2IGFH

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSRCAMSWVRQTPEKRLEWVAGISSGGSYTFYPDTVKGRFIISRNNARNTLSLQMSSLRSEDTAIYYCTRYSSDPFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfH01
1LP9E 3HE6A 2OL3L 3KPQB 5F7LB 3O9WC 3BGMB 2HFTA 4LLDA 1G7IA 1O7SA 2BNQA 5JIKA 5IVZB 4S1QL 3KPNB 3LHPH 4UIMA 1ZOXA 4OD1L 1PDKA 2IPUK 1JUFB 2WBWB 3OKDB 3HI6L 1KYOJ 3QQ3B 5IHZB 2FBOJ 3ARTA 1DBBL 2H32H 3IGAB 3L3GA 4LAQH 4D8PA 1QR1B 3GSUB 1FZOB 3O3DA 4ZMAT 5ERWA 3T2NL 1BF2A 1MCJA 1T7YA 3M17B 1SJEA 4CGTA 4PLKD 5ERWB 3QNXB 1DTUA 2QQQA 2R1YB 3IDMB 1IZJA 4KQ4L 3OR7B 3V6OA 3T1FB 1BIIA 4LRNH 1J5OL 2AKRA 2V2TA 3PL6D 4FFVD 4HIIA 2P5EA 4WV1A 2V17H 2JJUA 5DJYB 4OZGF 2NR6C 5HHOE 5HHPA 1U3ZA 1R3HB 4G80A 3CFIC 3JZ7A 7CGTA 5BJTA 2IAMA 3F58H 3BZ4A 4EI5A 2DLFH 1ZGLP 1N59B 4OZIB 3L3HA 3QHZH 2EE9A 4M6OL 2G9HB 3KPRA 1G6VK 2D7MA 3JV0A 3D69A 2QSQA 3D3VE 3QXUA 3P3YA 3OG4B 1T7ZA 5LVEA 4Y7MA 1A1NB 1E27A 1UKSA 2XKNA 1S7RB 5DSCA 1NKRA 1FFOA 2VOTA 5IVXF 5FO8B 5FO7A 4O51A 3MRIB 1YMHA 4B41A 4NO0B 1J0KA 1CDGA 2XQYG 4QF1B 4MCYB 5L8JB 1NFIA 3G6DL 2BCKA 3VFOA 4GW4B 1AE6H 1L0QA 1RZKH 4LNRB 1NGXB 5F7FA 1E4KA 5F1SA 3L5XL 2DQFA 2D31B 2VDQL 2DOCA 3SCMA 3PWPE 4JPIA 3V7MA 5CEZE 5EPMB 4ZO9A 4NQDD 3VRIA 4X5WB 1TNNA 1GL4B 3KPPA 1EZVX 5IT2L 5D1XD 2JELH 1S3KL 1QEWA 3HG1D 5JQ6L 3CMGA 4X99A 1VEOA 4NOFA 2WP3T 4MMZC 3MCLL 1AHWA 1RZJC 1NKOA 3NZ8B 2HT4C 4DZ8B 3O9WD 1A7OH 3UTTE 2ZG2A 1FFPA 3FOLB 2VSCA 4BH7A 5F7WC 4OI9A 1LP9B 3LS4H 4DKEL 2DLHA 4HFUH 2IFGA 3HMXL 3SDDB 2DBLL 4APQB 2PR4H 1S7QB 4YHNA 4ENEC 1OAUL 4NO3B 4ALAL 1J10A 1LE9A 2HT3D 2XWBA 4WEBH 4EI6A 4XNUH 1N5AB 4APQA 3HR5A 2ZCKL 4N8CH 3D3VA 4ZUVA 3U7YH 5E8EB 3ZTNH 4X7CC 4OCMC 1MFCL 2WSKA 2VLLA 4HJ0C 1CLCA 5K59E 2Y9RT 3ZKNC 3QPXL 5F1NB 5J11C 2PYFA 1S7XB 4FFWC 1CFNA 4HWBH 1NBYA 2Q3ZA 2E9WA 2C1PB 2Z91B 4YQXL 1MAML 4IIQA 4GUPB 4XCFH 4I3RH 2AVGA 3GIZL 2RB8A 3EYUH 4ELMF 1A7RL 3NCEB 3RX7A 4HUNB 3OKKA 4PJIB 4CAGA 4ODSH 5I1CL 3QQNA 3HE7B 4XAWL 2QADD 3AY4A 5IGXH 3BP4B 4JO2L 1U8PB 5GS2D 5E99H 1QFUH 2GK2A 4U1MB 3SGJA 4JB9H 2FEDC 1LDSA 3OF6A 3W81A 2VN4A 2OTWA 3FB8B 1MCCA 1OTTC 2F19H 4FG6C 4M7JL 1EIBA 2C26A 5TFSL 1T0PB 4A6YB 4CN1A 1VGKB 5JOEA 1MCHA 1J11A 3DARA 2DQJH 3SKJH 1JWUB 3HRZA 3MGOA 4JFXA 2IBZY 4KKLD 4Y4HA 4PJ7A 4JQXC 32C2A 5E1AB 1Z9MA 2ITCA 4BSVB 2BNQD 1LO5A 2RFXA 4ZODA 3V6FA 4MS8C 4WWKB 1UWXK 5D1ZB 1ORQA 4NQCA 4PRNB 1WUNT 