA 5A2QU 4P10A 1NM2A 1R3NA 3DGPB 3RBEA 4DU7A 4KHWA 1E6VB 2ASYA 2BJ7A 1MSWD 1BLUA 4PRFA 4HUGA 1E3MA 3DHXA 1G4CA 1GLJO 3ZC4A 4M5IA 1DTQA 2MKJA 3OXFA 5IS2A 4H0PA 1T94A 1SC3B 2KRBA 3J80Y 3TTDA 3BBFA 3HT3A 1NHUA 4DV4J 1VSLA 3ID6A 4X65J 3ZNJ1 2DY9A 2ZM6F 2DIVA 2BJEA 4PCQA 2P9KB 4DQIA 4KI4A 4ECUA 2MYFA 3LO3A 1F5AA 2R7OA 2E20A 4BC5A 2GGPB 5E2QA 1TL5A 4DQ8A 1FT8A 4MYTA 2XS2A 1K8KB 4YY3K 2M4MA 1RHMB 2IAJA 2XB2D 1S7IA 3R7SB 3VAFA 5AQKA 1C0FA 3FZBA 4IR9A 2RDIA 4DLGA 2FC0A 1NDCA 1LAWA 2UU9F 1KQKA 2JWLA 3MCNA 4BRAA 3EGZA 3K0JA 4WWSA 4QWBA 4TYBA 3V6KA 1LXNA 1LK7A 2P9IA 1PO6A 1BWVA 3D6TB 9ATCB 4KPYA 3M6GA 1QE1B 5KFDA 1F60B 3O9TA 1T03B 4CD1A 4K4WA 4DV4K 4RW8B 4HTLA 3VGUA 4X62K 1JL1A 1RUSA 3VGKA 2ALZA 1RDAA 1S72N 4O0NA 4ZA1A 3QLHA 2HMPA 2VG6B 1IR0A 3O4QA 5LSLA 3I32A 1NGCA 1A7GE 4X66J 3I0RB 1CSJA 1KOOA 1RTHA 5EU7A 2P6TA 4CZCA 3AY0A 2B9YA 2BV3A 4YY3J 2HFVA 2V4RA 1P27B 3W64A 5C25B 3WHIA 1SQEA 3JXOA 1ROFA 3NP5A 4EU0A 3PM9A 1FNOA 4CZFA 4OJRA 3BBBA 1S10A 4FWNA 2BMBA 3UPFA 1HI8A 1EWQA 4CO0A 2QLFB 3Q8PB 2A41A 1IKVB 3BGRB 3CC7S 3G0ZA 2MLZA 2D0CA 1JLAA 3I5BA 2CPFA 3WZ0A 3SV4A 4DTRA 1LWFB 4OFZA 4J9VA 1UZHA 3EM1A 3HZEA 3H90A 2DR7A 2VOOA 5GMEA 5AZJB 3GU0A 1VJWA 1HWKA 5T14A 4QU7A 5M1OA 1BQXA 3MOJB 3NNAA 4QWEA 3AGRA 4H5NA 4FZZA 2ZVIA 3R7NB 5JICA 3NGRA 3LL3A 4KH4A 4Q2MA 3ZEUB 2O8FA 2QTWA 4M5JA 4L72B 4CHNA 4DWIA 3AVGA 4FZXC 3L4BC 4CO2A 1K44A 1FE0A 2A1SA 4MK8A 4BE2A 4OPAA 1SC6A 4J91A 2LP4A 4F0HA 4CP5A 4F4XA 2WSEC 1UWBA 3TQ1A 4EWTA 2BVZA 4IDHA 2MDAA 1TL1A 1R31A 4AQYF 2NRVA 2CH6A 3BUZB 5ETMA 4B8AB 1WSGA 4CHQA 2UXCF 4Z4EA 3AQOA 2FTRA 4DZ6A 3BBCA 2WVCA 3AH6A 3FEZA 4W98A 4M5DA 4DX7A 2MQOA 3VQAA 2PC6A 5HLFB 4WQ5A 4TLQA 2J6TA 4BY9C 4HTIA 2DH9A 3C2PA 4CJSA 4BACA 3CCUS 3AVLA 4MMOA 1DEJA 4ZPTR 2X1FA 2ATQA 4CTAA 4MKYA 2FB0A 3HJVA 4CTAB 3DLEA 5KFEA 2DFFA 5EXWA 5HL7L 2B3TB 4B1UB 1V4TA 3MOZA 3R3TA 1QY7A 2XWYA 4NLWA 3MPVA 5E5NA 3K5LA 2MGZA 1OQ3A 5A6WA 4DR6K 2CJBA 1M1HA 2W2QP 2WBNA 2YXLA 3J7ZO 1WSRA 1KAXA 2D9OA 3KDOA 2BGGA 4DV7F 2KM8C 2D7SA 4C0HA 4FWKA 4F25A 4GMJB 3T1YF 4ISGA 2PEHA 2L9WA 2K8GA 4E7KA 1ILYA 2HPUA 5ETOA 4JI7J 3OFGA 2AYMA 1W2BR 1FESA 1F5CA 4AHSA 3MAAB 4OYMA 1TL7B 2A5XA 1WSHA 2CADA 2GHWA 1I94J 3RSEA 2FJEB 3KUHA 1UFLA 5D0RA 1WUUA 4JV0A 5E0OA 2KDOA 2DH8A 4KPCA 2VKRA 3M8SA 2Y8WA 3AOCA 2PMWA 2RD5C 