2HMIB

Hiv-1 reverse transcriptase/fragment of fab 28/dna complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an antibody Fab fragment at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/dna
molecule keywords DNA (5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*G
total genus 104
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hmiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiB02
1JLQB 1S1UA 4IFVB 3T5HA 3CWJA 3DLEB 2HNDB 1RT6B 3M8QB 3IRXA 4DL2A 3PW2A 1JKHA 1KLMA 1I6JA 1EP4A 3D28A 3KMSA 3T19A 1LWCA 3JYTB 4M94A 1REVA 1TQLA 3BGRB 4Q8EA 5KFGA 3H4BA 4ZP6A 5J2QA 3N6LA 3QIDA 2W8KA 2HNZA 5KT5A 3KK1B 3MECA 1C1BA 2HMIA 4WFXA 1SH2A 5J2PA 5HP1B 5C5JA 1S1WB 5KFCA 3V81A 4K4WA 3RBDA 1GX5A 1S9FA 3NGDA 4I2PA 4WFZA 4RNHA 1LWCB 3NAIA 5DQHA 2OH2A 1N5YB 1RTIA 3H59A 3I5CA 3KK3A 2OPSB 2RDJA 4ECWA 5J2QB 4ZHRA 3GIJA 4O3NA 4WFYA 4I7FA 2WHOA 2ASDA 3IG1A 3HVAA 3KMQA 4ED7A 4X2BA 1S1WA 5KFHA 4FBTA 4J9PA 3ICLA 1JLBB 3CJ2A 2YNHB 4K4SA 2IC3A 2R2UA 5K14A 3QIPB 4ECVA 3LANA 4B3OA 3QGHA 3OL9A 1RTDA 2OPSA 2HWHA 2D3ZA 5DGBA 4ZHRB 4LSLA 4ZP9A 3QGGA 3KK2A 3CDEA 2HAIA 3HKWA 1T3NA 1RYRA 2WONB 2ZKUA 4JV1A 3TVKA 5EDWA 4NLUA 5FDLA 5KFMA 1RT1A 1C0TA 3DRSB 4NLTA 4ZP7A 3MFHA 4KHRA 5KFQA 4TYBA 4EYIB 1S9EA 4ECXA 5F8HA 4IR1A 5EWFA 3CIZA 2O5DA 4ZPBA 4YP3A 3BQ1A 4EBDA 4LSLB 3GYNA 5KFDA 1VRTB 3RB4A 2VA3A 4RNNA 2VA2A 3KHRA 1IKYA 1C0UA 4ECZA 1JLQA 2WONA 2VG7A 1TVRA 1RT6A 3M8PA 2OPPA 1FKPB 2FVQA 2GC8A 5DGAA 1JKHB 3T1AA 1KLMB 1BQNA 1HPZB 3LAKA 3DMJB 4IDKB 4JV0A 4YQWA 4J9LA 1S97A 4MH8A 3DRPA 2V9WA 2R8KA 2BQ3A 2ZE2B 4H4OA 1VRTA 2W9BA 3BSNA 1QAIA 2R2SA 2OPRA 4KE5A 4NLSA 1HQUA 3MEDB 1C0UB 1C1BB 2HMIB 3I0RB 5KG5A 3CJ4A 2R8IA 4DL4A 1CSJA 3C6UB 2XCAA 1SUQA 1HYSA 2ALZA 2C22A 2UVUA 1IKXA 2RKIA 5KG0A 3E01B 5KT6A 1RDRA 4YR2A 4ECYA 4PUOA 2ILYA 4MIBA 4NLGA 1RTIB 2DPJA 4QW8A 2ZE2A 4H4OB 5HROA 4NLRA 2W9BB 2YKNA 2OPRB 2IAJA 3H40A 4YMEA 2VG6B 3OL7A 2XCPA 1RTJB 1SV5A 4IG3A 3QGIA 1ZTTA 2UVVA 5C25A 3QZ7A 4Y34A 2BQRA 2JEGA 4QPXA 3MR2A 2YNHA 3T5JA 4R8UB 1HNVB 1TV6A 3KLIB 3QIPA 1JLCA 4HKQA 4ECRA 2ASLA 4QWEA 1R0AA 1C1CB 5L1IA 4JV2A 5KG6A 1KHWA 2JEIA 1QE1A 2ILZA 4TQRA 2V4QA 2YKNB 1FKOB 5DQGA 3CDWA 4MK7A 3GQCA 3RBEA 3OSPA 2IMWP 2QE5A 3I0SB 1MMLA 3IGVA 2IA6A 4NLPA 1C0TB 2UUTA 4Q45A 4RW8B 3SFGA 4QWDA 1FK9A 2B6AA 1JLCB 1TKTB 3DLKA 2W9AA 5DLGA 4Q0BA 1TL1B 3LP2B 5I3UA 2UUWA 5HBMB 3NKYA 5C42A 4ZPCA 1QE1B 1JXLA 1RT7A 4IRKA 4IG0B 3DI6B 5C24A 3M9MB 1JIHA 4LQ3A 3QYYA 4J9KA 2AGOA 1N56A 3KLFA 4KFBB 2BE2A 4TY8B 4URQU 1FKPA 4H4MB 4NRTA 2HNYA 1HPZA 1BQNB 4KKOB 3DMJA 2YNFB 3ISND 4IDKA 1GX6A 2R8JA 4O3RA 3Q8SB 3M9NB 1LWEB 1S1XB 4ID5A 4QWBA 4G1QA 5HBMA 2OPQB 3V6DA 3HVTA 1SH3A 2CKWA 1N48A 1RT7B 4QW9A 2JEJA 3DI6A 4R5PB 1YVFA 4WZQA 1HMVA 4O44B 5J2MA 4YR0A 1HYSB 4J9MA 1ZTWA 1JLEB 1IKVB 4DG1A 1RT3B 1U09A 3E01A 1UWBA 3G6XA 5I42B 5KFWA 2V0NA 4DL6A 3KJVA 4ZVHA 1RYSA 4FS1A 4ZP8A 3DLGB 1RT5B 2B5JA 2OPQA 3V6DB 3HVTB 3EZUA 5HROB 2J6SA 4RNOA 4RW9A 2IM2A 1QUVA 4NCGA 1HNIA 5CYQA 2HNZB 2VG5A 2YNGB 3FFIA 3KLVA 3KHHA 3DRRA 3KK1A 4ZVEA 2DPIA 2FLLA 3MF5A 1RT3A 4R8UA 2XGQA 4RW4B 3TAMA 3N6NA 3V6KA 1TV6B 3KLIA 4F4YA 3I5BA 1LWFA 1T94A 3CJ0A 2AU0A 5KFVA 4DEZA 5F8JA 1K1QA 4KB7A 1HARA 1N5YA 2IM3A 3Q8QB 2J6TA 3KK3B 4RZRA 3BREA 4NCGB 4I2QA 1T03A 3IG1B 1QAJA 1S1VB 3KHGA 2GIRA 5JUMA 5EWGA 1XR6A 4URGA 4J9NA 4KAIA 3MR5A 3DOKB 3IS9A 3SI8A 1TKTA 3DLKB 1D0EA 3GIKA 2WB4A 1JX4A 4DL3A 2JC0A 1LW0A 4IFYA 3I5AA 3BSCA 5KFPA 3H5UA 3H4DA 4FS2A 3DM2A 4B3OB 1RTDB 1TP7A 2YNIB 2JC1A 4K50A 3NBPA 2F8EX 5T14A 4PWDA 4MK8A 4QWAA 3H98A 4H4MA 3KK2B 5L1JA 1N6QB 3KLEB 2YNFA 1S1UB 4IFVA 1TKZA 3C6TA 3DLEA 1J5OB 2HNDA 5L9XA 5KFXA 3BQ2A 4ID5B 3MEGA 3OLBA 2WRMA 4RW6A 5KT3A 4IH7A 3PHEA 5L1KA 3DM2B 4J9OA 1RT2B 4LSNA 4KV8B 1MU2A 4RNMA 2YNIA 5D3GA 3Q8PB 3KLHA 3BR9A 3NBPB 3H2LA 4WXOA 1JLFA 4PWDB 4KSEB 1TL3A 3QLHA 5KG7A 3GV7B 5KG2A 3PW5A 3N6MA 1S49A 5KFEA 2ATLA 4OL8A 1N6QA 1JLEA 1IKVA 1XR7A 4K4TA 3V81B 2UVRA 4ICLB 3KJVB 2B43A 5KFNA 4IOBA 3GV5B 4O4RA 2JEFA 2D41A 4ZVGA 3LP1B 4K4UA 5KG4A 4NLWA 5F9NA 4JUZA 4ED6A 1JLFB 3DYAB 4GC7A 4I7FB 1HQUB 1BQMA 3MEDA 3I0RA 1RA6A 3GILA 1JLBA 3M8QA 4PQUA 3OSNA 3G6YA 2E9ZA 1EP4B 2W9CB 2IC3B 2W7OA 3LP1A 1S0NA 2HWIA 3FSIA 4IKAA 4IQXA 3PW4A 3BSAA 1DTQB 3FDSA 1JLAB 3MEEB 3DYAA 1S4FA 3KHLA 2V4RA 1HQEB 2AX0A 5F8NA 2VG6A 4KO0A 1S48A 1RTJA 1SV5B 4IG3B 2D7SA 1S1VA 1S0OA 3G86A 4KHMA 3HHKA 3DOKA 3IS9B 4I2PB 5J1EA 4ECQA 3PJXA 3DRSA 2XI3A 1NNDA 3MR6A 4EO6A 1S9EB 1RA7A 5KFTA 5KFZA 4KBIA 3UDLA 3OLAA 4MFBB 3PZPA 4O3QA 1R0AB 4K4XA 4NLYA 5KFKA 2C2RA 2WK4A 1DTQA 1JLAA 3MEEA 5F8LA 3KNAA 2WTFA 1FKOA 3FQKA 4XPCA 4F4XA 5DG7A 2E9TA 3PW7A 3KLEA 4O3PA 4O4GB 1TKXB 2ZD1B 4K4YA 2E9RX 4J9SA 3MEGB 4LQ9A 3UPFA 4IH5A 5KFIA 4F50A 5KFFA 1DTTA 2D3UA 2EC0A 4J9RA 2RF2B 1RT2A 4R0EA 3T5LA 2IM1A 4ECUA 5F8GA 4IG0A 5C24B 4WYWA 3MFIA 3DOLA 2ZD1A 1TKXA 3KLFB 4ICLA 2BE2B 4TY8A 1S10A 2FLNA 4IH6A 3H5XA 4PUOB 3PR4A 3RAQA 4WZMA 3CVKA 3DDKA 1NHVA 3BGRA 4G1QB 4Y3CA 3V4IB 1WNEA 5DG9A 3H5SA 4ED2A 2GIQA 2AX1A 5F8IA 2VG7B 1TVRB 2OPPB 2QV6A 4PQUB 3QO9B 3V6HA 3OL8A 1SH0A 2BRKA 