2I0SD

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
124
structure length
123
Chain Sequence
b'HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 34
structure length 123
sequence length 124
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2i0sD00
2OJYD 3L4OC 4L1QC 2IUPD 4FA5C 2HKMD 3SJLC 2AH1D 2GC4B 1MG3B 2AGLD 2HJBD 4FA9C 4FB1C 3PXWC 2AGWD 3PXTC 4FA1C 4O1QC 4L3HC 2OK4D 2Q7QD 2OK6D 2BBKL 2HKRD 2HJ4D 3RN0C 3ORVC 2IURD 1MAFL 2AGXD 1MDAL 3PXSC 2AGZD 4L3GC 2OIZD 3SLEC 2GC7B 4FA4C 2J55L 2I0RD 3SWSC 3C75L 3RLMC 1MG2B 2AGYD 3RMZC 4FAVC 2IUQD 2HXCD 2MTAL 3SXTC 2I0SD 3RN1C 2IUVD 4FANC 3L4MC 2I0TD 2H3XB 2IAAB 4K3IC 1MAEL 2AH0D 3SVWC 2H47B 2J57K 2J56L 2MADL 4Y5RC
chains in the Genus database with same CATH superfamily
2OJYD 3L4OC 4L1QC 2IUPD 4FA5C 2HKMD 3SJLC 2AH1D 2GC4B 1MG3B 2AGLD 2HJBD 4FA9C 4FB1C 3PXWC 2AGWD 3PXTC 4FA1C 4O1QC 4L3HC 2OK4D 2Q7QD 2OK6D 2BBKL 2HKRD 2HJ4D 3RN0C 3ORVC 2IURD 1MAFL 2AGXD 1MDAL 3PXSC 2AGZD 4L3GC 2OIZD 3SLEC 2GC7B 4FA4C 2J55L 2I0RD 3SWSC 3C75L 3RLMC 1MG2B 2AGYD 3RMZC 4FAVC 2IUQD 2HXCD 2MTAL 3SXTC 2I0SD 3RN1C 2IUVD 4FANC 3L4MC 2I0TD 2H3XB 2IAAB 4K3IC 1MAEL 2AH0D 3SVWC 2H47B 2J57K 2J56L 2MADL 4Y5RC
chains in the Genus database with same CATH topology
2OJYD 3L4OC 4L1QC 2IUPD 4FA5C 2HKMD 3SJLC 2AH1D 2GC4B 1MG3B 2AGLD 2HJBD 4FA9C 4FB1C 3PXWC 2AGWD 3PXTC 4FA1C 4O1QC 4L3HC 2OK4D 2Q7QD 2OK6D 2BBKL 2HKRD 2HJ4D 3RN0C 3ORVC 2IURD 1MAFL 2AGXD 1MDAL 3PXSC 2AGZD 4L3GC 2OIZD 3SLEC 2GC7B 4FA4C 2J55L 2I0RD 3SWSC 3C75L 3RLMC 1MG2B 2AGYD 3RMZC 4FAVC 2IUQD 2HXCD 2MTAL 3SXTC 2I0SD 3RN1C 2IUVD 4FANC 3L4MC 2I0TD 2H3XB 2IAAB 4K3IC 1MAEL 2AH0D 3SVWC 2H47B 2J57K 2J56L 2MADL 4Y5RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJY D;  3L4O C;  4L1Q C;  2IUP D;  4FA5 C;  2HKM D;  3SJL C;  2AH1 D;  2GC4 B;  1MG3 B;  2AGL D;  2HJB D;  4FA9 C;  4FB1 C;  3PXW C;  2AGW D;  3PXT C;  4FA1 C;  4O1Q C;  4L3H C;  2OK4 D;  2Q7Q D;  2OK6 D;  2BBK L;  2HKR D;  2HJ4 D;  3RN0 C;  3ORV C;  2IUR D;  1MAF L;  2AGX D;  1MDA L;  3PXS C;  2AGZ D;  4L3G C;  2OIZ D;  3SLE C;  2GC7 B;  4FA4 C;  2J55 L;  2I0R D;  3SWS C;  3C75 L;  3RLM C;  1MG2 B;  2AGY D;  3RMZ C;  4FAV C;  2IUQ D;  2HXC D;  2MTA L;  3SXT C;  2I0S D;  3RN1 C;  2IUV D;  4FAN C;  3L4M C;  2I0T D;  2H3X B;  2IAA B;  4K3I C;  1MAE L;  2AH0 D;  3SVW C;  2H47 B;  2J57 K;  2J56 L;  2MAD L;  4Y5R C; 
#chains in the Genus database with same CATH topology
 2OJY D;  3L4O C;  4L1Q C;  2IUP D;  4FA5 C;  2HKM D;  3SJL C;  2AH1 D;  2GC4 B;  1MG3 B;  2AGL D;  2HJB D;  4FA9 C;  4FB1 C;  3PXW C;  2AGW D;  3PXT C;  4FA1 C;  4O1Q C;  4L3H C;  2OK4 D;  2Q7Q D;  2OK6 D;  2BBK L;  2HKR D;  2HJ4 D;  3RN0 C;  3ORV C;  2IUR D;  1MAF L;  2AGX D;  1MDA L;  3PXS C;  2AGZ D;  4L3G C;  2OIZ D;  3SLE C;  2GC7 B;  4FA4 C;  2J55 L;  2I0R D;  3SWS C;  3C75 L;  3RLM C;  1MG2 B;  2AGY D;  3RMZ C;  4FAV C;  2IUQ D;  2HXC D;  2MTA L;  3SXT C;  2I0S D;  3RN1 C;  2IUV D;  4FAN C;  3L4M C;  2I0T D;  2H3X B;  2IAA B;  4K3I C;  1MAE L;  2AH0 D;  3SVW C;  2H47 B;  2J57 K;  2J56 L;  2MAD L;  4Y5R C; 
#chains in the Genus database with same CATH homology
 2OJY D;  3L4O C;  4L1Q C;  2IUP D;  4FA5 C;  2HKM D;  3SJL C;  2AH1 D;  2GC4 B;  1MG3 B;  2AGL D;  2HJB D;  4FA9 C;  4FB1 C;  3PXW C;  2AGW D;  3PXT C;  4FA1 C;  4O1Q C;  4L3H C;  2OK4 D;  2Q7Q D;  2OK6 D;  2BBK L;  2HKR D;  2HJ4 D;  3RN0 C;  3ORV C;  2IUR D;  1MAF L;  2AGX D;  1MDA L;  3PXS C;  2AGZ D;  4L3G C;  2OIZ D;  3SLE C;  2GC7 B;  4FA4 C;  2J55 L;  2I0R D;  3SWS C;  3C75 L;  3RLM C;  1MG2 B;  2AGY D;  3RMZ C;  4FAV C;  2IUQ D;  2HXC D;  2MTA L;  3SXT C;  2I0S D;  3RN1 C;  2IUV D;  4FAN C;  3L4M C;  2I0T D;  2H3X B;  2IAA B;  4K3I C;  1MAE L;  2AH0 D;  3SVW C;  2H47 B;  2J57 K;  2J56 L;  2MAD L;  4Y5R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...