4B9UA 3M2RB 4V19J 3MAQA 4YB1P 3CCUN 2GTDA 1OWXA 1RT6A 2OUGA 5GMKa 2UV8G 2IAJB 3TVZA 3D67A 4KKOA 3DOLB 3CPWR 2F9TA 2SXLA 2CIMA 1TFYA 4JYAF 5I9EB 4C97A 2VPYB 2QA2A 3WIUA 1NZ8A 2J0QD 1S1XA 3R1LA 1JB0C 4FJMA 3TSQA 4RJVA 1Q8IA 2VUGA 2XSJA 2NRXA 3S1TA 2VA3A 1TK0A 2JZ5A 5L39A 4TY8B 3S41A 4B08A 3D28A 1H98A 1ZBHA 3FQKA 4J9OA 3GG4A 2IIHA 5CZVA 3MXMA 2CPHA 1VRQC 3V6JA 4WXWA 3CM5A 4C48A 1EX4A 3CFPA 5SWMA 4OVLA 1NK7A 4HR2A 3N5BA 3PW0A 2XCPA 4IRCA 1RT4B 3LH2S 4W5OA 2NUBA 3MEEB 2FHJD 2VQEF 3PO4A 3E3XA 2KHOA 3CPWM 1WOSA 1YDLA 1ZM9A 2APOA 1QVFR 3TRGA 1UETA 4IO8A 3BSAA 4DTPA 1IKYB 2IVYA 4B3RF 1X0FA 2QWPA 3IFEA 2YV0X 3BQ1A 5ADXH 3PHTA 3MM8B 1XMBA 3PTWA 4NE9C 1RILA 1WEXA 2KYZA 3O3HA 1NNDA 4NZ7A 2IDOA 3N5FA 2C2DA 5HMXA 3G8SA 2YHAA 4JRPA 3NHGA 1I51B 4GMKA 4ZVGA 3FEYB 3EYZA 3ENAA 1RHKB 3QO9B 4DL0C 4FF4A 3Q23A 3QB0A 3TSPA 4QW9A 3NEKA 2P1JA 4FYDA 3DAWA 2CNKB 2JVOA 3AB4B 1HBNA 4NYOA 4C0OC 2YHYA 1CJUB 5HBMA 4RX6A 3UKUB 2Y3YA 5A8WB 4PUOB 3CCJS 2GVZA 3J7YI 3KK1A 2XMAA 1IG9A 3N4QA 1QM9A 4NA2A 4ILJA 3F41A 2DY4A 4Q8EA 3PX6A 3X1LB 2BJ1A 1UWAA 4O55A 1NSQA 2F9JA 2B9WA 5LMNJ 3DLRA 3TPQA 1H3DA 2ADCA 1HWJA 3IGNA 3Q83A 2YJEA 2OZMA 5C24A 4P73A 2VB6A 4JN4A 1U1PA 1KVAA 3P39A 2D0PA 2F63A 2FJXA 2GHPA 5JXSA 5BN9A 5DDPC 3ZZZA 2ZITA 4NYPA 4X4OA 4OHYA 1Q5VA 3SUOA 2B7BB 1Z25A 3THXA 5CH7B 4DJBA 4GC7A 4FOEA 4CIEA 3ZZOA 4LUBA 4Y2KA 5BXIA 1ZM4A 1RGIA 3AJ2A 4GKKF 1QJHA 3HL8A 3GR0A 5KFSA 1VOMA 1KAZA 3DHWC 3BN7A 4Y2IA 2LDYA 1VC5A 4U7BA 2HOEA 2A1BA 2RQCA 4ZPDA 1BU6O 4Y3CA 3MECB 5I4MA 3N28A 2KXFA 1QE1A 3H5YA 5KT7A 4W5NA 3CJ8A 1JCFA 4FPIA 2AP1A 1HNIB 1K9MO 4DZDA 3OHRA 1VQ8N 1Y9OA 4DR5F 2J9DA 2CQ2A 4FJ7A 1BA1A 2EW9A 1RYRA 1S22A 3ENBA 1AW0A 1ESVA 1SXLA 3NWRA 3DOMB 1Q81T 3PYEA 3JTNA 3RW6A 3IGVA 3C65A 1S7HA 2VIHA 1NK6A 3M8YA 4QBUA 1EO1A 4CZMA 2D3UA 3PNIA 3QAUA 2Z2YB 4QS7A 3CJ7A 3OTOJ 2CJQA 5AQFA 3TZXA 2FHOB 1ASUA 3QZ7A 1NSAA 1JLBA 1D8ZA 2JH3A 5CYQA 3CULA 4K59A 1RAEB 3H46O 1X0PA 4LBPA 4J9LA 2QI2A 4IOCL 2FIUA 4M41A 2P9NB 2ZH2A 3HZGA 2QA4S 4I64A 4FN5A 1CQMA 3EZWA 5KGXA 5KGWA 1HKAA 1VK0A 3TWHA 1YI2N 4I6WA 4E7IA 1KEKA 2IRUA 1SAZA 2ZNZA 2X78A 4FJGA 1N34F 1NPPA 1X4DA 2JDJA 1SQKA 3K59A 5LMUJ 2ZHBA 4H5VA 1ASVA 3PYGA 3TAQA 1RDDA 1PSDA 1BOTO 4OZ2A 4QOZB 4URSA 2MKIA 4K0KK 1YZ6A 4DR4J 1R8HA 4CH0S 5HMWA 4XH4A 4J37A 2FUG9 3AODA 