2W7PA 4ECTA 4Y2CA 2XC9A 1HNVA 1IKWB 2FVRA 1OS5A 2I1RA 3M9OB 5J2NB 1LW2A 5DLFA 3PR5B 3BJYA 2IJFA 4FBUA 3RAXA 4RW9B 2C2EA 4KO0B 1EETA 3PJWA 2JLEA 3C6UA 1SUQB 4WXWA 2VG5B 2YNGA 3FFIB 3I0SA 4NZ0A 3DRRB 5KFRA 5J1EB 4TXSA 1ZETA 1IKXB 2RKIB 5HLFA 4WYLA 4RW8A 3UR0A 3NL0A 4MKAA 4NLXA 3CDUA 4K4ZA 3UQSA 1S6PB 4DL5A 4MFBA 1KHVA 1LWFB 1TL1A 3FQLA 4YR3A 5C42B 1LW2B 1DLOA 4MIAA 2RDIA 3V6JA 1S9GB 2FJVA 3G6VA 2ASJA 4Q43A 3RB6A 4F4ZA 4O4GA 2WOMA 2C28A 2W8LA 3BSOA 1RT4A 4MK9A 4KKOA 1N4LA 5KFLA 1S6PA 5CYMA 1C2PA 4O3OA 2YKMA 1C1CA 2WCXA 3CJ5A 4EBCA 4H54A 4EO8A 1XR5A 1RAJA 3T5KA 1DLOB 2I5JA 2UVWA 4WE1A 1S9GA 4TY9A 4RNFA 5KG1A 2XGPA 1IKYB 3GIIA 2FLPA 4RU9A 3QZ8A 4EEYA 2WOMB 3M8PB 4RUCA 4NLDA 4DG1B 5KFAA 4HYKA 4EBEA 5F9LA 1FK9B 2B6AB 5KT2A 4IR9A 2C2DA 3V4IA 3LP2A 3DRPB 5I3UB 2IM0A 1RT5A 3ISNC 4ZVFA 5JXSA 5F8MA 5L1LA 2I5JB 1JLGA 4GC6A 3PVXA 4KV8A 4LSNB 1MU2B 3CJ3A 1D1UA 5D3GB 3OHBA 3KLHB 2FJWA 5EUHA 3SFUA 1TL3B 5CYQB 4KFBA 3QO9A 3IGNA 1T05A 5KFJA 2FVPA 4J9QA 1IM4A 4ECSA 4RW4A 1IKWA 1LWEA 1S1XA 3IRXB 5DQIA 4NLVA 5KFYA 3HVWA 3NAHA 3JSMA 4NYZA 5KFBA 5J2NA 5DG8A 1S0MA 4TYAA 4IRCA 5KFUA 4TN2A 2IAJB 4EYHB 4M95A 2CJQA 4ED0A 2R8GA 4RUAA 1EETB 4XO0A 2IBKA 1S1TA 4RW7A 4I2QB 5J2MB 4XPEA 3EPGA 1W25A 1T03B 2XWYA 5C25B 1BQMB 3MECB 2R2TA 4U7CA 2AQ4A 3LP0A 5HLFB 5J2PB 1UWBB 5HP1A 2FVCA 5KT7A 5I42A 3GIMA 2BRLA 3Q8RB 2W9CA 3DLGA 3D5MA 2B5JB 4ED8A 2AGPA 3JSMB 1LW0B 4URSA 1VRUB 3KLGA 2BANA 3TQ1A 4NRUA 5KFOA 4Y2AA 3GV8B 3CO9A 1S1TB 4RW7B 1HNIB 4TLRA 4ED3A 3PW0A 4Q8FA 1HQEA 4F4WA 3OL6A 3LP0B 1RT4B 2AGQA 1RTHA 4NLQA 3TAMB 1TKZB 3C6TB 1J5OA 5CYMB 4ZMMA 4Q0BB 2AWZA 2YKMB 3BQ0A 2XI2A 5KG3A 4Q44A 4RW6B 3ITHA 1VRUA 3KLGB 2BANB 5K14B 4WE1B 2R2RA 1S6QB 1Z4UA 5KFSA 3MR3A 3NMAA 4TQSA 4U6PA 5KT4A 2BQUA 1NHUA 2BR0A 3E51A 3OHAA 3QLHB 5EWEA 2HNYB 4IRDA 3FRZA 4QWCA 3RB0A 1RTHB 2J6UA 5FDLB 1RT1B 3LAMA 2IJNA 3MTKA 1DTTB 4ED1A 4DL7A 3IN5A 4IFYB 3ITHB 3JYTA 4K4VA 1JLGB 1REVB 1S6QA 2RF2A 3H5YA 4R5PA 4MKBA 3LALA 4ZPAA 4G3IA 4ZPDA 1K1SA 4O3SA 3EPIA 3KOAA 2FJXA 2FVSA 1HMVB 4O44A 3RB3A 2R8HA 3VQSA 3DOLB 1T05B 4NLOA
chains in the Genus database with same CATH superfamily
3UNYA 4IFVB 2ZBCA 1YZ7A 3DLEB 2VKRA 4V19X 1VHFA 3M8QB 5LMUF 4DL2A 2MY8A 1U49A 1AFJA 3KMSA 3I31A 3ADAC 1TK0A 3T19A 1IBCB 3JYTB 1RLCL 1REVA 2W2NP 2GNKA 5G0RA 3AODA 3LUYA 4AQYF 1HWLA 3MAAB 2RHSB 3N6LA 4LF8F 4A8OA 3WZ0A 3MM6B 5KT5A 2YX1A 3J80Y 3KK1B 3SCJE 1C1BA 2FGCA 4FPIA 4WFXA 4EGLA 4KHPJ 2L48A 5IV3A 4K4WA 4C48A 3RBDA 2DJWA 4OYXA 3D3CJ 1CS4A 3D54A 4DUZF 4I2PA 1RHJB 3T9ZA 3SYZA 1VHIA 1RACB 1T3OA 4RNHA 3UDEA 1OY9A 4ELUA 2N7YA 1JMTA 3OVBA 3P49B 2OH2A 3DGVA 1N5YB 2VPWB 1E6YA 1L3SA 1SC3B 5LOQA 5J2QB 4ZHRA 3BBCA 2MKKA 2WHOA 5IT0A 3IG1A 3CJQA 3GPAA 3GJQB 3HVAA 3N9UC 1UETA 4P72A 2PT0A 3W2VA 2Z56B 4EI2A 1S1WA 1D9FA 2IJRA 3Q86A 2HQ3A 4WU3A 3DRXA 1JLBB 3WHIA 5D4PA 3PIOQ 3I96A 3PRBA 3GP9A 2YNHB 1HBUA 4K4SA 4J5OA 3W64A 4C97A 3SQGA 1BMQB 2Y9HA 2KRRA 2R7XA 2AF6A 5E3RA 2ABYA 5DGBA 2GQCA 3C8YA 3TW0A 3MAQA 3IA0A 2A3JA 3IC1A 2C2OB 2YWWA 3Q24A 2N3OA 3TJAA 4YHHF 4OJGA 2CG8A 3HKWA 5LT5A 3C15A 3P6YC 3DRYA 1WG5A 5B0DA 5D8HB 1B64A 4NLUA 5FDLA 1C0TA 1BWVA 1RWNB 3CCZA 4L3KA 2QFIA 1SQGA 3HMJG 1S72S 2DY9A 4ECXA 4JI5J 2K1RA 2WAQD 4OYOA 4WU2A 3CIZA 5BYRA 1U1RA 2YWGA 3G4SS 1VC0A 1YJWS 4EBDA 1M1KT 1V5VA 4J91A 3GYNA 5KFDA 3R7BB 5EX0A 2OAUA 2VA2A 3H7HB 3KHRA 1VFJA 1IKYA 3MMAB 1FXDA 5F0WA 2HQFA 3AOBA 3VAGA 2VPZB 3M8PA 2Y1JA 2FVQA 2Z0GA 2GC8A 3ONQA 1ICEB 4LBHA 4CT9A 1BQNA 4Q8FA 5JVHQ 4YQWA 2UXDF 3MMBA 4J9LA 2Q66A 3ISZA 3MM9B 3W66A 4DCPB 1O0PA 3CIMA 4JB8B 4H4KA 4QBUA 2VBXA 1EQMA 1HD0A 4DQPA 1T9YA 1W26A 2H5EA 3PO4A 4KC5A 2ZE2B 1C4AA 1VRTA 1UFWA 1QAIA 2XLIA 2R2SA 2AW0A 4YDDB 2EFVA 3QJPA 1C1BB 4DV5J 2ZUAA 3CJ4A 3L7OA 3NNAA 1CSJA 3C6UB 4X66J 2XCAA 3CB4A 1HYSA 2F9JA 3AD8C 4B3RF 3D0GE 3E01B 2LFVA 1RDRA 4PUOA 4DV4J 3GJSB 1ZBTA 3I9ZA 3LGNA 1Z1ZA 2CQ4A 1WTBA 1GXLA 4WIQA 3BGOP 4OHXA 5HROA 2LEPA 1KKHA 2WSFC 3MPYA 3TJ9A 5GAGU 2OPRB 2DISA 3T1YF 2XHWA 5HMYA 1FFGB 4WKYA 2W1BA 1RKIA 2K8GA 1M1GA 5AXKA 5AE1A 5MLCV 2CQPA 4ZLJA 1ZYQA 1ZTTA 2HZAA 5C25A 4QJVA 1JJ2R 5H9EK 2JEGA 3RW7A 2KH9A 2Q1LA 2YNHA 5ETOA 3T5JA 2LYVA 4KR0B 4X4VA 1D09B 1N5TA 2F4FA 3IR6B 2NLWA 1TV6A 2WBMA 1NDLA 1JLCA 2EBGA 5KOXA 5A2QU 3MMCB 4F8RA 4B02A 2MKJA 1VQKS 2B9EA 3A3OB 5HQLA 5T7LB 2RVJA 4X65J 2PGCA 2V4QA 2JEIA 2YKNB 3UO0A 5IOLA 1FKOB 4Z37A 3CDWA 1HW9A 4MK7A 4OHZA 3RBEA 3BS9A 2UP1A 4W4MA 4UQTA 4B3TJ 4JI1F 2JZ5A 4M5IA 5F3TA 1D8YA 1MMLA 2DHHA 3FUYA 2Y8WA 1C0TB 2EC2A 4Q45A 4RW8B 3SFGA 4LT6A 4NEZA 4B3SJ 2B6AA 2G0IA 2IVMA 4LFBF 4E2FB 4J9UE 1RLDA 3A12A 3C19A 1PJ7A 2K2PA 4HTJA 5L39A 1JXLA 1ITPA 5A8RB 1OIAA 4IG0B 2KM8B 3DI6B 2WW8A 1U0SA 2IDEA 2MPUA 3MMAA 4ZVPB 2KN4A 1KQFB 2PN6A 3ZZTA 4KFBB 1MWYA 4TY8B 4B08A 3C2PA 4QYRA 2HNYA 2MJNA 1BQNB 1GX6A 3ISND 3IWLA 1RBLA 3F0NA 1YI2S 3W5XA 2DTJA 3M9NB 3OTOJ 1FNXH 3TVZA 4U8VA 3FBFA 4P7VA 1RT7B 3OJSA 2VPYB 3HX9A 4B9SA 2RRBA 2XG8A 3QBCA 3M2RB 4L3NA 1SCJB 5B0FA 4OX7A 1HMVA 5J2MA 1CC7A 2CADA 4EFAC 3PRVA 4YR0A 1FJEB 1HYSB 4J9MA 4HHHA 1IM6A 4I69A 4DR1F 3HHLD 3G6XA 3PX6A 3E01A 