2ITDA 2IFFH 5IEHB 3AAZA 5DTFB 5FYLD 3PWLB 4QHLA 3KYKH 1XF2A 1UVQB 1GC1L 4YBQD 2YPVH 1KTRL 4C56B 4HUXA 1CLZH 3JWNC 5EBMB 2DB8A 1BVZA 1FNGA 2VZUA 3OAZH 1S9WB 2KZWA 1U2CA 2HT2C 4HV8A 4YPGA 1CL7L 4F7MA 3O41B 1MJUL 4HC1A 3HZMA 3DX9A 3ZKMD 1LK2A 3DO3A 4GRLC 2BCKB 1AXTL 5IVXE 3WS3A 1MPAL 4YBHA 4NQVA 3HFML 2CLRB 2EDYA 4YK4C 3QNYA 5I1CH 3KLAB 1YN7B 2E6JA 5IEKA 2OMNA 4LIQH 1KJVB 2NPLX 3O2VH 1OAXH 1X6NA 1X5FA 3GMMB 3ME0A 5C0BA 1FNEA 3PNWB 2P24B 4S1QH 4ODWB 3U46A 3V4VH 1M05B 1I4FB 4I2XB 3BPNB 1MLBA 3SE9H 4R4FL 5KS9B 1A6UH 2P48B 2N7AA 3SO3B 2X4TA 3VXPA 2F8OA 1C5CH 5EO0B 4P5MA 1BREA 4G9DA 4NBXB 4WI5A 4LVHB 3KYNB 3VD9A 3OB8A 4IRSB 4Y1AB 4HKXB 2Q1EA 2PKDA 2DM4A 3P4MB 4PJ9B 4YDJA 2QEJA 1OQOA 3SCMC 4B7LA 3T0EC 1JNHB 3QJFA 1YA5A 3UTTB 5HYIA 4KRLB 4QHNA 1BVLA 4PJGF 1J7VR 5IB3B 1AD0A 1UWGL 4LSUH 2C3WA 3BHBB 1FN4B 4ZUTA 5CJBA 4Y8AA 3NN8B 4IDLA 4UT9L 4XXCC 4Z7WA 3V0VB 2GEEA 5M94B 4RMWA 2E7LA 4LHUA 1MNUL 3WLBB 4R3SA 2JJTC 3MJ8B 3SE8H 1CD1A 4LCUA 2WUBH 4HSQA 1CXLA 1HILA 2EDFA 3KYOA 4MCZB 1SJXA 1IGYB 2VL4A 1JPTL 3QIWB 4TNVF 1A8JH 2OTWB 3ZL4H 2EYTB 4NCC2 3HI1B 2BXZA 1W72L 3EJYD 1G7HB 4NJ9H 3MNVA 2D7NA 3QA3A 1INDL 1MHCA 1UH2A 4OAWB 3DVNA 3LS5H 2EDWA 4XBEH 5EFIA 4JKLA 1ZHKB 5GGRA 5BRZD 4A2LA 3B6SB 1I7TA 2E9BA 3EDJA 1DLFL 2ARJQ 1CD9B 4KTDL 3WKMH 3UROR 4WWKA 4PY7A 4BZ1L 1F4WH 2ATPA 4QKXB 1OT2A 3MZGB 1I7ZA 3WBDA 4QXTA 4PY7B 4H1LH 5CBAB 5KSAD 3MBEB 1IT9L 4ZFOA 5HGBA 5JO5B 1F8TL 4WI6A 3QXTA 5DHXB 1T5XB 1FGNH 2R0WL 2X9XA 5CZXD 3IDGB 3RAJL 4R7DB 2YUXA 3QIUA 4JREB 5D7KE 1TDQA 4BKLA 3P0VL 4PY8I 1QFOA 4ZNCD 2PUQT 5DJZA 1U8NA 4ZSOA 4R7NB 5E9DE 1CFBA 1C1EL 3OQ3B 5MEQB 5IJKA 3OHXA 1BJ8A 1S9YA 5EZJA 5KVFH 2F5AH 1S7UB 2PO6D 3UAJC 2P47B 3PGDA 3T0EB 2UWEF 4N0UE 5A2FA 5BV7B 5J6HB 3CDGB 2VTFA 3HE6B 4HH9B 5I15L 2KL6A 4D9LH 1GYAA 4NKDA 3CFJB 5DMJB 5IQ9B 3BEVA 4IRSC 1HSBB 4G6FD 4LLWA 1KIPA 4LVHC 1MCWW 5LKNA 1OTSC 1MJJA 1HYSD 3QUYD 4EUPA 1SBSL 5C86A 5HYJD 3SO3C 3QQ3A 3S37X 4TNVK 5EU6D 5GS0H 5HYEA 4E41D 2G2RA 4HXAL 4ODUB 1WTLA 3C6LB 3WHXA 5F9DC 1A6TB 3FQWB 1FG9C 1FZKB 2EH8L 1NMBL 4XMPH 1QBLH 3BPNC 3VWKA 2R8SL 2DM3A 4QOKD 4D0DB 3R8QA 4NBYB 4TQEH 4QT5B 1J1PH 5JOFA 4N8VA 4QHMB 1N7MH 2FHCA 2X09A 2XWTA 4IRSA 4BSWB 4OZHF 4LAJH 5HGHB 4JGJA 4XXDB 3U83A 4DN3L 3GMOA 3TBVB 3SOBL 1P5UA 5FV1L 1TITA 2EDQA 2ENYA 4J1UB 2XY2A 3L3DA 2F58H 4FQJL 1T20B 5KSVA 1Q94A 1KENL 