3TZYA 3C15B 4AFFA 3HP6A 1NJZA 4C11A 2XM3A 2HNDA 4K4ZA 4G3IA 1SL2A 5LJ5Y 4TY8A 4E0DA 3D6RA 3J80O 4BVOA 1VJQA 4PXBA 2HEKA 1W2BM 1S9GB 1M5HA 3FGUA 2V2QA 1SCJB 3MXJA 3I8DA 4CLKA 2HAFA 1X3NA 1NBEB 2EFQA 4K5RA 4ZJLA 4OJGA 1A5VA 4Y00A 3POTA 3DXKA 1FKPA 1WC5A 1RT7B 1HWUA 2XYGB 4CF8A 4OYWA 2AZ3A 5ITHA 4JI2K 2G4BA 5THWA 3C16A 4UOCA 1FX2A 3C16B 4BS2A 4DTOA 1GLDG 1HKGA 1YRXA 4FZYA 3NH1A 4DPTA 5DK5A 1VFJA 2F8SA 4G1QB 1EKEA 1JLGA 2WOMA 2Q97A 1PGZA 3G82A 2GUPA 5E84A 1OJ4A 2N3OA 1SKSA 1BDGA 5KPRA 3G71N 5JS1A 2CQIA 3HT0A 2K06A 1U0HB 2HHHF 2F40A 3MR7A 1H2VZ 1HR0F 3MWBA 2X1AA 2WC9A 4ZHRB 2OPQA 3GJQB 3AJDA 1RAFB 5BN8A 1MMNA 1RAOA 3UW1A 4Z94A 2AKWB 4IO9L 1RHJB 1HW8A 3EXCX 4MO4A 2GCFA 1U45A 3SMZA 3CJCA 1HR0K 4I9QA 2VONA 3HFVA 2HHHK 2GIRA 1CG2A 4YS2A 2P9LA 3GV5B 3EX7B 4IFVA 4PQUA 2OPPA 2AJ2A 5AQWA 3CJBA 4KHYA 5A76A 2X74A 4CF9A 1X4HA 1S9EB 4URQU 1JJ2R 7FDRA 1RDUA 4YR3A 3F5TA 3O9SA 1NWKA 4DV3F 1U1NA 2KZZA 2IGIA 5FRMA 2D1CA 2Z1HA 2ZGYA 2WW8A 3E9LA 1T05B 4KYZA 4B9LA 1S1UA 1YBUA 4JKFA 3HHDA 3T1AA 1YRUA 3QGGA 1WNEA 2HHQA 2M52A 1UFWA 3RR7A 4EUVA 3QLHB 4JK8A 4ANDA 3ZSWA 5J2PA 2FBVA 1NK8A 4LF8K 4IOCQ 3ZLJA 4PG6A 3V4MA 1HHQA 3FZMA 3KLIA 2XMVA 1K9MT 5D4OA 1DJ0A 2C1EB 2M8DB 3ZT1A 3CCMN 2F7TA 2CVEA 3W1YC 2EFOA 4B3TJ 2CXEA 5EX3A 2E29A 1I94K 3B6BA 2ZC4A 4LVNP 2YWFA 2M7SA 3BZCA 4NCBA 3W5XA 4HCBA 1GK8A 2VDHA 1ACMB 1KD1O 3HZ6A 4JI0F 4A4JA 2DPJA 2XYHB 1VRUA 2FHMA 4A8FA 5FPEA 1ZZNA 4YUDA 1Q82O 3ZTPA 4CBXA 2XMTA 3MDFA 2QT7A 1RT3B 2RHQB 3DRRB 3QEPA 2VV5A 4LRAA 2VQFF 2ZE2B 1YZ7A 1HNXJ 1FWLA 1HYSB 3PYFA 1EARA 4IO1A 1PILA 1WSFA 3ZX3A 3K5PA 3KFWX 3EY1A 2J9CA 1P8ZA 4AH9A 1V5VA 2CJAA 4DSEA 3QNOA 4YOVA 2BUPA 2G9OA 3HHLD 1LWCA 4CJRA 4CECA 3C6AA 3G25A 3AVIA 2DISA 1FRHA 1RNHA 4WFBL 2V9KA 4O4GA 3H3NO 3A0IX 4RUCA 4QIEA 4KT0C 1ASWA 1Y4ZB 3VPZA 2HK2A 4HVJA 4FJLA 4L73A 3WQUA 1YJNS 2QWQA 2ZJRQ 2ITGA 3W2VA 3W9HA 2XWXA 1OSCA 5B08A 3CC4N 4CF0A 4PG8A 5FPNA 1X5SA 2JOQA 2YX4A 4WU2A 4NB4A 2XC9A 1KR4A 2IOCA 1CZBA 4LRBA 1T3VA 2E1CA 3VQSA 3UD5A 4B1ZA 4H4OA 1S5ZA 1C0TB 3LDPA 3TVYA 1QSSA 4FL9A 1VQ7N 3ISNC 5KFQA 3SJHA 4UY8O 3DLEB 2FD2A 5HQMA 4NLBA 1GLBG 1JQGA 4M94A 1U6FA 5CD4H 4LQ3A 2YNGA 4GVBB 2HBRB 4F0KA 3MMBB 3V9UA 2XZWA 1LW2B 2U2FA 3B6PA 1NGFA 4KTWA 2ZBCA 1S77D 2R7VA 2E6MA 2E1RA 1S6UA 1VMBA 3ZETA 2E5JA 2C3UA 4CT8A 2DNZA 3OBIA 