4XDDA 2DXDA 3RTVA 2QGFB 2XHCA 5I42B 3OUYA 2VZ9A 2EVZA 3IR7B 2XQCA 1Q7LB 4F4AA 4O0NA 5J1NA 3LA0A 3ELHA 2B5JA 3DCAA 3V6DB 1U7LA 5HROB 3U1NA 5B0AA 2O3DA 3K5OA 4RNOA 2V69A 4RW9A 5IV4A 2GQQA 3J7YU 1QUVA 3CMAS 4F0HA 5CH7B 4R0JA 1HNIA 5CYQA 3OT9A 1M5VC 2YNGB 3FFIA 1NU4A 2FLLA 1JX4A 2LDYA 3AA9A 3V6KA 2XGQA 3TAMA 3U02A 3L7UA 1TV6B 4AD6A 1D9DA 3DKDA 3MMCA 1CJKA 2LLZA 3CJ0A 5E33A 3MGJA 5L9NA 2CDQA 4WP8A 3NCQA 4KB7A 1F9EB 1HARA 1JK9B 3LGMA 4NZ6A 2OMLA 3ZXWA 4C8OA 4N8NA 2HFUA 2F3JA 4I2QA 5B09A 1QAJA 4NYPA 3BDEA 3ZNUA 5B08A 5JUMA 1PSDA 2RJZA 1XR6A 4B3MJ 4DU7A 4MKYA 4HVZA 3QRQA 1CJUA 4GKKF 3IS9A 5M2UA 1D0EA 4DCOB 2DNPA 2ZOFA 2WZ1A 2MSTA 4WTOB 4DL3A 1RAIB 5DDOC 2QL9B 1LW0A 3H5UA 5EX3A 3DM2A 5LJ3Y 1RTDB 1S6UA 2KYXA 3D6TB 2AKWB 2OD6A 4ZA1A 3T6BA 3JSBA 1F60B 5L1JA 4P73A 1NXIA 2B9WA 2YH0A 4IFVA 3DLEA 1BHNA 2OUGA 2WRMA 4I0WA 1H0HB 1NZAA 2HZCA 2DNQA 2K3IA 5GAEU 5KT3A 5L1KA 1RT2B 2MYFA 5L8RC 2YNIA 5D3GA 3TAQA 4M5KA 3HHLB 3J7A1 4PWDB 4KSEB 3PW5A 1QD1A 2HBZB 3QT5A 3N6MA 2BZ2A 2BKPA 1RP5A 1S49A 2UZAA 5CHCB 4V1Ak 5KFEA 3VAKA 2ATLA 2VQFF 2DKOB 3FBBA 1RAHB 4OHWA 4WFNQ 3LTOA 2BJDA 3CUNA 2UVRA 3HK2A 4ICLB 2B43A 3KUEA 1CS4B 4IOBA 2BJEA 1G6BA 4ZVGA 2J9CA 4LIRA 1ZOTA 2KG1A 2XYGB 2F4VJ 4DV5F 2J7UA 5I4MA 4JUZA 4ED6A 4B9TA 3H20A 2G2ZA 3DLBA 3DYAB 4NE9C 4GC7A 2GV1A 2EG1A 1HQUB 3MEDA 2NXNA 4LMZA 3I0RA 4JV5J 1GTHA 3QRPA 5HMXA 3UD3P 1WEXA 1JLBA 4M5JA 4PQUA 4JI5F 2PMZD 2QSFA 2AZ3A 2E9ZA 4DUYF 3FCWA 1GT8A 2EK6A 1RUSA 3KJFB 1SVDA 3UCZP 3H2UB 3TUZC 3KHLA 4I4BA 2VG6A 2D7SA 3GR1A 1SV5B 4IG3B 1UPPA 3ETMA 2J9DE 2OELA 1T7PA 1XMOF 4KHMA 1CJUB 2XMWA 3IS9B 2K7JA 3HSGA 3MXHP 5F8NA 1UPMB 1SI9A 5D0GA 3MR6A 3HXMA 2QX0A 3IXQA 2NCKL 4HDHA 4LF5J 1WTFA 1CPZA 2L08A 3U27A 4NLYA 4K4XA 3BGFA 1NK6A 1DTQA 1NM2A 1JLAA 5IC6B 3MUVP 1WUUA 4N76A 4DV7J 3FQKA 3W8GA 4OIXA 5FIIA 2CJBA 4ZJOA 4MJKA 4O4GB 4O3PA 2ZBQA 3C16B 1TKXB 2HFNA 1IN0A 2CQHA 2APOA 3EMTA 4ZVUB 2O66A 3B78A 5A6PA 4LQ9A 1Q82T 3D0IE 4IYQA 1Z2ZA 4F50A 1DTTA 2EFNA 2G2YA 1FE0A 2RB7A 2AYGA 1FRHA 2RF2B 2BW7A 1RT2A 1YRTA 3O5TB 4R0EA 2E5HA 3T1YJ 1SL2A 3HKZD 2RHQB 1FFWB 2B7CB 4OZ0A 2YH1A 2RS8A 2ZOGA 3GJTB 4BDPA 1CQMA 4WYWA 3MFIA 2FB0A 4PZVA 3D2WA 4ZIVA 2ZD1A 2XMUA 2GZOA 3KNGA 5IS2A 4ICLA 3M6UA 1A9NB 2KYZA 4GVBA 5DETA 2ACMA 2AZ1A 1U2RA 4E8UA 4PUOB 2D69A 2FHJD 3CD5A 3H42A 3RBZA 1N5VA 4Y3CA 4N47A 4LF2A 1FNOA 3U7JA 1TL7B 2E1AA 3GR0A 2XM3A 5LM7E 2XMKA 2H5IB 1IR2A 3H5SA 5ETRA 1RXOB 1UJ5A 3F73A 4HT5A 1AUDA 3GFZA 1Q5VA 2VBWA 3VAIA 1OY6A 1TVRB 1KQSR 3HJFA 4RJVA 4PQUB 3EDQB 4CTAB 1NK8A 3OL8A 2BRKA 2VL1A 4KJIA 3MUMP 3TAPA 2XC9A 2HURA 3CCRS 4CWBA 4WCEQ 4FDFA 4RBUA 2VQEJ 1M0SA 1P6TA 4BCAA 1X5PA 3CF5Q 3M1VB 1B4SA 4C8MA 4G1PA 1NHKL 3R5JB 1YJ9S 4DSKA 2XEXA 2DO4A 1CC8A 1XNRJ 1IXKA 2HHTA 1R7IA 4OI0A 1SC4B 2JLEA 3PG9A 2VG5B 2ZHOA 4F3MA 4TXSA 1KBRA 1RHMB 1SJ4P 2V5HG 4LFAF 4RW8A 5CQGA 2W01A 3MDFA 5B0EA 4AE5A 1RZMA 1WF2A 5A8KB 3KG4A 4OI6A 2NYIA 3RR7A 2OFGX 1N33J 4B17A 1WG1A 4UF4A 4NWBA 4O4GA 1YQHA 2YVSA 3TUIC 2W8LA 4C98A 2ZZTA 3AJ2A 2OJ3A 4KH1B 3TZYA 1T9UA 1D8ZA 1IBKF 3CC7S 1MNEA 2MQQA 2K3KA 1S6PA 5CYMA 2FLOA 2J0WA 4HHJA 3GCWP 2QMXA 3TI0A 2YKMA 2XSJB 2WCXA 4EBCA 1YBAA 4EO8A 1XR5A 1L3UA 1TUVA 1VGYA 3K5PA 3QFWA 4WE1A 2C2MB 1NZ8A 4UUWA 4NA3A 4ZDNA 3O8WA 5DZ7A 3R9LA 4CM0A 4CLTA 2XGPA 1AROP 3ENQA 3GIIA 5DM7Q 4EEYA 2DXEA 4PQAA 1BWEA 2NXJA 2WOMB 2XLJA 3DFEA 5JJBA 4GVBB 3AFGA 1TKDA 3B8HA 4USVA 2YTCA 1VOMA 3OQ2A 1FK9B 4IR9A 5H1SV 1HR0J 2DGSA 3LP2A 5F8MA 2ZH8A 3KG1A 5L46A 2MKSA 2BM1A 3I4PA 3KJNB 5ETMA 4UTGA 3P8BB 3JQJA 3KLHB 1P1LA 1RHQB 3DLJA 4RBTA 3SFUA 1TL3B 5CYQB 3A8EA 3CCMS 2XZTB 2Y0SD 2QL5B 3HFZB 4CTAA 5K8MA 3CDAA 5LXRA 1X9WA 1YWXA 2PMHA 4WK1A 4J9QA 1IWGA 2E7VA 5HSPA 3SV3A 4ECSA 2H5JB 3WDOA 1LWEA 1KONA 2CPDA 3NP5A 5DQIA 2RQCA 4DR6J 2C3PA 1QY7A 3C3LA 3R2CJ 1HLWA 2BE7D 3OFHA 5E2QA 5KFBA 1S0MA 4IRCA 2CPIA 5K8OA 1FA0A 3NWRA 4EYHB 4EK2A 2CJQA 2E1PA 3E3XA 2BABA 4LR9A 2R8GA 2OEMA 4I2QB 5ETPA 1Q79A 1VIOA 2FC9A 2XWYA 4LR8A 1K8AT 3MECB 1U26A 1MMNA 1G4CA 2V4JA 1KEKA 2FVCA 3CC2S 2CAJA 4N7TA 3DNCA 2BRLA 2HFSA 3Q8RB 2Z2YB 3DLGA 1XBWA 4X4OA 2AGPA 1LW0B 4RBVA 2DIUA 1VRUB 4URSA 5ETQA 4LF9F 3JSRA 2CXEA 1Q0NA 4BBYA 5HL7Q 4Y2AA 5KFOA 4OV6A 2OFHX 4FVCA 4C11A 4RW7B 3EE3A 1T02A 1NPPA 4ENOA 3HVRA 2IVYA 4ED3A 4PPZA 1HQEA 4N77A 1S6OA 3QJLA 3LP0B 2AGQA 2FZKB 4P10A 1LXNA 3BF4A 4UZCA 5CYMB 2G1HA 2MQNA 2AWZA 2YKMB 2XSJA 4L72B 4F7VA 3B6BA 4K8RA 7AT1B 3MR3A 3SXLA 4WE1B 1NDPA 3FZ2A 4TQSA 4U6PA 3R5AA 4D3HA 4DDFA 3E51A 4LF6F 3Q89A 3TZXA 3BO4A 3VGUA 2YPYA 4GMKA 4FYWB 2RIJA 1NEEA 3RB0A 3K0JA 2F40A 4AXJA 4WKRA 2B56A 4Z2XA 2CUYA 2ZBRA 1LNQA 3VCDA 4LFCJ 3MTKA 4FNIA 4CO0A 2WSEC 4ED1A 1BC6A 2G0JA 3IN5A 4IFYB 3R5GA 2RMLA 5F0UA 2DNKA 3PJ9A 2PFDA 4MKBA 4OZ3A 4ZPAA 3H0PA 1WKKA 5FLXU 2QIFA 4X4PA 2C2NA 1K9MT 2NSCA 4G3IA 1PC4A 3OJUA 4NXNF 4DR4F 2VF3A 2VBZA 1NLKL 4C7QA 3BH6B 3JTOA 4UW2A 4NLOA 5E3PA 5CYJA 4M5NA 1VIXA 2LQ8A 4OZNA 3ZC4A 3PW2A 2BKNA 2ERRA 4QYZK 2YQ1A 1LWCA 4IOCQ 1TQLA 1BQXA 3K7RA 3BGRB 3M6WA 5IQ6A 1N88A 3BKFA 4PYAA 5KFGA 4JI1J 2D1CA 1YITS 4CLUA 2GGPB 2HNZA 4FKXA 2GJ2A 2V8VA 3PFOA 2H51B 