3K8LA 4NM4L 2NXZD 5SWZE 1EX0A 4GRLB 1G7LA 1OP5H 1H8OA 4Y19B 3MUHL 4ETYA 5EUKA 5IJKC 3BSZH 1H3UA 4P23A 5DA4A 2VMFA 1YYMH 1YEDB 4NWTL 3L5HA 4NO0D 5HYQB 3SDXE 1P9MA 4KKBC 2LV4A 1C7SA 4TSCL 4RCAA 1KLFA 4ENED 5C0AB 5GS0D 4JKMA 4XRCA 1SY6H 4TTGA 4JHAL 3I75B 2YD6A 4O51B 2CIKA 3BUTA 1F45A 5JQ6H 1MQKH 1HILB 3LMJH 2R4SH 3RNKB 4JDZA 4OGXL 4WRLA 1Q72H 3UYRL 3QAZB 3AS3A 4LLAA 4WWKC 1D5XB 5JORB 1MWAB 4HXAH 4QRQA 2GSIA 3NIDE 1XF4A 3GMRA 1FNFA 1DFBH 4YUEH 5EOTB 1EFQA 2FX8L 3BKML 3DUSB 3S5LG 4WEMB 1E4XH 4JANB 1H5BA 1H3PL 1GIGH 1CK0H 5FYLH 2ICWJ 4LVEA 3RU8H 1Q0XL 4O9HL 4XI5C 2GSGA 5IFAH 1P4LA 1W0VB 1DE4A 2VN7A 3EOTL 2N56A 2NY3D 5JR1H 3ETBF 4CJ1A 5JO5A 1U8HA 2VLKD 3O6FA 3AREA 4X4YB 2XPGA 3WO4B 2X89D 3U36A 1SM3L 5ADOH 1HXYB 3HE7C 4YHIB 5C08B 2Y72A 4EN3C 5E2WH 3EYQC 1HKLH 1JZ8A 4UIKH 4LDOB 1KCSH 3ULUE 4ZAKC 5J7CC 2HH0L 4QTHB 3GMPA 5D2NE 5DJ0A 1J8HD 4LSPH 3GDBA 1NGYA 1JF6A 3ARWA 1A7NL 3QPQD 4G6KH 1JNJA 3LMJL 3KJ6L 3VXOB 5HPMA 3LKRA 3LOWA 1F4WL 5ADOL 5BCAA 3UXFA 3IFPB 2DICA 1OAKH 4GRMA 2UUDH 3SDDC 1T21B 5MERB 3HN3A 3TFKD 5ETUB 3JVGC 1FZMA 4AYFA 4WTZG 4TRPL 3C09B 3C8KB 3VDCA 5I6XB 4R0LA 1HHKB 3CJJA 2VLMD 2PF6A 1KUMA 3RIAK 4KI5F 1I1FB 1YEJH 2IANE 3ROLA 3O4LE 3B8YA 2J7LA 4HUXB 2N1KA 1JN6B 1U58B 2XWJA 2BNRB 4K71C 2MNUA 4OZ4B 2FX9L 4LVNB 4NKQB 4PB0L 5CILL 5DJ2B 3UEZA 4NHCL 4Q9QH 4Y5VA 4KK9C 2C3GA 5I8KH 4RISH 2I25N 1MAKA 1G7PB 3QFJE 1F4YL 1QACA 4XMLH 3DWTA 1UZ6F 5HHXL 1TZGH 4U1SB 3OKOA 2LQRA 4XMKL 3VRIB 5GJTL 4TVPH 1T22B 4PGCA 1F6LL 1YEJL 2X4PA 1K6QH 2FH6A 2XQBL 2YZ8A 4XNYL 1KTKE 5DUPL 4HS8H 1KF9B 4I18A 3CDFA 3E6HA 3T08A 1JTTA 2UY6A 3T8XA 1QBLL 1FE8L 3MMEB 1JPGA 3KPMA 5J9PB 3RIFF 3RZCB 2ICEB 4TQEL 3D1MC 2VE6A 3MMEA 2QV2A 2B2XL 5SWZD 1G9MH 4MNHB 3QXVA 2VXQL 2WZPD 2ICEA 1VACA 4NSKB 1GZQA 2VABA 3UAJD 3S37L 3VMNA 1J1XL 2X4UA 5DRWB 5EOTA 4HKXA 2OS7A 3PHOA 5DD6A 5CEYA 5K9OB 4ZO6A 3L3OA 2LE9A 4QCIB 2X4RB 1UG9A 3PHOB 5CP3A 3ES6A 4PRPA 4A6YL 5IR1B 1FH5H 5KSUB 2NY6B 2P24A 4NFDA 1ZLUK 5I18H 4Y4FD 1ROWA 1DBAH 4I48A 3MR9A 2HTLC 2VDPL 1BWMA 2ARWA 4DGIL 3BDXA 1YEGL 3M45A 5ESVB 2XN9E 4JKPH 5E6ZA 2AS5M 4ZFGL 12E8L 3MRCB 4QRTA 4M7JH 4JFOB 4MJIE 3LY6A 5ESVA 2R0ZL 4ZPTA 1KFAH 5CINL 4KZDH 3WN5C 3V52L 3MRBB 2IQAA 3BE1L 1N2RB 1YDPA 1I9IL 4O02L 1IGFL 1YC7A 3C2AL 4CN6A 4Q6YA 4ZOCA 3N1MC 5CIPA 5L6YH 3BGAA 3C5ZB 4F7CB 1NMCC 4RAUB 1CZ8H 1I3RB 3LQAC 3RWDA 4A6YA 