2BQUA 2E7XA 5IT9O 4DL5A 2KRRA 4U96A 2VQFJ 1R0BG 2W25A 2GO8A 2F5GA 4KHSA 5GAEU 3OVSA 2R2UA 4IYQA 1FJGK 4FS1A 2N7CA 4U8YA 2QLWA 3BYPA 4FK0A 3NMAA 2AX1A 4H8KA 3MMCA 3NGDA 3HX9A 3HVTB 1RBAA 2MKSA 4KHPF 4NCAA 4ISEA 1R6YA 3J7Z5 2B5JA 4NLPA 2HQCA 4YHHF 3WX8A 1ZZFA 1RFQA 1KDNA 2JNJA 3DI6A 3CJTA 1RGVA 4CBUA 1VQ4S 5ETLA 4QU6A 5AE2A 1IQZA 2ZDOA 3R1XA 3ZX0A 4BGBA 3OXLA 2NXNA 3H08A 2BW7A 5CAAA 3BV8A 2ZH9A 3CIPA 2ETJA 2R4FA 3VGMA 3R6LB 4LR8A 4NL5A 3K7RA 3OYKA 5KG3A 1VLYA 2YCHA 2E1PA 2A10A 5H9FK 4NXMJ 4IOAQ 1T02A 2YBVA 1U2FA 2OELA 4WJBA 1ICEB 2ZKUA 2PT0A 3CETA 1HQEA 4RW6A 3QNNA 3W3SA 2BX6A 3IMXA 1NK9A 1FFWB 2B4VA 1YBAA 3EPIA 1N32J 4F4YA 2KT2A 1GH8A 2UP1A 3FZFA 5KOWA 2GA7A 3QESA 4LRDA 5LXRA 2HQGA 2ZC3A 4QCLA 3MR6A 3NBPB 2OLWA 3MMJA 1KOHA 3WBZA 1FJ7A 2O8EB 4BRLA 4B9SA 4O0IA 5IT0A 4DV2J 3TAEA 1IWGA 5AQTA 3U6FA 1HR0J 2DO0A 3RTVA 2HNZB 3QZ8A 4KRFA 3BY5A 2I7PA 4L3QA 1IBKF 1P9QC 4HTJA 4OQJA 5B0FA 1NDPA 1XMOK 4CGFA 1WJ9A 2M2BA 1C1CA 1VDHA 2RE2A 4NASA 1M90O 4CI0B 4JI8K 5DQGA 4MK9A 4ELVA 5GIOA 2AGPA 4O44A 3TAMB 2CQ0A 2UUCJ 3ZTRA 2DNLA 4IRDA 3NGKA 4EP5A 3O6QA 1TMJA 2LU2A 4ERDA 2EBGA 3ET6A 3CI5A 1T9YA 4LF2A 1OO0B 2G2ZA 2DNPA 4AL6A 3I33A 4DR4K 2RQKA 3GDQA 1WKKA 2HBKA 3PX4A 4U67Q 3T19A 1HYVA 4JV5J 2OPSB 5CCMA 1XR5A 1X1PA 4NI2B 3CCZA 3M5RA 2D69A 1VBKA 4DL7A 1RHQB 2EKNA 4P2XA 4LMZA 1N36J 4HDHA 1GXTA 4J7CA 1SS6A 1VR6A 1N52B 1XBWA 4OZJA 4DR2F 3R7BB 3Q89A 2RILA 2VFTA 1VSHA 1JKHA 1HBOB 3T6BA 4ED7A 3UKRA 3DJCA 1RBOB 4JI2J 3TWZA 5BYRA 2CH5A 1I6JA 5DG9A 3W2WB 2RUGA 2ZH6A 4LF7F 2A2DA 3CFOA 4DN9A 2NRWA 2AEFA 1HBUB 3VF0B 1Z26A 4EBDA 3G71S 1B64A 5KG5A 2NR0A 4HWIA 1BE4A 1V6HA 3HI0A 4BQZA 4ZLLA 2Q3PA 3AA3A 4KV8A 3X3UA 1JNZB 4ZCIA 4TY9A 1G15A 2NXEA 2UUAJ 4GKJF 4BQLA 4LF5J 2LVWA 2XEXA 1TKZA 3I0SA 4JB8B 3HD2A 4ELTA 3DC2A 3CC4S 1F5BA 2QA4G 3AGKA 2P2CB 2CNOB 1GLEG 3RRKA 4JI4F 2L3MA 2M70A 1YVUA 3C6TB 2DTUA 2U1AA 1MDUB 5B0AA 2IIRA 3GIMA 1Y64A 1L3UA 3DWLA 2OTJN 3JSRA 3I5CA 3H6EA 1HFEL 4LF6F 4JI3K 4ZDNA 3RB0A 4ZLJA 2J7WA 4KHPJ 3OQ2A 2GAHC 1RWMB 1WDDA 3DDNA 3ENOA 3OR1A 1BWEA 4TQSA 2ILYA 4DV0K 5B8HA 5K8NA 2OAUA 1FRMA 3VEWA 1R8BA 1H1VA 4CNZA 1O1WA 2V94A 2L08A 1HJOA 3NF9A 2G8FA 5HP1B 2DO4A 4QIFA 1GX5A 4O3SA 2QSWA 2GMLA 3D9BA 1M1KT 3OVBA 1F2GA 4JHDA 1MWKA 4BVPA 2RF2A 4UF4A 5CXTA 4Y2CA 2R42A 3R5CA 1BA0A 3BB5A 