3TEHB 1QSLA 3MECA 2HMIA 2IPOB 2V4JB 4C8LA 4ZN1A 4LFBJ 2DITA 5LXYA 1GX5A 5IT9U 3ENWA 2BYCA 3D6HB 5DQHA 2CNLB 3IAS9 3QAEA 1OWXA 3SEOA 3H59A 1S99A 3I32A 3ILIA 1H98A 3I5CA 2OPSB 2G2OA 2B4OA 4CLPA 1I3OB 5RUBA 3NGRA 3M9MB 3GIJA 4ECWA 2E5LF 4F2SA 4WFYA 8ATCB 2ASDA 1A7GE 3GU0A 3W8PA 1NB2A 3ZZYA 4X2BA 1VJQA 3OTOF 4FBTA 3C16A 3TJ8A 1UA1A 2QLWA 1HHQA 3KFWX 4OYAA 3CGIA 3CJ2A 3I6PA 2EK1A 2IC3A 1QTMA 1HHTP 3ILLA 4ECVA 3QGHA 3HHNB 2N82B 1YG0A 1F1BB 2L9NA 1PBAA 5HMZA 2D3ZA 3N4WA 3RW6A 2DK2A 2MDAA 2EWHA 3KXDA 5E5NA 2LU2A 5KTQA 3EX7B 2DNLA 2LP4A 2DNNA 5IT9Y 2J9EA 1HIYA 3KK2A 2VV5A 3C14A 3MZIA 1FJCA 4X64J 2HAIA 4F0MA 2FQQB 1NO8A 2ZKUA 1AB8A 2P2CB 2A6OA 3TVKA 1N8RT 3PDNA 5EDWA 5AXNA 5D4OA 5KFMA 2VQEF 4DQIA 4NLTA 2A10A 3T41A 1N32F 4KHRA 1WELA 3HD2A 4TYBA 3MPWA 4OI1A 1XMQJ 3A13A 3FSYA 1XNRF 2O5DA 3CO0P 4ZPBA 1S0VA 4LSLB 3D68A 2CWXA 1Q86T 2DGQA 3RB4A 2KZMA 2OGUA 2GHPA 4RNNA 3CT9A 3OV7A 1C0UA 1B3TA 4DI6A 5KG5A 2B9XA 4E98A 2WONA 1X4DA 2P6TA 1TVRA 3W9HA 1FKPB 2LEBA 2LEAA 1N0VC 2CFXA 4IDKB 2KL8A 4X62J 2BACA 2QLBB 2WVDA 3MURP 5D4NA 1M5PC 2L41A 1S5ZA 2M3DA 3DRPA 2HFZA 1S7HA 2J0XA 3M1VA 4C8KA 4H4OA 2W9BA 2R7TA 4DV6F 1KSPA 5E3AA 4KE5A 1S0OA 1P9YA 2HMIB 3CJRA 3H2VE 8AT1B 2R8IA 2DNYA 2HW3A 2ZWOA 4P71A 1M5SA 1YJRA 1FD8A 3AOCA 5KG0A 2C22A 1NK9A 3MPVA 2VFSA 2MKHA 3NWGA 3B82A 1WHWA 4MIBA 4O23A 3ZZOA 2OIHA 4NLGA 1EB0A 3UW1A 3QSIA 4U7UD 1ZZFA 3BKUA 4J37A 4NLRA 3EDRB 3GB0A 4LRFA 2IAJA 3H40A 4DV6J 2RDDA 1RTJB 1HWKA 4HDGA 2R9LA 1XC9A 2NPFA 1X9SA 2CWKA 1N36J 1R0BG 3QZ7A 2QA4S 4Y34A 2BQRA 3ILOA 4QR1A 4CT8A 4NA2A 2DEJA 3EUNA 4QPXA 2HQCA 1HNVB 4R8UB 4K2JA 1R6VA 3KLIB 4Y2MA 2LMIA 2PD1A 1X5TA 1B70B 2ASLA 1WOOA 4FNHA 5L1IA 4A8MP 4ZOSA 4BHQA 5KG6A 1KHWA 1OYDA 1L3KA 2I9SA 3LO3A 1U6FA 4TQRA 5MAOA 2CJKA 4A8KA 4HACA 4OZ2A 3OSPA 1U2CA 1PKUA 4OJ3A 2IMWP 4QIVA 2QE5A 1U1QA 2HVHA 2PI5A 3I0SB 1TELA 1DAXA 2IVFB 1DFDA 1CJTA 1UL3A 3G82A 4OMFG 1DZ5A 2J76E 1SPBP 1O51A 3FBEA 1FK9A 3QT7A 4OV1A 5BR8J 4CLLA 3DLKA 1X7VA 3BYPA 4BS2A 2XLKA 1TL1B 3LP2B 2UUWA 4UUXA 5HBMB 5C42A 1AYEA 2JLGA 1QE1B 1IQZA 2V50A 5HVHA 1RU1A 1JIHA 3CCSS 2E7XA 3D66A 3UFCX 1X4FA 4DV2F 1N56A 1UVIA 4A8FA 1FKPA 4NRTA 3JTNA 1FX2A 4KKOB 4IDKA 2YNFB 3MCOA 3QMQA 4FVMA 3Q8SB 4O3RA 4OI4A 3BKTA 1LWEB 4ITSA 4ID5A 2V8PA 4QWBA 1RI7A 2HSEB 4CLZA 2UXCJ 2GA7A 4X66F 5FJ4A 2R7QA 4ER8A 5KOWA 2OPQB 1SH3A 4CYUB 1F3FA 2JEJA 4R5PB 2XMVA 3M6VA 2XYPB 1X8DA 1EKRA 4P2XA 3H25A 4DSEA 3Q2SC 4O44B 1Y5LB 4O0IA 3S1TA 4DJBA 2NQPA 1JLEB 3CCLS 4DG1A 3K57A 2JVOA 2RUSA 1RYSA 2LQ5A 3MPUB 3NGSA 4ZVHA 1E6VB 2F9DA 2DGOA 4ZP8A 3EM1A 3DLGB 1RCOB 4HI2A 3HVTB 3TWZA 1Y7PA 2BUNA 2FDNA 2BOPA 2J6SA 2RQKA 5G0RB 4EWTA 4A4JA 4WFBQ 3DLLQ 4W98A 4DSJA 4FF3A 4DFPA 3P3DA 3FVYA 4OYZA 1H2VZ 1APSA 1CQNA 2GMJA 1PG5B 2EG2A 4WWSA 4CP5A 3KHHA 3KK1A 4X65F 4LF5F 3K5NA 4LFCF 2G1DA 1RT3A 3CCES 4R8UA 1NUEA 2M70A 3KLIA 2QRRA 4B3TF 1KS2A 4C8ZA 2AU0A 1RABB 2IMOA 5E0OA 2VFUA 4ANDA 3R2DJ 5F8JA 3FNNA 4KPCA 3WBZA 4IO1A 5HJYA 2ADBA 5HATA 3L3CA 1N5YA 2IM3A 3Q8QB 3OTEA 2ZH6A 2J6TA 4DR4J 2KZZA 4NCGB 3J7ZT 1UVLA 1TAQA 1YJVA 4OZJA 4DV1J 3IG1B 3GYXB 4X4QA 4DUYJ 1CJTB 1RWPB 3JS9A 3G82B 1S1VB 3KHGA 1FE4A 5EWGA 1JJ4A 4DZ6A 1WORA 3MR5A 3SI8A 4KT0C 3DLKB 4DSFA 3HT3A 1W2BR 3MM8A 2HK2A 4OX6A 4IFYA 3I5AA 2E5IA 3OTCA 1R8AA 4MIWA 3H4DA 3TUJC 3Q22A 3VAHA 4XIUA 5IXUA 1LKZA 1T9TA 1FKAF 1UEKA 4K50A 1H3DA 2L9DA 3OPKA 5T14A 3OR1B 2HFVA 4M5DB 2KFNA 3W9JA 4LVNP 4TVAB 2YNFA 3C6TA 2M4MA 2QO3A 1J5OB 3C15B 4ES1A 3TA1A 4ID5B 3MEGA 3OLBA 4A8SA 2KJVA 3LW5C 4CO1A 3NNCA 1U6ZA 4IQMA 2H4WB 4CYUA 4DR1J 2XO7A 1T9WA 4NXNJ 4LSNA 4KV8B 1MU2A 3H2LA 3NBPB 1UKUA 3PEHA 3BPSP 1JLFA 4UY85 1SJ1A 2ZHAA 4LF4F 2GHWA 5KG2A 3QPIA 3NG8A 1HNWJ 1N6QA 1JLEA 2VUGA 3D6MB 4A46A 2MKIA 3P5TL 3PM9A 1SB6A 4FKYA 1MWZA 4P2MA 3FMBA 4AXIA 2JEFA 3FK4A 3OD2A 2DT9A 5D0HA 4PYDA 3AB2B 4B9UA 3LP1B 1RB0A 1FTRA 3ENAA 3NEKA 2RRAA 1JQGA 1HKAA 5F9NA 1SJFA 1H6KX 4NZ7A 2YY3A 1YDLA 5F3ZA 4JI0J 4ZVTB 3N5BA 2DNMA 1LQ9A 3OSNA 2EI5A 4ED5A 2ADCA 4C2MA 2CYYA 2ZVSA 3KDNA 1EP4B 3VAMA 3NRBA 3VHQA 2IC3B 3UN2A 3CNQP 3PHTA 4GO7X 1KWMA 2ALYB 1S59A 2R42A 4ERDA 5AJ3F 2MB0B 1RSCA 3BSAA 1NKCA 1Y11A 3FDSA 1PCAA 2AX0A 2P5VA 4JP8A 1S1VA 3H8YA 4Y6IA 4X62F 3VF0B 1GH8A 5GVQA 3HHKA 3GG0A 3CCQS 2XBPA 1RHRB 5J1EA 1MN7A 3PJXA 4DZDA 5DS7A 3MM8B 1MWQA 1KTQA 1Q53A 2IBOA 1RK8A 3J81j 1RAGB 3UDLA 1N5QA 3OLAA 3VGVA 1AUSL 2J8AA 2DGWA 3MEEA 4LBPA 4MAKA 1X4HA 2DBBA 1EAYC 1ZPVA 4KGZB 2KVIA 1FKOA 2WTFA 5M2PA 2NR0A 2BVZA 2M2BA 4Q2MA 4XDCA 4GO5X 4IO9Q 1AFIA 5BR8F 1YBUA 2BE9B 1U0HB 4DR6F 4CO2A 3J81Y 3CCWA 3L4BC 3MEGB 1LXJA 4J9SA 1NJIT 3OTBA 4YB5A 4C0BA 1VBXA 1UCNA 4MYTA 3F56A 3CMQA 1B7FA 2RQMA 1GFWB 2E29A 3EVOA 5AT1B 1VQLS 3BO2A 1WKLA 4OX9F 1TZ0A 2XMMA 3M8ZA 4EU0A 1RU2A 5LMNJ 4ECUA 2AJ2A 5F8GA 3UDCA 4IG0A 3W63A 4AYBD 5HANA 3J7YI 3K5MA 2E1CA 1PGZA 4TY8A 2DHGA 4JI2J 1M1HA 4QIEA 4OLPA 3WQPA 2DNHA 4F3QA 3W2WB 3RRHA 3PY8A 1RGVA 2AJFE 3CVKA 1VQ7S 3DDKA 1NHVA 2QG9B 3MWBA 1BGXT 3V4IB 1UJ6A 1QSSA 2JOQA 1FEHA 2ROEA 2COLA 2RU9A 2C42A 2HRYA 4TKTA 1Q81T 1VS3A 1M5KC 2W2QP 3NOGA 1R8CA 3UNGC 4ED2A 2GIQA 2AX1A 2YQ0A 