4ELKA 1GH7A 4NM8L 4RA3A 1XGTA 5ANMA 5KTEL 5CINH 5CCKH 4DOHE 2AXJA 5TDPB 5I76B 3SDAB 2OTPA 1OP5K 5DK0A 2DQDL 4J4PD 3VFVB 4F9PC 3VD7A 3UMTA 2P8MB 4OZGE 2J8UA 4JGUA 1IFHL 1N26A 1IBGH 2GY5A 3D39B 3HC4H 4AEEA 4L5FH 4N0YL 1A2YB 5ICYB 5HYSG 5I9QB 1W72H 3O3BB 1IEHA 1PKQE 3RWGA 4H1LA 4Z7NE 4ZNEA 1Z0NA 1RZJL 3NIDF 1AHWC 3L3HB 5LQBL 5E8OB 3RJDA 3TESA 1V05A 2CRYA 3KXFA 1EMTH 3HI1A 3KPSB 4L9LB 4ODHH 4TULL 3SDXF 5B3JF 4L29B 3AB0B 5DQDL 3JV6A 4B0MM 5HI5D 3MRKB 5I1JL 3OAYH 1ZHBA 5GRUL 4L3EA 1IAKB 1IILE 3WN5B 3R1GH 2BVUA 3VXUE 6FABH 1MCWM 3BP6A 1Q0YL 4JRYB 3OZ9L 4OD2A 4K94C 2NLJB 4NQVB 5KAQF 5SX5K 1A02N 3QEUA 1MNUH 3SGKA 1U3HB 1UYWH 5KVEH 1NCTA 2P8PA 1FGVL 4HFWB 1V7NH 2LU4A 4XVJL 3CDGA 5L7XL 2D31A 3GKWL 4ZXBA 3F6LA 1FNEB 3PNWA 4MDJB 2KH2B 5JDSB 1NC4B 4FNLL 2DTMH 3QDME 1WIOA 4D9LL 3ZO0A 3IDXH 1TETH 3TYGH 1TXKA 4ZSOB 1U95A 4BELD 3F5WA 1MCKA 1HEZB 1UXSB 2VKWA 3VXSB 4YJZL 3KYNA 1G9NH 3RZCC 1XIWC 1DQMH 3UJJL 1MHEB 1YUHA 2BVOB 5F9JA 3DV6A 3HAEA 1BIIB 1J1PL 1KPVA 4UT9H 1T1XB 1T03H 2NW2B 4F33B 1T6WA 1QKZL 5J06A 3VG9B 2HYMA 2BZDA 1IBGL 3BVNB 3HC4L 4GAYA 4KAQH 2EKSB 5J6GA 3RGVC 4PBXA 5IB5B 3VE0B 1FNAA 3D6GA 1GZPB 3WDJA 1OAQH 5I16B 3UO1L 5JXEC 5D5ME 2CJUL 4U1NA 4M1CD 5EA0L 1A4KB 2CLVA 3MCLH 3MA9L 5D93B 3QUYA 5HYJA 3NCMA 1YYLL 3MV8B 5FKAA 5DR5L 3T3ME 3HPLA 3IXAA 5MHSE 1G7IB 2MQCA 1BAFL 3SKMB 2YD4A 3NAAL 1TCRB 4O5LH 2WINA 3THMH 4GKZA 3X12A 1NBZB 2NTFB 3OKDA 5MP6L 1TQBC 5ITFA 3N06B 1PY4A 4Y2DA 3TO4D 3U0TA 5D7IB 5FECB 3BRDA 43C9A 3HTLX 2F19L 1ITBB 1YYLH 1LMKA 3RTQB 2LU7A 4HC1H 1D5MA 3B9KD 3D25B 2EDTA 2XA8L 3ZYIA 4RGMB 5TDPA 1ZWIB 1S9KC 3NFNB 1H0DA 3KXFE 3LRSA 3PIQB 3L6FB 1A1MB 3OL2A 4LRIA 4XZUA 3ULUL 2VYRE 4HKBA 5GIRB 1HQRA 4JO3L 3QDJA 1Y18A 5FYLL 4Y4HB 4KK9D 1H3PH 1D3CA 5GSVA 3QFJD 4OZIA 4XB7A 3MLVL 3V6BR 4DK3A 1NQBA 1CQYA 4PJDB 1YPZF 5EA0H 5IOPA 3HUJE 2RCSH 5LG1A 4OF6A 3MRDB 4KK6C 5EZLA 3RWFB 3UPRA 1G9ML 1A3LL 3H42L 1OW0A 4NQTA 3MODL 2BVQA 5B3NA 5E2JA 3WO4C 3LAFA 4DN4L 2NY3B 1MLCB 5H35B 2DAVA 1S7UA 3S36H 3PF2A 4S0TD 3O45B 4PJBF 4TN9A 3HZMB 1VA9A 3CH8A 2ZOKA 2FSEA 1RK1B 4YDIL 3QEHB 4QTIL 5IESH 4FQCL 1FL3A 4XPAH 3FMGL 4NPYB 3QNYB 2UV3A 1ZT7A 3KPSD 4AIZB 4OKDA 3BRFA 4L8SC 1T66C 1B4RA 4AIZA 1HIMH 3RWHA 2XN9A 3KLDA 2NY4B 4HS3A 2O5XH 1A7QH 3QAZC 4ODHL 4BH8A 3LKSA 3WLWD 4IEFB 4PR5B 3O8XA 5CSZB 4R26L 4KXZI 3TO4C 3BMVA 4KHXL 3T77B 3PGDB 2FX7L 