3SUNA 3TTFA 3TEHB 4CZIA 4KKOB 1MNEA 3WC0A 1GAOA 3HO1A 4XH5A 3GJTB 4UT4A 1S1TA 4ED5A 3Q8SB 3C0BA 1S1TB 3AVFA 1WC3A 1S1XB 1EP4B 4FM2A 1JLEB 4HKQA 4XPEA 3FBEA 3ZTQA 5KPTA 4PYDA 4ID5A 4C11B 3E66A 3MGJA 1EETB 2GHVC 5KT6A 5K9FA 5T7BA 5K20B 3M8PA 1YITS 4F02A 1SIZA 4GVLA 4CEDA 1YK9A 4F2RA 3POTB 3MCOA 4BC3A 1BI4B 4LF9K 2LXUA 4KE5A 2ZOGA 3UCGA 5EUHA 1C0GA 1J6ZA 2W2OP 4LIRA 5DZ7A 4AXIA 5B09A 2XMKA 3HPOA 4OPHA 1IBMF 3PIOQ 2ZUAA 3Q8QB 2G8VA 2J9EA 4AHRA 3C7NB 3OBYA 3QYYA 4CK1A 4U7UK 1VSKA 2POKA 1NHVA 4H4MB 1WUAA 1GMWD 3K5NA 3GYGA 2ROEA 5LXYA 3JSYA 2R7YA 3GCWP 3IRWP 4N5SA 2W9BA 4ED2A 2GVDB 1GLLO 4GVBA 4YDXA 4OZ5A 3A5OC 2ASLA 2HIYA 4ZVQB 3KXDA 4CRJA 3I4PA 8AT1B 5KT2A 3ZETB 3QETA 2KQ2A 4WFBQ 4FBUA 2HGLA 3HKZD 3VQPA 5E3CA 3DI6B 3CCSS 2O4IA 4OL8A 4LSNA 3PW5A 1NOZA 4JV2A 2VYPA 1JLFB 4JKCA 3UVJB 1YXQA 1S6PA 1HBOA 5KG7A 1IXKA 1PCAA 3H2VE 4N41A 4LF9J 3C3LA 1UCNA 3FRYA 1IBMK 4B3TF 3SBGA 3VQ6A 2VJVA 1U02A 2RU9A 3ATUA 4CJTA 4DUZF 4RNMA 4I0WA 3SI8A 1HX1A 2GMJA 2DR5A 3VF4A 1RP5A 3BSOA 1WI6A 4IH7A 1YGYA 1FERA 4DV6F 4ECXA 3PR4A 1JLCA 3D2FB 3V9SA 1Y00A 2WFBA 1T03A 4KB1A 2ZOFA 2DHHA 3MFHA 1BQNB 3DYAB 2R8GA 1U48A 4OX8A 1J5EF 3DYAA 1NLVA 4FWQA 4DV0F 3ZSVA 4OI3A 1SZ2A 2D0OA 1FRXA 3NDKA 3CC7N 5E3QA 4N7TA 1VS3A 1E4FT 1QVGM 3NF7A 3VF6A 4CQ1A 1I3OB 3CJ4A 4BC9A 4KY3A 3Q86A 4FJHA 3SSRA 2RB7A 4DL6A 3E1YA 3NH2A 4ES2A 2E9RX 1S49A 1OVYA 5CD4A 2UVWA 1YRTA 3CG7A 5AXLA 3OR1B 1N5YB 2QWLA 4NCGB 1Z2ZA 2IVFB 3I0SB 3TAGA 3DM2A 2WBMA 3OJUA 1WSVA 1VQ5S 1VRUB 5CYMB 5AQZA 4DU8A 3NGIA 4KB7A 3TAMA 2CRLA 2E2QA 4JI1J 3V1QA 5A2QY 2W2PP 4RWXA 1T3NA 4DV7J 1CEZA 3WNEA 2HHHJ 4K2XA 4ZKAA 3ALYA 2MQQA 1NPKA 2PEBA 3THTA 4JRQA 4OMFG 3F9MA 1OH5A 5C2FA 4OGCA 2DHAA 4OJ1A 3CQYA 2B4OA 1CXUA 4YOYA 3CJKB 4I2QB 3O8MA 1HMVB 2OD4A 1Y5NB 5J1NA 3EDQB 2E66A 2JEFA 3OJSA 3CMAN 2OTJS 3VQ5A 1N5TA 4WFNQ 1BD6A 1FO1A 3HVRA 2DRBA 2HBJA 4NXNJ 2FLOA 2YX6A 1RBLA 3BGLA 1TL1B 1XI1A 1OY9A 3QQCD 3NNCA 2XO6A 4C4WA 5HRPA 4EK2A 1W7WA 4DMNA 5BJRA 1WOOA 4QJVA 4AUKA 5KFYA 4Y0WA 2NNWA 4H0OA 2UXCJ 2N4DA 4ZCMA 1VGYA 4EFHA 1GMUA 4P2SA 4WK3A 4YB5A 3H5UA 3CYMA 4AQYJ 2B51A 4RW9A 3MPDA 4PQAA 2FJDB 2NRHA 2A2CA 1FRLA 1Z6RA 2DNOA 1OS5A 1F6TA 2V5HG 2BRKA 3WEEB 2FY1A 3VALA 4JI8F 3SPZA 2BABA 3AO1A 3W65A 1YG0A 3MUTP 3FBFA 2Z1GA 3OL7A 3IUCA 1X4BA 2HLUA 3RG6A 1TKZB 3QNWB 5C42A 