2VG7B 3VGTA 3W5ZA 4DLGA 2QV6A 4LRBA 1SH0A 1ZS6A 2CQCA 3AXKA 4JI2F 4Y2CA 3PYEA 5K20B 1HNVA 1IKWB 2M88A 1UWAA 5IT4A 1OS5A 1EKSA 2MHEA 1KDNA 2VBYA 1L3VA 4CI0B 3G9CA 3NGKA 3CCUS 2ZITA 4F04B 1R3NA 5HQMA 2DXFA 3M9OB 2EKNA 4FF4A 5J2NB 1LW2A 3DXBA 2BM0A 1AT1B 4RW9B 4JOUA 1F5BA 2B4VA 3BN4A 1V6HA 1WKJA 2P9CA 2Q43A 1SUQB 4WXWA 2YNGA 3FFIB 3I0SA 3GYGA 4USUA 5J1EB 4RX6A 1ZETA 4ZLLA 2HGNA 3HZEA 5HLFA 1DJ0A 1WEYA 2O67A 1F2HA 1OPZA 1R8BA 4QZVB 1HNZJ 4QPTA 3PKMA 1NJXA 3NL0A 4W92B 3W5YA 3UQSA 1RWOB 4AT1B 1FFSB 2P8IA 1TL1A 1HWUA 3J81U 1UZDA 5C42B 1ROFA 5A8WA 2JRSA 3ZTSA 2FJVA 3R1HA 3GLJA 1I5OB 3Q8VA 2R7UA 3RB6A 3CE8A 2CJYB 1L3TA 4B9MA 3F41A 2C28A 4ANEA 5F41A 1N54B 3BSOA 4JI4J 2HRTA 1RT4A 4MK9A 4KKOA 1N4LA 1YJ7A 4N41A 2OD4A 1NKEA 1KD1T 3RAMA 2MJUA 4TNOA 1C2PA 4O3OA 2HHVA 1C1CA 2FUG9 2XZDB 3HHDA 2AIRB 1I51B 3SDEB 1DLOB 2I5JA 1R31A 5AXLA 4FXWA 1S9GA 3W65A 3X3UA 4TY9A 1U47A 4EMDA 4P7TA 3BJYA 4LVOP 1WF1A 4RU9A 4GKJF 3BPDA 2PO4A 4ZCKA 5DDQC 4RUCA 3I9V9 1KQGB 1HW8A 4DG1B 4K5RA 2NZCA 5KFAA 3AB4B 4TLQA 4C3MA 5F9LA 3GFYA 3W9IA 4EBEA 2XY5A 2UXCF 2Z4PA 4X4NA 2UXDJ 3V4IA 5I3UB 1UVKA 1YSJA 2IM0A 3R5CA 1S0NA 4QIFA 5L1LA 1URRA 4DOZA 5DDRC 1JLGA 1NJYA 2BJ3A 1NJZA 2GX8A 4GVLA 3K2YA 1D1UA 5D3GB 4NOHA 1RE1B 2OSRA 5EUHA 2AHOB 1WDTA 4Q5VA 4MTPA 4NMXA 1T05A 3I4HX 3RUBL 1HA1A 2J0SD 4DR3F 1IM4A 1CULA 1IKWA 1PAUB 1S1XA 1ZM2A 4QIGA 2B51A 2VDIA 1RWKB 4B3RJ 1IJEB 2KXHA 3JSMA 2E1RA 4H4KC 5J2NA 4NYZA 2GW8A 4PXCA 5HI7A 3UCGA 4DCJB 4K0KJ 3QT8A 4K7QA 4ED0A 2PDAA 1FDNA 2IBKA 4ZVSB 2HVDA 4XPEA 1VCTA 2IHR1 3OFEA 4F02A 1K0TA 4C3KA 4FPRA 2AEMA 5HN0A 2AP6A 4DS4A 5HLFB 5J2PB 5HP1A 4F0KA 4KQZA 4G1IA 4USMA 1WC3A 4YY3J 5KT7A 2MZQA 3D3BJ 3EVMA 4CO3A 3GIMA 2CIMA 1CEZA 3SQOP 1NPRA 2DH8A 4X64F 3PXGa 2BANA 3TQ1A 4KY3A 1QLNA 2ZDPA 2NSBA 1F3VA 2CQ1A 1S1TB 4DPTA 2OKQA 4CLSA 4ETZA 4Z7CA 3PW0A 2VIHA 3HF5A 2LXUA 1VI7A 5HAOA 1K47A 2KU7A 1RT4B 4ZN3A 5H9FK 2KXNB 2ZM6J 4XK8C 3C6TB 3EZOA 1J5OA 3A3PB 4Q0BB 1PBUA 3ITHA 3KLGB 5K14B 1UMJA 3CJ8A 1S6QB 5KFSA 1FD2A 2R3VA 3ZNJ1 4DR2F 5LL6d 4J9KA 2BQUA 2M0GB 4EUVA 3OHAA 4DPYA 4DX5A 5EWEA 2CPJA 3AJ1A 3IWNC 4IRDA 3P5BP 1RTHB 1RKJA 1TU0B 2AV5A 1TMJA 1J5EF 1HQ2A 2LQBA 2VJUA 2FJBB 5GMKa 4DR3J 3LAMA 2Y1LB 5HK4A 4PR6A 1CVJA 1DTTB 4CIOA 4DUTA 3O3LA 5GAEI 3JYTA 1JLGB 1WHYA 1REVB 2OO4A 2RF2A 3OBIA 4Z7YA 3H5YA 4LF4J 3MAAA 1XWLA 1M90T 1O8BA 4K5SA 1O5JA 4UQGA 3RB3A 3KOAA 2GHVC 3W60A 2R8HA 2V8HA 1LEOA 5E3QA 1T05B 3VVUA 1JLQB 1S1UA 3T5HA 2HNDB 2EFPA 2DH9A 3KUHA 1T95A 1KLMA 1EP4A 2V2ZA 1HWJA 2V67A 1R8PA 2E7WA 4DPXA 4ELVA 1FDDA 4NI2B 4Q8EA 3H4BA 4ZP6A 1SQEA 5J2QA 2ROPA 4HTIA 4ZJLA 4Y65A 5AE2A 2W8KA 4JV2A 3P45B 2QT7A 3Q23A 4DBQA 1SH2A 2KFZA 5J2PA 5HP1B 1S1WB 1WHXA 3NOCA 3VVTA 1S9FA 5IZHA 3T3FA 3NGDA 3IR5B 4DR7F 3AAWB 1R6YA 3M2UA 3PYGA 1HI1A 2CPXA 3FBCA 3FRYA 3POTB 4OZ5A 1Q1KA 1SIZA 2DNZA 1K73T 4MMOA 4DV2J 3ZZUA 3OVSA 3KK3A 2RDJA 3KTQA 1RHKB 1RWUA 3AJDA 5IWAJ 2D9OA 2KTQA 1JWWA 1VQYA 3VR1A 2AT1B 5ETVA 3KMQA 2DIVA 3HHEA 2R4FA 5KFHA 2BBEA 1Q8BA 2HHQA 1U0HA 3ICLA 3ULHA 3MM7A 1J5EJ 3UN5A 4J90A 3CPWR 4B3MF 3IP0A 4GRSA 2R2UA 4YOEA 5K14A 1S57A 3LANA 4B3OA 3G8QA 5A8KA 5D15A 4YS2A 4A48A 1E6YB 2HWHA 3EYZA 1PO6A 2DHXA 4BLGA 4ZHRB 5D0RA 5IWAF 4ZP9A 2LECA 2I6WA 2GAGC 3CDEA 2XNRA 3AQPA 1RYRA 4P9SA 1V3RA 2OHDA 1IR1A 4EZ9A 4RU2A 4PG6A 3DRSB 1HWIA 4NMLA 3SZ2A 3K59A 3SV4A 1FVQA 5C2CA 3W2WA 5KFQA 1X9MA 1CBKA 5F8HA 4PAAA 4AFFA 5EWFA 3P96A 4F67A 2JVRA 3BYRA 2VFVA 2M7SA 4YP3A 1VRTB 1FX4A 2CZ9A 1HNXF 2VA3A 3CJKB 3QGPA 4ECZA 2C3OA 1JLQA 2KB2A 4LUBA 1YIJS 2QMUB 2VG7A 3PX0A 1GQEA 5B0BA 1IJFB 2U1AA 4JBCA 5DGAA 3T1AA 1KLMB 1HPZB 3LAKA 2MEWA 1XMOJ 2AJQA 3PEJA 1U02A 1VJWA 2ZC4A 1S97A 1PAEX 3D9BA 2W4CA 2WVEA 2Z2MA 3M8RA 4DV1F 2F1FA 2BQ3A 2R8KA 1UP1A 2OPRA 1YLXA 1OJ4A 1ZAXA 3DOMB 3JTPA 4C9DA 1PILA 1SUQA 2KRBA 4YEAA 1U4BA 4CQ1A 1NBEB 3M2UB 2KXFA 5KT6A 1ULRA 1RISA 3G6ES 4ECYA 1RHUB 2B4PA 2ILYA 3ILJA 2H1YA 4HI1A 2CQIA 4U8YA 4DV0F 2FGOA 2KKHA 4PG7A 4NASA 3NMRA 5T7LA 2ZE2A 2HK3A 7FDRA 1RQ0A 4USWA 3SCLE 2YKNA 2CG4A 4USKA 3R8YA 3RGIA 4BC9A 3EGWB 2VHGA 2HFOA 1OMSA 2VD3A 2DVIA 2UVVA 2MQMA 3ZTRA 2HHWA 2JWNA 4L76A 1QAXA 2V2VA 1HI8A 3EGZA 3FEZA 4ECRA 4HKQA 5T41A 2JL9A 4RL1A 4WJBA 1R0AA 1C1CB 2HWTA 2N4DA 1HNWF 3BO3A 2ILZA 4JI6J 5A8RA 2UU9J 2QJ3A 4GKKJ 4FYVB 3DXSX 2HAFA 2QYCA 2RNEA 3GQCA 1N33F 1X5SA 2FHOB 3EWGA 3VAJA 2IY5B 4OYIA 1KQKA 2MKYA 2VODA 2ZVIA 2IA6A 4NLPA 3W3SA 2IRYA 4YN3B 4QWDA 2Z8QA 1ZA1B 1JLCB 2QA1A 2B8PA 3VWSA 5DLGA 2W9AA 2DRAA 2C1EB 5I3UA 2HHSA 3NKYA 3D7SB 3OW2R 1RT7A 4IRKA 4GKJJ 5C24A 2F8MA 1RWXB 4DXLA 1NAQA 4ZCLA 4FN5A 4BWJA 3DHWC 2XWXA 3HJVA 1FWLA 1ZAWA 2NUHA 5ETLA 1XMBA 3KLFA 3TRGA 4PWWA 2AGOA 3KUGA 2BE2A 2UU9F 2XS7A 4H4MB 2M52A 3FSXA 1HPZA 1GNKA 2AD9A 1UVNA 1WSRA 3M6XA 3BGUA 1CULB 2MMYA 3Q8UA 2R8JA 4ILMA 1F5AA 2MZSA 1S1XB 3B54A 3S01A 3E2EA 3K8WA 3UE2A 4G1QA 2QFJA 1SL0A 2ZKTA 1MW7A 1U25A 3V6DA 2CQ3A 4ZCMA 2CDRB 1FVSA 2CKWA 3FJ2A 2FZGB 3IBFB 4ILRA 4QW9A 3DI6A 2DR8A 1HBMA 2LVWA 3O1LA 3R6GB 4L6V3 1NSAA 1XTZA 2RE1A 3RRGA 4LF7F 1HD1A 2BV3A 1UTAA 4P6QA 3G87A 3R27A 5E41A 4KRWA 1TK8A 2G0CA 1F9FA 