3EFDL 1RJLA 5JMOC 1M7IA 3LKPA 1GC1C 4DK6A 4HMDA 2YPLD 1JRHH 3LKNB 3HPJB 4ZUWA 3TCLB 4JFHE 1VSCA 2GTZA 4U1HB 3BOVA 4XPBH 4QHKJ 2B7DT 4CDHA 3ZKMC 4HHAB 4IDJL 5D1ZA 4XI5D 1KBGL 1TTGA 1PKQB 3LB6C 3QPXH 4Z7VE 3VXMB 4MQXC 5T3ZE 1K8IA 1D5IH 4HUVB 3D39E 4RX4A 1Q9KA 2C3VA 3TVMA 4Y2DC 1QQDB 4WUUA 4HUVA 5I2IA 4HQQH 3EFFB 2W9DH 2ZCHH 1FDLL 1OW0C 1N3NB 2EYSA 2FJGB 2A0LC 4LCIH 3OKKB 3H9ZA 5IESL 4D9QE 3L5XH 4OM0L 5DMYA 3V0VA 1QRKA 3S35H 5JW5B 3RVTC 4JQIL 1U8QA 4FFVC 3QIBB 3NTCL 1OP3H 3NCYS 2I26N 3V5DA 5I8CA 1WCBB 5L88L 1F6AA 1EJ6A 3MXWL 3W2DH 4OQTA 2WIIB 1CLYL 2GKIA 4KKLC 4E41E 2OX5A 1MWAA 1CIDA 4MYWB 3U0TB 3BWAB 2OYPA 3A6BL 3QHTC 4P59L 4NZRL 3TJEH 3OKOB 2SEBB 3REVA 3WIIH 3OKNA 5I30L 4XX1E 5CP7B 1UM6L 4FQLL 1EEZA 1WBZB 2P4AB 4YHOH 1GCFA 3L6FA 3LSOA 5JIPA 3HZKA 2IFFL 4H8WH 1JV5B 3RTQC 4L4TE 4RGNB 4FTVB 3MXVH 4M5ZL 2ILLA 2A6JA 2AK4D 2OJZH 2VE6B 3FN3A 2PYEB 2Y6SC 3PV6B 1AP2A 2Q6WB 2H2SC 2PO6B 2B20A 3K81A 4NO3A 3W39B 3AU1B 3H7BA 4JDTL 4OGXH 2DJSA 3DVIA 2PO6A 1UVQA 3C5SA 1F4YH 3D18B 1D9KC 2NY6D 4KZDL 1XF5B 4YDJB 1NBQA 3FQTA 5FYKD 5TQ0L 4YAQA 5F93C 2BVQB 2VLRE 4U7MA 3EJJX 4M1GH 3K1KC 1TTUA 5E4EC 4UMGA 1DUYB 4XP6H 1QLRA 2R2EA 1WLHA 3QUZC 3WFZA 4PREA 4OIAA 3ARFC 5D6DA 4EIZC 2EE6A 2YD2A 3DX7A 2IANA 3LKRB 5D1XB 2JIXD 1EJOH 3QXDA 4PGBA 4F7TA 2OZ4L 4ONGH 2LABA 1EGJA 3DX8A 1NCCL 4UDTA 3K2UL 4I4WB 5FUOL 2QJDA 1OGAD 3GJFK 5K9QI 3TYFA 5IBUG 3HKFA 2YRLA 5B39G 3O6MH 2AP2A 3EZ8A 3G04B 1K4CB 3A6CH 5DD3H 4HS3B 2AGJL 2VLRA 3ZDYE 3STLA 3STZB 2CQVA 4W6WB 5D2NA 1VFAA 3EUUA 3T0AA 3WL9A 2A74B 2MWCA 1BWWA 4GXVH 3G5VB 1MIEH 4G9DB 2QSTA 4XNZB 5DRXB 4M00A 1XF1A 4P46B 2I9TA 2FJFB 5IW1A 2P42B 4K8RD 3B6SA 2R1YA 1KB5L 1EMTL 5HI3D 3WFDH 5KS9F 1A9EA 1I1RA 2NXYB 3ZYJA 3O2DA 2VISB 2VDMH 5CAYB 4JY6B 1IRAY 5FGSA 4KROC 3TZVB 3LQZA 1OQXA 1R3HA 3OZ9H 4G80B 4NFBA 4BFEA 1T5XA 2P8PB 4IRZH 2GY7B 4UILL 1I75A 1KIQA 2HTLD 4J3SA 5I1JH 1AO7A 4JFZL 4JZNA 3SDXA 4JR9L 3W11C 1JYWA 1CXFA 3BPCA 4TNWF 4WVRA 4PUBL 4GG6F 2EYSB 2FJGA 1NAKL 3CFBA 1V7NL 4XVJH 5JXAL 5DJXB 1AQKL 4KPHH 2OLDA 3PL6B 4R7NA 4Q74A 3O11A 5DEZA 3VCLB 4QXUH 4Q9CA 3MLXL 4P4KC 5E8DH 3OJVC 5BOZG 5KSBB 3PHQA 4OLVH 5I74B 3HUJF 4YHML 3VFUA 1N8ZB 4NZUL 4DTGH 4HG4K 2BOBB 4KMTH 5H37H 2MCPL 3ARQA 2YOCA 4GS7B 2HRPL 1HXMA 3OGCA 2Q76A 3Q3GA 5KSBF 4KGJA 1M05A 3HUJA 5CP7A 1CFTB 4TSCH 4PJGB 1T03L 5ID1B 3RIFK 5C0NC 2APXA 2EDKA 