2IJFA 5IT9Y 4CK2A 1LW2A 1QTNB 3PFEA 4UZBA 3RAQA 1VHFA 3W5ZA 5DETA 1CULA 4OZLA 2YNIB 4WYBA 4B9VA 2FXUA 1NLKL 2OI2A 1A5WA 2H48B 4KRWA 4DI6A 3AT1B 4M5KA 2J0XA 1Q8KA 5EVZA 4ZVEA 2HF3A 4BG9A 4E1JA 5T7LA 5CQGA 5KG4A 2BYCA 2CPYA 7FD1A 1XR6A 2W9AA 2P9LB 4CO5A 3P31A 3HI9A 3CCMS 1WBBA 4J2EA 4X4SA 1MMDA 1S76D 1MWQA 1S9EA 3KNAA 5BPLA 4TN2A 1SC4B 2CVIA 2MB0B 1SJ3P 1K47A 2C2NA 1X4FA 3AVCA 3QFPA 4A57A 1YJVA 1RTIA 4XH1A 3AA2A 3O3GA 5E26A 3CD0A 1UEUA 2DGWA 3IFRA 4FWRA 1TZ0A 4CLWA 3AD7C 3KG0A 3IKMA 5AQUA 3P5JA 2MQMA 3DRPA 4A8MP 3S3MA 4MDAA 2AZ1A 3QWUA 4DEZA 3IBWA 4FPRA 4ID8A 3NOCA 2XSJB 1B0PA 3ZSYA 1VQ9N 4TQRA 2IYIA 1AUSL 4EIAA 4DTMA 3ZZRA 3PACA 3HK2A 1NMDA 2O5DA 2IM1A 3LZIA 2ASPA 3LGHA 4DQRA 3SQ1A 3GG1A 1TK8A 1W7AA 2QLXA 1CXQA 5FLXY 1QS4A 1D09B 3K5OA 1WNSA 2UUWA 3SUPA 4GKKJ 1VQKN 2P9EA 3DOLA 3BPSP 1S1WB 2QMWA 3VHQA 4JAXA 4RUHA 1Q78A 2IDLA 3C15A 2DD8S 1RWOB 4JOUA 2FY8A 2DFHA 3M30A 1F21A 3AFGA 1NJXA 3G8QA 2ZNYA 4GVEA 5HQ8A 1HARA 4OYPA 1HYSA 4EP4A 3KLEB 5LMNF 2VOPA 2W6LA 5J1PA 3C46A 4DQSA 3CCQN 3U27A 3KWGA 2QXLA 2CAJA 4JK9A 3LDLA 3CXCR 4FLZA 3QEIA 3O9UA 1IBLK 3KZBA 2ZVSA 3VEXA 2YTCA 1UW9A 3DXBA 3CC2S 1YHQS 1LOTB 5IC4B 5KFLA 2QV6A 1P9YA 1PJ7A 3D2EA 3DFEA 4KGMA 2ALYB 4CZJA 4X4TA 2ACMA 3H5XA 1TV6B 4I67A 1M5VC 2YHXA 3OT9A 2CJ9A 2LA4A 5L1LA 4CI6A 4QAGA 2H65B 2LYVA 3GZ7A 2GQ2A 3ZT4A 2Q79A 4CZEA 1WSIA 3RAXA 1WF2A 3C66A 2R8JA 4ED0A 2VBXA 5KRTA 1U04A 3QT7A 2J8AA 4FK4A 2HB5A 3NFAA 4IR1A 2KFZA 2K1RB 3AA9A 3N79A 2VFRA 5F3ZA 3G2XA 2HYIB 1JLFA 3LDSA 3QWPA 2XTJP 4OO1J 1U4BA 5D4PA 1EKSA 3K9KA 1DBDA 4EAHD 4A47A 1GNKA 3D66A 4I2PA 3H4BA 3U4LA 4JV1A 1UVIA 2GZOA 2OFGX 3VQDA 2CGKA 3LWLA 4JBCA 5GAGP 3W2WA 2BXJA 5F0WA 2K2PA 1VQOS 5F0UA 3CC2N 5DLFA 3RMCA 2DEJA 5AQNA 3L2UA 5M2RA 2Y9HA 4U95A 2HZVA 3ITHB 2KG1A 3VAMA 4DR2K 4OV1A 3H7HB 1QQCA 2H5EA 2DNNA 3ISZA 1A6LA 4RO0A 4DR7K 3J81U 1IQTA 5AJ3F 2A3ZA 5ETQA 3MM9B 4DSFA 4G1PA 3UN5A 3MMBA 3U8XA 2XHBA 3NXZA 3C6UB 3VGTA 1YX2A 2QA4N 5KFMA 4IOBA 4IEEA 3LGNA 5L1JA 4RW4B 4DFMA 4ZLPA 1XNQJ 4QIWD 3HHNB 4Q5VA 2QXFA 4RZRA 4QIVA 4JKBA 2V0NA 3P38A 1RHUB 1OYEA 4DS5A 3R6MA 3R8EA 3TP2A 3MPYA 1WTFA 5EN1A 2XG8A 2BE9B 2MTLA 4I7FB 3BKUA 1ZXOA 2XQCA 2GX9A 5DGAA 2DHGA 4LF6K 2MSSA 5DRKA 4F0MA 1S5JA 1JLBB 3OR2B 3SZ2A 1U2CA 2OANA 4DFKA 5J2QA 3TA2A 5F8HA 1SKWA 4OI6A 2DHSA 4YOUA 