1EARA 4OZLA 5KFWA 2HIYA 2V0NA 1AZSB 3CCVS 4P52A 4WP3A 4UZBA 5GMDA 5ADZA 1RT5B 1N36F 2PE8A 5HVFA 2HBRB 3ZTQA 3CXCR 5B7WA 4JI6F 3S6EA 3PCOB 1TAUA 1UVMA 4HL9A 2GQ2A 2HKEA 2HNZB 3A4TA 3Q83A 3W61A 3CCTA 3GONA 3DRRA 1Y9OA 2W2PP 4I56A 5CCMA 3KWMA 1UW9A 4I64A 4ZKAA 1XK8A 3WIUA 2MSSA 4RW4B 3TX8A 1T9XA 5K8PA 3GCXP 4HH0A 3AY0A 3TA0A 3I5BA 1LWFA 3JQMA 5KFVA 4DEZA 5HVGA 3TX0A 1K1QA 1WC5A 1REGX 5DM6Q 3TZZA 5THWA 2EXUA 1PIEA 2I8EA 2PFFB 2DNRA 1V5IB 3CEDA 3N28A 2B9YA 4PKDB 2MQOA 3MCSA 1OSDA 2GJFA 1VK3A 1X4CA 4DF8A 4OYBA 4M8LA 3CJSA 2XULA 3WX8A 2E5GA 4U7UK 1KNZA 2WB4A 4NEYA 4HR2A 4DFMA 2W25A 2HHPA 3JXOA 3DC2A 4ZCIA 3UWTA 3BSCA 4DMZA 5KFPA 4FS2A 4JI8F 3SMZA 4LF8J 1TP7A 2BJ7A 2YNIB 2OEKA 3ZZPA 2JC1A 4RUBA 2F8EX 3M8WA 3HHLA 1VLOA 4PWDA 4ETXA 5HO4A 4C8YA 4MK8A 4U95A 1RWVB 4FYXB 2V9KA 3H98A 4H4MA 3KK2B 3SSRA 1QTNB 4QWAA 3Q0AA 4DR7J 4QCLA 2J8SA 1S1UB 4S0MA 3MEKA 4NYOA 1TL4A 2HNDA 2KJWA 4OZ1A 1B99A 1V3SA 1P1TA 1U8SA 2C3MA 5KFXA 1GAOA 2LQJA 1RTZA 3BQ2A 3AA8A 3RZAA 2HEKA 1WI8A 4IH7A 3PHEA 4USIA 1Z2LA 3DM2B 3EVWA 4J9OA 1XEZA 3Q8PB 4QR2A 3KLVA 3DDIA 1DHMA 1FDAA 3HCXA 1MMDA 2KT5A 1H72C 1YJUA 5EHHA 2B0GA 3QLHA 5LSRA 1MG7A 5KG7A 2G13A 4PPDA 3TQEA 3GV7B 3BGLA 4OL8A 1LK5A 4YUDA 3RYLA 2NZ4A 4K4TA 4LRCA 3QWUA 2ASYA 3F44A 1AZSA 2VH7A 2HRUA 2YKAA 3MAHA 3QWPA 4O4RA 5KFNA 4KYZA 2N7CA 4OYMA 1AXQA 1UAWA 1JXVA 3BR8A 3LOUA 2F5GA 3POTA 2D3OR 3G96A 3D1OA 2CNNB 5KG4A 4NLWA 1YGYA 2RUGA 5DRKA 4A8YA 3AHPA 5U47A 2FTRA 2EFOA 2XMTA 5EGYA 4KGXB 4DFJA 1BQMA 3O44A 4RUHA 1B7YB 1RA6A 3GILA 2ACYA 4LF1A 4KTQA 2Q79A 3MM7B 3G6YA 2W9CB 3CTRA 1SQFA 1QVGR 3MOJB 2AEJA 3RBXA 2HWIA 3FSIA 1FERA 1GMUA 5JVGQ 2MGZA 4C3LA 1HNXJ 4IQXA 3PW4A 2OLWA 2V2KA 1DTQB 5IC4B 1JLAB 2DB1A 3DYAA 2IYGA 4HEA9 5GAGI 1ELOA 2DGXA 2M8HA 3D6FB 1S48A 1RTJA 1Q4RA 2W2MP 1RWWB 5I3PA 1X60A 4Y2KA 2VOOA 3MM5B 5ETKA 2J7WA 3DRSA 4E0DA 1NK5A 5GMEA 2ZOMA 1UEVA 3GFHA 4EO6A 5A0YB 5KAKA 3RR8A 4PCQA 2X1AA 5KFZA 4KBIA 1LK7A 2Y1IA 3PZPA 1SJ3P 4DLEA 2C2RA 5KFKA 5D77A 2WK4A 3C46A 3NGTA 1KLNA 4HACB 3VZHA 3B4MA 3PW7A 1DY3A 2DEIA 3EXYA 2E9TA 3AQOA 3V4MA 4B3SF 2ZD1B 3NXZA 3TARA 4K4YA 4DV4F 3FEXB 4LFAJ 1F5CA 2MZ1A 1UEUA 4DV0J 1JJHA 1QUPA 2C2ZB 3D1QA 4IH5A 2UXBJ 1U1OA 2EC0A 1A6LA 1VK8A 1M5HA 4J9RA 2CQBA 2QN6B 3T5LA 3T1HJ 2QYGA 1NJWA 2NREA 2IM1A 4ZPTR 2QC3A 4FF1A 2Y8YA 4CRJA 2YPZA 3L09A 3N5FA 2IFXA 4QIWD 3LWLA 4AL7A 2HS3A 1Y0HA 1F9HA 1KTVA 3DOLA 2BOAA 3M32B 3OVAA 3I87A 4XTTA 1YTYA 1FTCA 3E8OA 1TKXA 2HHXA 1OY8A 1HBNB 3QT6A 1HBOB 1MROA 3UVJA 3H5XA 1Y4ZB 4ZS6A 3PR4A 3RAQA 4WZMA 4K59A 1I94J 2F4VF 4FYYB 5FD1A 2HVIA 1GXTA 4USHA 1WNEA 4A47A 3QSYB 1VQ6S 2BX6A 2YX7A 3VAFA 2CRLA 1IBLJ 2RD5C 1SBRA 3CD0A 1YRXA 4B9VA 4LQ3A 1R43A 2OPPB 1Y3JA 2FD2A 3QO9B 1G7CB 1HFEL 1SJRA 2M5YA 2IYIA 2ZDOA 4P75A 3VQTA 4ECTA 2V63A 4DQQA 4HT7A 2FVRA 2LA4A 2I1RA 2JFKA 5A6WA 2CZVC 4LBIA 3UD4P 4F3OA 1TL7A 3NGUA 1W2IA 1P9QC 2RU3A 3GSIA 4PG4A 2NXUA 4CH7A 6FDRA 1TTHB 5HQ8A 4PXBA 2IRUA 3W2VB 3RAXA 2K06A 1FNMA 2A18A 1BE4A 1EETA 2QMWA 3PJWA 2AMCB 1D9AA 4LRDA 4RKUC 5CZXA 4IUFA 3MM5A 5KFRA 2WB1D 1IKXB 2RKIB 3A8IA 2PEBA 4WYLA 3TVYA 3UI3A 1NH7A 2E66A 3TR5A 5BYSA 3TANA 1CG2A 4NLXA 4K4ZA 1S6PB 3AT1B 4DL5A 1JNRB 1X4BA 2KG0A 3NS7B 1VQOS 1UFKA 2BJ1A 2XSFA 1QJHA 3FQLA 4YR3A 2XYHB 3QAUA 2FYXA 2RDIA 4MIAA 5D78A 5K5MA 4CDIA 3G6VA 4D3GA 4Q43A 3HFKA 2W2OP 3SCKE 1WD6A 4FZVA 4CLFA 1CLFA 4ZVOB 2WOMA 2L9WA 1Y3KA 2MLYA 2WBRA 2H48B 1FDBA 4NX9A 2JX2A 2CVIA 4OLOA 4NL5A 5KFLA 1EHWA 5SZTA 3OFGA 2FPHX 2FC8A 1RAFB 1RAJA 4RWWA 1NDKA 3GG1A 4WIIA 1Q95G 4RNFA 5KG1A 1IKYB 1PJ5A 3EICA 2FY8A 3M32A 4F26A 3K58A 5CCLA 5AJ3J 4PXEA 5AXMA 5ETTA 4YFUA 2Y1RI 3M8PB 2ZH4A 1SKSA 1HBNA 1XERA 4NLDA 4PXDA 1HBOA 1MROB 2MZRA 1IBKJ 1RADB 3IM9A 5KT2A 4J9VA 2EKYA 2IIHA 2OI2A 2B7BB 4X4RA 1NRKA 5J1PA 2C2DA 2KT3A 4KHPF 1RT5A 3ISNC 5JXSA 1NH8A 5AE3A 2MXYA 2ZHBA 4GC6A 3MCNA 1ZA2B 3OTDA 3PVXA 4KV8A 4LSNB 1MU2B 2H54B 2VFTA 2C3UA 2PA8D 3IWXA 2W24A 3M05A 5CABA 9RUBA 3OHBA 2FJWA 2PC6A 2Y0BB 3D67A 3TA2A 1X4EA 3AH6A 3M8YA 3TEGA 3QO9A 1FXRA 3IGNA 1RAAB 4ALZA 4DU8A 2FVPA 4J7CA 3ZFVA 5KFJA 5GAHI 2MQPA 2X3DA 4RW4A 2HBYB 3IRXB 4Y0FA 4AL5A 4NLVA 2XMAA 3NAHA 1U1LA 3V5RA 2X51A 1XJWB 2RQ4A 4QR0A 4TN2A 4YHHJ 2DD8S 4M95A 2VPXB 2I0XA 1EETB 4XO0A 4RW7A 1FWPA 4OX9J 1W25A 5C25B 3UR3C 2AQ4A 1ZM9A 3LP0A 2NUUG 2QLXA 1UWBB 4KGMA 1PC5A 3QNWB 2CQ0A 1O6XA 2R7VA 1U8WA 2HG4A 3KKFA 2MKCA 2MQ8A 4U9RA 5B0GA 3DDNA 1PYTA 4NRUA 4NCAA 2YKOA 2ZH5A 2JLFA 1X0PA 1X31C 2B4UA 2V2QA 3TNVA 2V6AA 5CXTA 3HO1A 3U1MA 1F2GA 2VDHA 4JI3F 2GS8A 1MSWD 3OL6A 1R0CB 3W62A 1ZZNA 1VRQC 3PV8A 1MLAA 1OSCA 1SJQA 1G3OA 1UFLA 3MR7A 3A8KA 4FP9A 4NLQA 4OI2A 4EZ6A 4ZMMA 1GTEA 1Q78A 3N01A 3J80U 3BQ0A 1Y5IB 2GAHC 2Z58B 2R2RA 4Q44A 1VRUA 1RAEB 4M5HA 3NMAA 1AW0A 1Z4UA 2FZCB 2OTJS 2LXFA 2EBEA 3EXCX 3HI9A 4FXVA 1VISA 2ZBPA 2ZNYA 3K8VA 5E3CA 4C11B 2HQIA 2QLFB 2DNOA 2W4DA 2R7WA 2RS2A 3QLHB 2FHKA 4W90B 1TUWA 2ROGA 3LGHA 3N0VA 2HNYB 1RWMB 4G65A 5D0EA 2PEHA 3FRZA 1M5OC 2J6UA 2B3TB 1Q16B 3B4DA 3PYFA 1RT1B 2IJNA 3M4XA 5BJRA 5LSOA 3VTIA 4DL7A 1F6TA 2HLTA 5DO2A 3THTA 3P4UB 1NK0A 3PIPQ 3LALA 1ZM4A 3K89A 