5E8PA 5EO1A 3NCBB 2PCPA 4L1DA 2X9WA 2I5YH 5GS2H 2Z92A 1NMCB 2GSGB 5HHQB 2QQNL 1CFSB 1OAZH 4NC0B 5JR1L 5DURB 4HT1H 4GXUN 2R4SL 1HHIB 4BQBA 4O2FA 4KQ4H 1X9QA 3WSQH 1ZGLA 1U8HB 5CCKL 4BJLA 1MCQA 2BVPB 2Z31A 5HDOA 3KDMB 3AY4C 3L3OB 5CBEA 3FB5A 2N7BA 2XWBB 3CXHK 4HK3N 5F89A 1ZT4B 2ZPKH 3Q6FA 1U8PA 3D3VB 4DVRL 1MCOL 2K7PA 4CADB 3V8OA 4GMTL 4NT6B 5BQ7B 1GZPA 4OCRH 4P2YA 1JHLL 5L8LB 5TGBB 1FG2B 3U30C 3R06B 4CMMB 4WUKL 2EXYD 1KCRH 1QG3A 2HKHH 3MRCA 1TLKA 1UWXH 4QRTB 4EVNA 4X4MA 2GCYA 4GUPA 4H1LG 4YR6B 4KK5C 1DBJH 5AYQA 5CEZD 4IM8A 3PQYA 3O0RH 2DJ4A 3N85L 1EH9A 5CKAA 4X6EA 3JUZA 4LARL 2W60B 32C2B 5E1AA 4I5BA 4QWWD 5SWSE 4DQOL 4NZJA 4JRYE 5IHZA 5J13B 4ERSH 5JOPE 4QRUA 1NPUA 5FOJA 2BHYA 1QOKA 1MELA 3KPRB 4PGEA 4AY0A 1FP5A 1RZIB 4DWHA 4GG8A 3G08B 4WUKH 1D5XA 4HPOL 5FUCC 1CGUA 2EDJA 4M4RA 1I1AB 3K74B 2Y23A 1ZS8B 5L0QB 3Q5TA 3IDMA 4PJ5E 5FO8A 2R0KH 2W0KA 3QUMH 2ATPB 3HE7D 3BW9A 1D6VL 4IOFC 1S7TA 1OGAA 4JFDA 1ZA6A 5A1AA 1FJ1A 4OFPA 2QHRH 3GIVA 1LO2L 4OZHB 4FZ8L 3RPKA 1OLLA 4NQCB 5J11B 3RBGA 2G9HA 1OCWH 1VGEL 2ZOLB 2PW2A 2XACC 1A4JB 3ARBD 4K71B 3RUGF 3CFBB 5IVXB 4PJFB 4MNGB 3WN5A 4KKAD 2CK2A 1OWRM 2AK1L 2UYLA 1S9WA 4UB0H 2IBZX 3RUGB 5I1EH 5I1DB 1NFDA 4XVSH 5IB4B 5D8JH 5JHDE 5DJ6B 5FYJL 3A67L 3WNNA 5IIEB 3UTSD 2A1WH 3FRPA 3BVNA 5T1KD 4XP1L 3P30L 3RVUD 1QFHA 1KJVA 3QULB 4P2QA 1L7TL 1VPOL 1T21A 1H3GA 4Z77A 1ADQH 3GSVA 4OTXL 1R24B 5AWNL 4YH6A 3RP1A 5JNYA 1KACB 4XWGL 2FIKB 1IEBB 1WBYB 1Z3GL 3B4NA 2XN9D 1UJTA 4UB0L 4U7SA 3NZ8A 3D48R 2AV7B 1EFXD 2O93L 1S7VA 2H9GA 3S6CA 3DRQA 3EYVB 4PJ8C 5KSAB 1JFQL 1WTGT 3NH7H 3W0WE 1CGYA 3GRWA 1QSFB 4HIJB 1CXHA 2EC9U 4N1CA 1T1XA 4P9MH 2WINB 3O6LL 4QGYA 4L8SA 4OFIA 4M5YH 4GAYB 2HT4D 3OWEA 3R0MA 1BQLL 2R23B 4LL9A 3NCCB 4RFEA 3RTQD 3FAWA 3HCVB 4CADA 4RRPG 3KYOB 4MCZA 2HFFB 5HD8D 1JNHA 4FQQB 2FLBT 4TVPD 3GSNH 2Q7YA 1U9KA 2YD5A 1IC1A 1YZZA 3QQ4A 3MRFB 3QIBD 2ESVA 4S11A 5TF1H 1F4XL 2PXYD 2IPTL 3FL7A 2FL5A 4BFBD 2ED9A 3QFDB 1YEFH 1KLGB 4RMVA 5JW5A 5CJ5A 3BKJH 3EHBC 5DLML 3WFHB 3ZTJG 4NGHL 3MBEA 3HMXH 4QRQB 4TRPH 2QR0B 3IB4A 1X5KA 4PGEB 4U6XA 2I60H 3GSQA 3K4AA 3D9AH 1VADB 1I3GL 4CVZB 5ADPH 2OJZL 1EO7A 2BOCB 1BVKA 1F11A 1UM4H 3EYOB 3FO0L 3BJLA 3C6SB 3C60D 3MLZL 3EDDA 3P9MA 1EUUA 5J3HD 4M6ML 5FB8A 4OGYH 1KCRL 1HNFA 3MUGB 1QSZA 2VERN 1DUYA 2RFXB 1AIFB 1Q0YH 2HRPH 3VXQB 4Y1AE 2D4DA 5T3XL 4N5UA 4XNQB 