2NYHA 4A46A 1WEYA 2HF4A 3A8EA 1DZ5A 3CB4A 4CLSA 1TGOA 1NGAA 1VQPS 4K43A 4RTFD 2CPJA 4IG0A 4EFAC 3SQ4A 1SJFA 3F44A 2W7AA 1AUDA 3LPTA 3PYDA 3JSBA 4P2MA 1RA6A 2A6OA 3J7AP 1IV0A 4RW7B 4AT1B 2ERRA 3AA8A 3LP1A 1I3AA 2FSJA 2KH9A 5HMYA 3FGVA 3VCDA 4C7QA 1QQOA 1X5OA 3TVKA 8ATCB 1B99A 4CVNE 1TVRB 2MQ8A 3ENVA 2W4PA 1HNWJ 4PWWA 1MROB 4WP3A 1WHWA 4B1XB 1Q86O 4DSJA 1VSMA 3VQCA 4DUYF 1U47A 4LF5K 3SYZA 3S7RA 3TANA 2P8IA 5HSPA 1WF0A 4RW6B 2BW2A 3C14A 2OGUA 3NCQA 3C14B 3FZLA 3MM6A 3JS6A 2CWXA 2OSQA 2BH1A 3OFFA 2DNKA 4CJLA 3T5LA 1OH7A 1MWYA 4CM0A 3J81Y 1B7FA 2X3GA 1EZZB 4IG3B 1JXLA 3MEEA 1RQ0A 3IP0A 4OX9K 5GADI 3THWB 4JP8A 1BMQB 2DCLA 3OYNA 3ILOA 3KLEA 4IKFA 4W4MA 3OS2A 4A8WA 3KD5E 1KNZA 2F4VK 3SCIE 3RBXA 1MWZA 4FJ8A 1MWMA 4DG1A 1R27B 3ZFVA 1VHIA 1FKPB 3LANA 1XK8A 4QQBA 4USIA 4DX5A 3Q8VA 2IC3B 2J0WA 4WE1B 1JMTA 3CF5Q 1AFJA 3QIOA 3BO2A 4L3KA 3MM5B 5JJBA 1RWKB 3QJJA 3I87A 5B0EA 1GOBA 2D4WA 1HHTP 2YKPA 4USUA 1DARA 3O9QA 1OKJA 3CJ2A 4CJVA 4G9ZA 3PDNA 3SPYA 4HDGA 3VAGA 1NGJA 4ILGB 1PYSB 1RWVB 4DV5F 3S6EA 2QL7B 3O80A 4CZKA 3FZ2A 4LF4J 2EG2A 4MIBA 2BR0A 4RCHA 3VENA 4WU3A 5D15A 4JKGB 4BC2A 4H4OB 2PA3A 1RT5B 4ZHRA 5C10A 1V3SA 2RE1A 1XWLA 3T9ZA 4J9SA 2QW9A 2CPZA 2LQJA 4DV1F 4ZTJA 4B02A 1G1XA 1H72C 3SJJA 5ETNA 2Y0BB 3QAEA 2AIRB 2FVSA 4FLXA 2EC2A 4U67L 1N56A 3TAFA 2RHKA 2Q3SA 3M1VA 4HI1A 3I82A 1NJWA 2YNFB 3KKFA 3UN3A 2LQ9A 3MEDA 1WG4A 2XMJA 4PABA 4IO9Q 5KG6A 3DRSA 2JEIA 2XCAA 4BHQA 4DTSA 2CJYB 2G1HA 1U0SA 4ES3A 4OHXA 1HNIA 4NEYA 1Q81O 2CZ9A 3MMAB 1Q95G 1C6VA 4M8LA 3EO3A 2E5LK 1EQMA 1EJ7L 1F3FA 3GYNA 2QLBB 1HQUA 1K0TA 1X9SA 1U1MA 4JKHA 4E7HA 1T95A 1X9WA 3E9OA 4JD2B 2DGVA 3OPKA 3ATVA 3QFWA 2R7WA 3NY0A 3EICA 3P45B 3GILA 4DTNA 5IM0B 4FW1A 4ZCKA 4LF1A 4BLGA 3H20A 1N6QA 2HSEB 5F8IA 1RE1B 4ED1A 4LR9A 1TKXA 4FF3A 4K4SA 4ITSA 2J0SD 2FZCB 3Q7CA 1KHVA 3K58A 3AO4A 2AJ1A 2BE2B 3IAS9 2BE2A 1WWHA 4Y1DA 3HHLB 1VQ6N 1ATSA 2NLWA 4KH6A 4B3SK 4F4WA 1S59A 1KVBA 1CPZA 1WC1A 1E6YB 4DR7J 5HL7Q 1WI8A 2HVDA 5C15A 4GV9A 3M8WA 2XMUA 2GVZB 3JAMU 5LL6Z 1IO2A 3BN4A 2HWHA 2A18A 2E5LJ 3CJ0A 4IZ9A 4JLHA 3OYCA 2ILZA 5K8PA 1RBSA 4H5TA 1KQSM 4ZTFA 2C3PA 4UQGA 4DF8A 2IVNA 3OYFA 2OEJA 3PV8A 2FHJA 4M5MA 2LECA 4DS4A 1HWLA 4FLYA 4M3WA 1XHZA 1KVCA 1KLMA 2YNHA 1FA0A 3F9KA 3O44A 2YPYA 1R8CA 3MCSA 3GMGA 4LF6J 1CVJA 3IN5A 1VIXA 