3M2RA 1K1SA 3MHYA 3NY0A 3RRKA 2FJXA 2FVSA 1HMVB 4URGA 1LFWA 4OQJA 4DR5F 1FJGF 2K7KA 2CPHA 3AOAA 2UUCF 2RH3A 2EEYA 5H9EJ 1X5OA 2MZJA 1VQNS 4KPYA 2O01C 3CWJA 5B0CA 1RT6B 4CNZA 3IRXA 3MUTP 2D3O1 1JKHA 2CPFA 1I6JA 3DU5A 3D28A 1EX8A 4U96A 3BDPA 4M94A 1PJ6A 3NS6A 5LJ5Y 2Z57B 3FEYB 4DV7F 1IBLF 3ZZRA 2E5JA 2E5LJ 1WEZA 2CNKB 3QIDA 3D0HE 2WSCC 2JHEA 4DHVA 2DR7A 3NNHA 1R89A 5C5JA 5KFCA 1YKWA 3V81A 1CJVA 5FLXY 4ZPWR 3O2IA 2DR5A 4WFZA 4LF6J 2RT3A 3HD1A 1LWCB 1ACMB 3NAIA 2F8HA 4WK3A 3GIRA 1BD6A 3S8SA 4JYAJ 4DX8H 1RTIA 2BXJA 3CD6S 2DYAA 2GGPA 4O3NA 3TO8A 4I7FA 2DGVA 2RSQA 3C14B 4HLBA 4CM2A 3EJMA 2CPZA 3FKBA 3HLUA 4J9PA 2PI4A 1R27B 4CLKA 1N32J 3MPDA 1YJTA 3LPEA 1HL6A 3EGVA 2DO0A 1C4CA 2HZVA 4OHYA 4OYWA 4RLEA 1U1PA 3QIPB 3OL9A 2XO6A 5CD4A 1RTDA 3FZBA 3MR2A 2OPSA 4LF7J 1URNA 5L38A 4DV3F 4LSLA 3QGGA 1EQ0A 3QJJA 1D3WA 2VC0A 3BBBA 2A2CA 3CJTA 5GADU 4JI7F 1L5UA 2F63A 3DGPA 1T3NA 2RILA 2WONB 2FJAB 2ZWPA 1WC6A 1RT1A 4ZP7A 3MFHA 4JI0F 3UVJB 1VQ8S 1U1KA 4CO4A 4EYIB 1S9EA 2W7AA 3GSDA 2NYHA 1I1GA 2Q6CA 3IBWA 4YB6A 1T8EA 4IR1A 4N8OA 2RAQA 2YWEA 9ATCB 3BQ1A 2QA2A 1NKBA 4I6YA 3BZQA 1KVIA 1HHSA 1FJ7A 5BYQA 1MN9A 2BJ8A 2GO9A 3HM9A 1KC8T 2ZNZA 1U1NA 3MI7X 3A1YG 2GMHA 4FF2A 2BA9A 4QYZJ 1RT6A 2B8QA 2OPPA 2RRNA 2FJEB 5GADI 3KDOA 4A8WA 1JKHB 2XY7A 1FCAA 2EFQA 3BB5A 4JV0A 3DMJB 4C6AA 3K5LA 4PG8A 2ZH9A 1Q8KA 2OP5A 2XZWA 2ZM6F 2VOPA 2OEJA 4ZK7M 4MH8A 5C2GA 2X7IA 4UOHA 3VGSA 3ZO7A 4N56A 2XY6A 3Q8YA 4NPOA 1N0UA 2V9WA 3Q2TC 1FESA 4QU7A 3OXFA 4WF9Q 4DPUA 3BSNA 3K17A 4NLSA 4ES2A 2AJ1A 1HQUA 3MEDB 1C0UB 1VLYA 3I0RB 2WVBA 1S7IA 2Q6BA 4PWUA 4ZPVR 5CAAA 4DL4A 1Y5NB 3LWMA 1FO1A 4Y28C 2UV8A 1S77D 1KN6A 1OYEA 1T0TV 2ALZA 1VC6A 2UVUA 1FT8A 1IKXA 2RKIA 4L74A 2PIIA 5E7OB 4YR2A 3US5A 4ELTA 2KM8C 2CA9A 2U2FA 2DHSA 1RBAA 1RTIB 2HBQB 2DPJA 4USJC 1P27B 4QW8A 4WTYA 4H4OB 4DPOA 3SSQA 3UDVA 3WX4A 1LOUA 2LKZA 2QLJB 2W9BB 4DV3J 4ED7A 4YMEA 2VG6B 3OL7A 2LU1A 1SV5A 4IG3A 2XCPA 3HSJA 3QGIA 3DHXA 2VB6A 2NPIA 1FRIA 1GMWD 2UV8G 4UOFA 4FYDA 5CZVA 1NPKA 1ZAVA 2G9OA 4BWMA 1FHTA 2ZJPQ 2MY7A 4CCHA 1DARA 3PACA 1RCXB 1ZM3A 1KRPA 3QIPA 3GFXA 2JJ4D 4NXMF 1U24A 4TU7A 3BN7A 4M5LA 1WDDA 4QWEA 3HZGA 1QE1A 1LFPA 5DQGA 4ANCA 2HIQA 3HP6A 4XAKA 1TK5A 3DGPB 1WWHA 2HS4A 2WVCA 5GAHU 1TFYA 4PRFA 3IGVA 3PYDA 3PO5A 1FWKA 1JNZB 2GVDA 1YZ6A 2UUTA 2EPIA 5JMNA 1DBDA 2X1FA 1N52B 1Q8IA 1TKTB 1IUJA 1Q8LA 1NMEB 1P8GA 4Q0BA 2E1MC 2QL7B 1VMBA 3RG6A 1GXUA 2AYMA 3ZZ0A 5C7PA 3A8JA 4MKVA 4C0HA 1DQ9A 1QM9A 4X84A 3IBCB 4ZPCA 4ZIWA 1WHVA 1X4AA 1BY9A 3LPYA 4NCBA 2PA3A 4I6WA 1WC4A 2V8DA 3HHLC 3QYYA 4PG5A 5IFMA 4URQU 3M2VA 1WF0A 1EZZB 3DMJA 1FRMA 1GK8A 1S4EA 2HVEA 2POKA 4OJ1A 1DRZA 1HR0F 4CZCA 4Y2IA 5HMWA 1WC1A 2NS1B 3LQVA 1K44A 3T6JA 5BXIA 5HBMA 1DQAA 4L73A 1NK7A 3HVTA 3LF0A 4DR5J 1N48A 4JI3J 4OX8A 2FHJA 1YVFA 3NCPA 1ZPWX 1VC5A 3GTYX 1R8HA 4LREA 1NB7A 4WZQA 3ZTPA 1Y00A 2H3EB 2P9EA 3DLHA 3A3NB 3TUPA 2YWHA 1ZTWA 2M8DB 1IKVB 1RT3B 1U09A 1UWBA 1WI6A 1VYAA 1U6BA 2A0FB 4DL6A 3NS5A 3KJVA 2ZBIA 3BH7B 4CH1A 2N4CA 3R97A 1YHQS 2F65A 4FS1A 4JI4F 4RPFA 5K9FA 1FI4A 2ATCB 2OPQA 3EZUA 2PSZA 4KGKA 1BUXA 4P2SA 4DS5A 2IM2A 4M5GA 4NI2A 3HULA 1T9VA 3IO1A 2HS0A 4NCGA 3ETOA 2VG5A 3SSSA 1YJNS 2DPIA 4B9LA 2UXBF 4ZVEA 3MF5A 4PABA 3I82A 2NXCA 4JYAF 3CD7A 3N6NA 4ATNA 4F4YA 2CPEA 1E6VA 3U1LA 2VC1A 2GO8A 3PTWA 4YY3F 1G2EA 3SIPB 1T94A 1Q7YT 2C2KB 1X4GA 4DFKA 1IBMF 2HYIB 3GJRB 4C8NA 4F25A 4LIWA 3CSKA 3KK3B 2ZJQQ 3BEGB 4CLWA 4DPWA 4RZRA 1UA0A 3BREA 3OR1A 2MLXA 4M5MA 4I67A 1T03A 1XIQA 2GVDB 5G4DA 4J9NA 1A0OB 1FRLA 2GIRA 6FD1A 1SIWB 2BEFA 3GE9A 2KI2A 3MMJA 4KAIA 1NCLA 4ZLNA 3DOKB 2A1BA 1TKTA 1YK9A 2KO1A 3WC0A 3GIKA 4NA1A 2YXLA 2JC0A 2R7RA 2KHDA 5CD4H 2JNJA 4Y00A 3JAMY 3L9ZA 4B3OB 2BJ9A 3ZZZA 2E44A 3NBPA 2IDLA 1H2TZ 4K0KF 1OQ6A 5A2QY 1N5SA 1SC1B 1TR0A 1VQSA 3I56S 2BMBA 3M2VB 2YWFA 1N6QB 1KFDA 2FHMA 3KLEB 3HSZA 3M7VA 4Q2LA 1SKRA 3TYTA 1TKZA 4Q7AA 3RJMB 5L9XA 3VALA 3CW2C 2ZUGA 3R5DA 3QRRA 2DCUB 4YB7A 2VONA 3DN9A 3WIVA 4RW6A 5ETSA 3PRDA 1KFSA 2LQ9A 2CJ9A 4UOGA 3R6LB 2OTLS 1FJGJ 4LRAA 4RNMA 1N34J 3KLHA 1Y10A 3BR9A 3JSYA 4WXOA 2MTLA 3AD9C 1VBYA 3OXLA 1TL3A 2AEFA 4M5DA 1WSVA 3CJKA 4I1TA 4DN9A 1S79A 1NK4A 1IKVA 1J2VA 1IWAA 1XR7A 3V81B 1FRXA 1CJVB 2W4PA 3KJVB 4ZJQA 1B0VA 2HPUA 3I55S 3GV5B 1WJ9A 1H74A 3OR2B 2D41A 2FY1A 4HH1A 3VZIA 4K4UA 4YDXA 2ZEJA 3KYLA 3PNIA 2ZZMA 1IQTA 1JLFB 1H73A 2XS2A 4AQYJ 4I7FB 3G2XA 1S12A 3GMGA 4OI3A 1U48A 2HHUA 2LCWA 3DOMA 4I6AA 4ES3A 3M8QA 1XMQF 2HGMA 4R25A 1SXLA 2DR9A 2W7OA 3LP1A 1TFWA 1H7WA 3O6QA 4IKAA 1RBOB 4OHVA 1QVFR 1DQ8A 1NSKL 1J27A 5A76A 6AT1B 3MEEB 1S4FA 4UT4A 2V4RA 2XTJP 3MM6A 1HQEB 4X4TA 4A8XA 1RJJA 4KO0A 1JJCB 2XNQA 3BV8A 2GFFA 4RO0A 3CC4S 4V19J 3SBMA 2CQ2A 2D9PA 2GCFA 3G86A 2AYEA 3IM8A 3M8SA 3DOKA 2DRBA 4I2PB 4ECQA 4DSLA 2AJ0A 1WC0A 2DRDA 1NNDA 2HGLA 2XI3A 3M30A 2I38A 1S9EB 1NSPA 1RA7A 2YKQA 5DZ6A 5KFTA 1U45A 1OQ3A 2IA0A 4MFBB 1B0TA 4O3QA 1R0AB 3DU6A 5LMNF 2H9ZA 1V3ZA 1X0FA 2M9KA 1N34F 5F8LA 2GIFA 2V94A 2UUAJ 2LA6A 1XNQJ 3KNAA 2NXEA 4XPCA 2DH7A 3QATA 4DX6A 4F4XA 5DG7A 3KLEA 3EGNA 2R7SA 4WPAA 2VICA 4LJMA 1HI0P 3R5BA 3R7SB 