2FSEB 4OCWL 5DS8B 3UZVB 2NZ9C 5D1QA 4LARH 3HAEG 2YZ1A 1U3HA 4TULH 1S7SA 3MLVH 4N9GA 1T2XA 1YPZA 4F9LC 4FA8A 3INUL 1MI5E 5D7KD 4JRXE 4C56A 3IFNL 4OV5A 2OZ4H 1KJ2L 4ONGL 4M43L 4WIQA 3SDCD 5ITBL 3ZT6A 1F3JA 3BESR 2YK1H 4MNGA 1U42A 4JM4L 1XF5A 1T1WA 2KBGA 2K3TA 1BECA 2F54D 1FLRL 1QLEH 2UY7A 5KW9L 3O6FD 4U2ZA 3CFCL 4DVRH 3ZYOA 1JGDA 2EDHA 1A6TA 3MO1B 3MRQA 1EHXA 1PLGL 4LEOB 3QEGH 5C08E 3C60A 4NUJB 1HI6A 5E5MA 2R0LH 1KJ2B 1A6ZB 4PRID 3HNTL 1G7MB 4S1RH 3RY6A 1PAMA 5J56B 4KTDH 3L95A 4PJEF 2VB5A 5C09A 4Z7NF 2HMIC 1XT5A 3SKOA 3VFVA 3GNMH 4NNYA 3BEVB 3L3DB 3ARGA 1FC1A 4DKAA 3C60C 5B3JE 4JM2D 1FGNL 3HG1A 4PGZA 3H7LA 3T4YB 3SKNB 4PJEB 2J8UE 2OR9L 2P49B 8CGTA 3QXAA 1IKNC 3B5GA 1MQKL 4F15B 3TWCH 4AEHL 4LCWA 1JWMB 2YA2A 5FHBL 5DGQA 2ZCLH 4GLRI 5IP4A 5BZWB 5F6IC 4JR9H 4Y8DC 1RZFH 5ALCH 1MWAH 2NY0C 4LP4A 1YMME 1FRGH 4PLNC 4PJ8A 1RUAH 5E4IA 1JZ2A 1CICB 4GXUM 3VXRE 5D7LA 3LDBC 4ALAH 2DQTH 3LQZB 2EDOA 4M8QA 2HA1A 4CW1B 3MRNB 4LGRB 1QTYT 5IMMA 3TVMB 1CIUA 5LWYL 4Q2ZB 3PABB 4ZUUB 4G7VL 3P9LB 1X44A 2VNCA 2A77H 1OCWL 1JTOA 4RDQF 2C7UB 2XICA 3T8XB 2X44D 3F7PC 5HHVH 3ZDZE 3TC9A 5LXGL 4GBXA 1R3KA 1B6UA 4XPHL 2DQIL 2DLEA 3TBTB 1A7RH 4QRPE 2R1XB 4Y19E 3TT3H 2ZKHL 4XNYH 5EIIA 3MYJA 1AGBA 1U8LA 2XTJC 4K3GA 4X4YA 3N9GL 4LPYA 3GO1H 3GSOA 3WXWH 3TNNB 5FUOH 1I8LC 4NQSB 3MODH 1TJHL 3QCUL 4JPKL 4O4YL 3TN0A 1SBSH 1KIUA 4ZFZA 2V7HB 4U6YB 5C0AD 2VQ1B 4XGZA 3QRGH 2IANB 4XAKE 2V2XB 2RR3A 2VLJE 3QEUB 3WMSA 3QEQE 2Q6WA 3ZMRA 2BJML 1BM3H 1EEYB 2J6EL 5GGTA 4LQFL 3OB0H 5HHOA 3X3GH 3E3QE 3FOMA 3AREB 2XPGB 4P99A 1HXYA 3H0TA 4XBPA 3VGEA 5BV7H 4X9HA 4NZDA 1OGTA 3ZE1E 2HKFL 5BO1L 1MSPA 5EDXA 4N0UB 2DLTA 3SGEI 4ZO8A 4E0RB 2V5SA 5CJQH 1DP0A 1BX2A 1N64L 2HLFC 1CR9L 2VLKB 2DLFL 1I85A 5DUBB 2N4IA 1IL1B 3LZFH 4MQSB 5L6YL 4LFHD 5JXAH 1ZK9A 4YHKL 2J8UB 3I6LD 1MRDH 1RU9L 3DURB 2R9HC 1NUDA 1HKFA 2ADFL 5BS0A 5DFVD 4YK4B 1INDH 2APWA 4Z76A 1G0XA 4PB9L 4LVOC 4XCNB 1GGIH 1MF2L 4KKCD 5KG9A 4HC1L 2WMPA 4L29A 1IQDB 3MRDA 1A3RL 3O4LD 4PP1C 4TSAH 5BZWA 1YMHB 2WBJB 2R15A 3MFGB 4YHKH 1MIMH 3AS1A 3QI9B 1R5VA 3U0PB 1E0OB 2Z35A 3EO0B 1XGQA 3JV4B 5FYKL 3BW9B 1T20A 3RUGA 4J4PC 2J6EH 5GXBB 4N0RA 5CEZH 5IWLA 5ENWB 1UQSA 4MDIB 4HGKC 2HFGH 4CJ0A 2DDQL 1KB5A 4R2GB 4WFHE 1K85A 4OCWH 4C4KO 4GMSL 3QSKB 5T1DL 4HQQL 1P1ZB 4P5KA 4X5WA 3U4BH 4XTRC 1EO8L 1L7IL 5JW3H 2HJFB 2J5LB 4F7EA 4K3JH 2PR4L 