4DUTA 4FW2A 4OHWA 4Q8FA 4XIUA 3ZSZA 1IJJA 2FQQB 3CNQP 1OYDA 1HUXA 1A5XA 2ZH5A 4JI1K 4QS9A 4NLGA 3LWMA 2QSFA 1R8AA 1EHWA 4B3SJ 1PJ6A 4DSKA 5HATA 1RT2B 4G65A 1FDAA 4WYLA 2DRDA 1UMJA 5GAHP 2VHGA 4CJEA 4O3QA 3EGNA 5KG1A 4XPCA 2R8KA 1FK9A 1CC7A 2HBLA 5D0GA 2HW3A 4O8UA 4R8UA 3HF5A 3ASMA 2QX0A 4Y2AA 2GJFA 4KFBB 1FRIA 3O1LA 3G6YA 3A3OB 3CJAA 3GLJA 2YVSA 5HMZA 3BDPA 4LF7J 1QAIA 4Q2LA 2ZOMA 4ECRA 3L4IA 3B54A 4JI4K 3PW7A 1WKLA 4PKGA 2G8UA 1Q0NA 5GADP 2M88A 3SCKE 3T5KA 3OL6A 2JLEA 1CULB 2FJAB 3A8JA 2PYLA 4F67A 3AO2A 3HD1A 4GKJK 2B9XA 4K4VA 1XJWB 1QVFM 3VEZA 2IA0A 3D1QA 2KHCA 3BJYA 2UXDF 3QFHA 3U3YA 4AQYK 5IWAF 3PJXA 3Q2TC 3R3LA 1ITGA 4FYWB 5KRSA 2V34A 3R8YA 5KFRA 3FCVA 3L8BA 1FWKA 1N34K 3PEHA 1XTZA 4ECTA 2GQCA 4TSXA 2YWKA 4FXVA 3HSDA 1TKDA 3UCZP 3KG1A 3ZSQA 1QLNA 3ZT0A 1EIYB 5FD1A 5B0GA 3K2YA 2E9TA 3MI7X 5ELZA 3NMRA 1N5YA 1REGX 1NGIA 2UUBF 5TKYA 2L9DA 1BL3A 4CBWA 4RW8A 3VEVA 3T1HJ 2I7NA 1RLCL 5MAOA 2C3YA 5KFBA 1SPBP 4L3NA 3EGWB 3R27A 1ZBLA 4DR3F 3VETA 2CQBA 4QW8A 4CD3A 2RIJA 4OYAA 3CCES 2HRYA 1IBKJ 4DPOA 1UOCA 3W60A 4TU9A 3KNGA 3FR0A 1PC4A 2QKKA 1UAWA 5BR8K 3CDAA 4DV2F 1QAXA 2BOAA 1CJKB 4DR5K 2HVZA 3TX8A 2DIUA 4W5RA 3BR9A 4ZCLA 1S79A 1XNRK 1QUVA 3GTYX 4NRUA 3MN9A 2ROGA 4RBUA 1ZBFA 4YHHK 3QRQA 3C95A 3IBCB 4F36A 3OUYB 4JEPA 2GWJA 4NOHA 4J2AA 5G0RA 2W4CA 4X64J 4P74A 1AZSB 1JXEA 5IM0A 4UUXA 4ZVUB 3O5TB 3MM5A 3I31A 1FKAF 3R2DJ 2LEBA 1PYTA 2AF6A 1WLJA 4HI2A 5AXMA 5KFGA 4EMDA 1RHRB 1AA1B 2BJ9A 3RB4A 2C2RA 4I6AA 3KHLA 3G9CA 2RUSA 4OYOA 4LFAF 3FDSA 5J1EA 2RQMA 3KVGA 2G1DA 3HKWA 3QT8A 3AAPA 2YWEA 3ELHA 5HJYA 4OHVA 5HROB 4USWA 1I39A 1NCLA 3DU6A 3OYAA 5J2MA 4FWLA 3CDEA 4QZVB 4DV6J 3IWNC 5D6GA 4NLOA 2CDQA 4IDKB 4PXEA 3QMLA 3CEDA 3ZZYA 3MMVA 2A6AA 4DUZJ 3PKYA 4CJQA 1RT1B 3T3FA 4WIQA 3I6PA 4OZ0A 3JXUA 1QAJA 4ZVOB 3R5AA 1TR0A 2JC0A 4F7VA 1L5UA 2NS1B 3KK3B 1IKWA 2C2KB 4WZMA 5FPDA 4PY5A 3NG8A 3KJVA 1N8RO 2COLA 2X6NA 2K1RA 1RZMA 3ZT2A 3D1HA 3IG1B 2FHKA 1IBLJ 4M5NA 4KV8B 3A5LC 4GW6A 5GMDA 4CFCA 1JJCB 2DJWA 5L8RC 4LJMA 4P72A 1N54B 1W2IA 3D7SB 2DVIA 4NWBA 2ZH8A 4KSEB 3N0VA 4A8YA 3ENWA 4Y34A 1QHAA 4ED4A 4WE1A 3PFOA 1X7VA 3LDNA 5M1NA 5KFTA 4M42A 4MLHA 2BM0A 2Y1LB 4DR1F 4M5GA 1YT3A 1FXXA 3UVJA 3KLHB 4LY7A 2FVPA 3W62A 4TNOA 4DU1A 1GLCG 2ZDPA 3QSYB 5C25A 1KQSR 1T9XA 4ECWA 4CE9A 1VQLN 4YFUA 2ACYA