2E9RX 2JFDA 4QOTA 2HHHF 1G1XA 3D4JA 1FF2A 2X3GA 3UPFA 2MZTA 5KFIA 3TP2A 1HBUB 5KFFA 4X4SA 4AL6A 3SQGB 4DQSA 2D3UA 3AXMA 3CDBA 4M1KA 1UZHA 2CJXB 4P74A 3W1YC 3HPOA 4DUZJ 1TMMA 2D74B 1OPIA 2KT2A 4I68A 4C0OC 4BC7A 3CCJS 3JB9k 2ZH2A 4DWIA 4F2RA 2BKOA 2HLUA 2UUBJ 5C24B 3H90A 1FEEA 1YRUA 4MYUA 1GMVA 3FCHA 3KLFB 3OXGA 4K2XA 2BE2B 1VQ9S 3ENVA 4KIAA 2H4YB 1UW4A 5K8NA 1S10A 1H38A 1IR0A 2FLNA 1V9OA 4IH6A 3FMWA 3C66A 3GWCA 4F4KA 1XQIA 4L75A 3ET6B 4DF4A 3BGRA 4G1QB 2EFGA 3G8SA 4JV5F 1Q5YA 3R7NB 2Z2LA 5DG9A 2VJVA 1SKUB 3S7RA 3MCMA 4A8QA 5EN1A 1VR6A 1HBMB 2ZH1A 2UUBF 2DNGA 2SXLA 2QEXS 4JI8J 2WW4A 1FXLA 4TU9A 5F8IA 3D1HA 1F0XA 3IRWP 3V6HA 4C4WA 2W7PA 1IVZA 2A2DA 2YX4A 2WVFA 3MMBB 2L3MA 3MM9A 2JH3A 4RR5A 2FJDB 5LSLA 2VKZG 2DR6A 1SL1A 2KHCA 2O1PA 3V2UC 5A8WB 2KFYA 1T11A 3WC2A 5DLFA 2IJFA 4FBUA 3BBFA 2C2EA 4KO0B 2UUAF 3JQKA 3J7Z5 4N5SA 2J7KA 3C6UA 2PMWA 2CNOB 2ZJRQ 1VDHA 2QA4G 4NZ0A 3DRRB 2EW9A 2QSWA 2ZFHA 3KJQB 3VV2B 2YKPA 1BXNA 2LDIA 3M30B 4OFZA 3W7BA 3UR0A 1IBMJ 2HHHJ 4NXMJ 2XB2D 1KOOA 4MKAA 2VQFJ 1WOSA 3CDUA 2DCLA 4MFBA 1KHVA 1LWFB 3R3TA 4JV1A 4CO5A 1TUGB 2P9GA 1LW2B 1DLOA 2KDOA 4M63A 3V6JA 1KVJA 1S9GB 4CNYA 1U1MA 4UOCA 3BM7A 2ASJA 1SKWA 2QZ8A 4F4ZA 2MLZA 2I2YA 2YQ3A 2G4BA 4WFAQ 8RUCA 3TOQA 4LF9J 2J5AA 3FCVA 5D6GA 2N3LA 4KH0B 2HVZA 1HNZF 4WBFA 4DN0A 1WOPA 2DGTA 1KOHA 4ID8A 4ZLPA 1B0PA 4U67Q 5HJXA 3CJ5A 2R7OA 4H54A 3T5KA 4KGVB 4USTA 2UVWA 2LXIA 1YBTA 2YBVA 4HHUA 4RWXA 2FLPA 1UJ4A 1KR4A 3UD5A 3QZ8A 2A6MA 2CVEA 5IM0B 1VQMS 4AUKA 5I3QA 3QQCD 2F7VA 1FRKA 1S76D 2Z2ZA 3THPA 1VQ5S 2GVZB 4HYKA 4CLYA 3QFHA 1NDCA 2AJ4A 1EJ7L 2B6AB 2VASA 3PFEA 3ZTOA 1FRJA 2CQDA 2FIUA 3ET6A 3GZ7A 5DDPC 1K0VA 3DRPB 4ZVFA 3FGVA 3SDEA 2I5JB 1H2UX 4ZVRB 1ZH5A 3CJ3A 2ZH7A 4G6VB 3IFEA 1GEHA 1EIYB 2J0QD 2V8GA 2CZ4A 1RAOA 4KFBA 1WACA 3T1HF 3HFVA 2XS5A 1GMWA 3G71S 2QTWA 4MT1A 4ZITA 1JB0C 2XMJA 1KVKA 2J9DA 2JDJA 4QQBA 4ZVQB 1VBZA 7FD1A 5KFYA 3HVWA 2Y3YA 4WP9A 2CPYA 2UUCJ 3J7AN 3CMES 5IQQA 5DG8A 4TYAA 5KFUA 2ZZNA 2IAJB 2GMLA 2C3YA 2BDPA 4RUAA 1S1TA 3RU0A 5J2MB 4P2FA 5DJBA 3JAMU 3EPGA 1I94F 1T03B 1YX2A 4DSIA 2KVQE 1BQMB 2R2TA 2V34A 4U7CA 1DURA 2JSXA 4LSZB 2AYBA 3AD7C 5I42A 3OUYB 3G8TA 3NLCA 1VBKA 4FXDA 1NSQA 4B9NA 2W9CA 1XN9A 1KP6A 1QDUB 3D5MA 2B5JB 2HQGA 4F36A 3JSMB 4ED8A 1LV5A 3KLGA 1BLUA 2P6SA 4OJHA 1VQPS 3UCUP 2MGZB 1PYSB 1WG4A 5CA5A 1SC6A 3GV8B 3CO9A 4TU8A 4DR2J 4ILLA 3MTJA 4IOAQ 1HNIB 3MD3A 4TLRA 2DGUA 3IMQJ 4F4WA 2GJIA 5M2RA 3LH2S 4CH0S 3PR5B 1AA1B 3HSDA 1RTHA 3TAMB 1TKZB 2OMOA 3NCRA 5D4LA 3TZWA 2DY1A 3SCIE 4ED4A 2YWKA 1CJKB 2CQGA 3L95X 2XI2A 2ZC3A 5A0YA 2V68A 4RW6B 2OSQA 3IAM9 5KG3A 2BANB 5SUHA 3PKYA 1XNQF 2MQLA 4PEOA 5KT4A 2VU5A 1NHUA 5IM0A 2BR0A 3HT0A 4UY8T 2ZH3A 4QU6A 1JXEA 3T9NA 3OFFA 4YB1P 4QWCA 2CJAA 2GVZA 3FC9A 3R1LA 1UVJA 3N79A 3X1LB 5LMUJ 3UN3A 1U2FA 5FDLB 1LWXA 4DQRA 1W7WA 1TL5A 2Q3PA 5ITHA 3EZ5A 1H7XA 3PX4A 3CULA 3OR2A 4X4UA 3ITHB 4LR7A 3MD1A 5ETNA 4JI7J 2K1RB 3L7PA 1S6QA 2MHNA 2IRXA 4DX7A 4K4VA 4R5PA 2H65B 1OO0B 2VFRA 2BW2A 1QAYA 2Z30B 3MOZA 4ZPDA 3THVA 1VQ4S 4O3SA 3KG0A 4OYPA 1PYOB 3EPIA 4O44A 3HDSA 2DHAA 5H9FJ 2X1BA 2HQDA 2X1GA 3VQSA 3DOLB 4DL0C 1QSYA
chains in the Genus database with same CATH topology
4IFVB 2ZBCA 3DLEB 2VKRA 4V19X 1VHFA 3M8QB 5LMUF 4DL2A 2MY8A 1U49A 1AFJA 3KMSA 3I31A 1TK0A 3T19A 3JYTB 1REVA 2GNKA 5G0RA 3LUYA 4AQYF 1HWLA 3N6LA 4LF8F 4A8OA 3WZ0A 3MM6B 5KT5A 2YX1A 3J80Y 3KK1B 3SCJE 1C1BA 2FGCA 4WFXA 4EGLA 2L48A 3RBDA 4K4WA 2DJWA 3D54A 4DUZF 4I2PA 3T9ZA 3SYZA 1T3OA 4ELUA 4RNHA 2N7YA 1JMTA 3OVBA 3P49B 2OH2A 1N5YB 2VPWB 1E6YA 5J2QB 4ZHRA 2MKKA 2WHOA 5IT0A 3IG1A 3HVAA 3W2VA 4IUFA 3N9UC 1UETA 1VQNS 2PT0A 1D9FA 1S1WA 2HQ3A 4WU3A 3DRXA 1JLBB 5D4PA 3PIOQ 3I96A 3PRBA 2YNHB 1HBUA 4K4SA 4J5OA 4C97A 3SQGA 2KRRA 2R7XA 2AF6A 5E3RA 2ABYA 5DGBA 2GQCA 3C8YA 3TW0A 3MAQA 3IA0A 2A3JA 3IC1A 3Q24A 2N3OA 4YHHF 4OJGA 3HKWA 5LT5A 5D8HB 3DRYA 1WG5A 5B0DA 1B64A 4NLUA 5FDLA 1C0TA 3CCZA 1S72S 3HMJG 4ECXA 2K1RA 2WAQD 4WU2A 3CIZA 5BYRA 1U1RA 2YWGA 3G4SS 1VC0A 1YJWS 4EBDA 1M1KT 3GYNA 5KFDA 5EX0A 2OAUA 2VA2A 3KHRA 1VFJA 1IKYA 3MMAB 1FXDA 5F0WA 3VAGA 2VPZB 3M8PA 2Y1JA 2FVQA 2Z0GA 2GC8A 3ONQA 4CT9A 4Q8FA 2UXDF 1BQNA 5JVHQ 4YQWA 3MMBA 4J9LA 2Q66A 3ISZA 3MM9B 1O0PA 3CIMA 4H4KA 4QBUA 2VBXA 1HD0A 4DQPA 2H5EA 3PO4A 4KC5A 2ZE2B 1C4AA 1VRTA 1UFWA 1QAIA 2XLIA 2R2SA 2AW0A 4YDDB 2EFVA 3QJPA 1C1BB 3CJ4A 3L7OA 3NNAA 1CSJA 3C6UB 2XCAA 3CB4A 1HYSA 2F9JA 4B3RF 3D0GE 3E01B 1RDRA 4PUOA 1ZBTA 3I9ZA 3LGNA 1Z1ZA 2CQ4A 1WTBA 1GXLA 4OHXA 5HROA 2LEPA 2WSFC 5GAGU 3MPYA 2OPRB 2DISA 3T1YF 2XHWA 5HMYA 4WKYA 1RKIA 2K8GA 5AXKA 5AE1A 5MLCV 1ZYQA 2CQPA 1ZTTA 5C25A 4QJVA 1JJ2R 2JEGA 3RW7A 2KH9A 2Q1LA 2YNHA 3T5JA 2LYVA 4KR0B 4X4VA 1N5TA 3IR6B 5KOXA 2NLWA 1TV6A 2WBMA 1JLCA 2EBGA 4F8RA 3MMCB 4B02A 2MKJA 1VQKS 5T7LB 2RVJA 2JEIA 2PGCA 2V4QA 2YKNB 1FKOB 3CDWA 1HW9A 4MK7A 4OHZA 3RBEA 3BS9A 2UP1A 4UQTA 4JI1F 2JZ5A 5F3TA 1D8YA 1MMLA 1C0TB 4Q45A 4RW8B 3SFGA 4LT6A 2B6AA 2IVMA 4LFBF 4HTJA 2K2PA 5L39A 1JXLA 5A8RB 1OIAA 4IG0B 2KM8B 3DI6B 2WW8A 3MMAA 2MPUA 1KQFB 2KN4A 2PN6A 3ZZTA 4KFBB 1MWYA 4TY8B 4B08A 3C2PA