1I1CA 4GSDH 5CWSB 4KUZH 4DKEH 1S9VB 2MMXA 4MB4A 1BFSA 1X5HA 43CAA 3H8NA 3FO2B 4KQ3H 4NQDB 1IAOA 4IBLT 4LKXB 5CGYC 1ONQB 2OM5A 4Q0XL 5F1IB 3V4VL 4UOW0 3IJSA 4UDUA 4JJ5B 1JPTH 3RBSA 3LVEA 4E41B 1YNTA 4NHCH 5BQ7A 4C83B 4WU5A 4Y4FC 9CGTA 1YNTB 1GPOH 4G7VH 2BVYA 4Y19D 2Z93B 1FLTX 3IU3A 3TA3A 3IJHA 1FBIL 1NC2B 4UV7L 1NLBH 5L9DL 3UTTD 4IJ3B 3EO1A 3S36X 3GBNH 4ZAKA 1AC6A 4OLUH 3DXAB 1QSFA 1WFNA 3OPZH 1I7RB 1SVCP 4UIMB 2GAZB 5HJ3A 4EN3A 2GFBB 4MJIB 2W0FB 2X2YA 5HHNB 4EXPX 1L6XA 4JFQA 3P40A 2W0LA 2XA8H 5IW6A 2FJHA 1H3WM 1XGUB 3RKPA 1HHKA 3DETC 1RUPH 3RTQA 2XG4A 1DQDH 2FIRT 2X1OA 3EW3B 2X89A 3LEVL 5GRVK 5AZEL 4LPXA 1PZUB 3BDYH 2SEBA 1ZWIA 3B9VA 3QYCA 4NN6B 4RA0C 5INDB 4UV4L 4N0CC 4K9EC 3VRJB 3TH3T 1HWHB 4U1HA 1J0IA 3VFRB 2VXTH 3G5XB 2FD6H 4QRSA 4LU5L 5GSVB 5JW4N 2XNAB 4QXTB 4NYLB 1DZBA 5KOMC 1WIUA 1D5IL 1FAIL 2VKXA 5FA4B 3DROB 4NYLA 2PN5A 1XH3A 3RQ3A 5GGVH 4Q7DA 4P4KA 3WNKA 1G9NC 1IQDA 1Z5LA 3SY0A 5C3TA 4MSWB 3RVVC 3D0LB 4WHTA 3ZDZF 2OL3A 1HCVA 5I1GL 3AREC 5DMIL 2XKNB 4UI2A 5HGAA 1U8NB 3KS0J 2VJXA 3X13B 2DD8L 5L88H 2HN7A 3KG5A 3MREB 5JPNA 2EEDA 3UO1H 1SQ2N 1DJSA 5GS0C 4LFHG 4YXHL 5ID0A 4JLRA 4L4VD 1A6AB 4O2EB 4DGVL 4JPIB 1QSFE 4OIIH 1BLNB 3ULUC 1A4JA 2JB5H 4RMTA 3BDYL 1IGMH 2JLLA 3HE6D 4XCYB 4CU6A 2E3VA 4Z77B 4QOKB 5DD5H 1NEZB 1MRFH 1QEWB 3UTZA 3KPOA 1RFDL 3X3GL 3QUXA 2XTJB 3W11D 3O8XC 3MCKA 1RJCA 4P2OD 1I4FA 4I2XA 1QLFB 4JGMA 3QQ9D 5DFVC 5F8QC 1RJLB 3KR3H 3QEQD 1H3XA 4PJ5B 3IKKA 2UWEB 2WQRA 5DVLA 3LN5A 3SDYH 4P46A 3WCYA 3VXUA 5E7FA 1WJ3A 4E42A 5T3XE 1IC5H 1HINL 1TVBB 3O9WB 1CE1H 4NKIH 4R4BB 2D9QB 3TZVA 4J6RH 3C5ZA 1R5IB 4F7CA 4HIXH 3H9SD 2EH7H 4K7PH 1DL7H 5JHLL 2R56H 3BZFA 5L2JB 1UACL 3DX6A 3ZTNL 3VFMA 1A4KA 1ODAA 2CLVB 1BFVL 2Z4QB 5DD0L 1ED3B 1R3JA 1S7WA 4PJBB 3U6RA 4GLRH 5C9JB 5T1LB 4I3RL 4JY4A 4I0PB 1FRGL 1U93B 1YEKH 2R2HB 1JWMA 5T1LA 1BQHB 1HH9B 5E08L 2KQNA 2HLAB 5GS3A 4HZLB 4M1DL 1KN2H 1TCRA 4F58L 3G04A 1N5YL 5E94A 1LEGA 2QR0A 1KN4H 5FK9A 1DCLA 5F6HI 1I8IB 1VB9A 1IGIH 1SYVA 2VDKL 4ELKB 1C08A 1UH3A 2EIZB 1GSMA 3MV7E 3PP3K 3H2WA 4LSTH 4GW1B 4WTXA 5HVGB 3NIGE 1JRHI 3W0WD 5ICZA 5IFHL 5IMMB 2MJWA 3OKNB 5E2VH 1CGWA 2HH0H 4PRBA 1D5MB 4MQXD 1MFAH 2ZG1A 2H3NB 4O02H 3I6GB 4E9LA 5CZXC 3SDAA 1AIFA 4LRNL 3OXSB 3MOAL 4ETQA 2DQCL 2GJJA 1KLUB 1NDMA 1LK3H 3MRGB 4LLVB 3VXNB 4HD9A 3U48A 5DMKA 1UB6A 1L7IH 1EAPB 5D6CA 4PRNA 3WFEL 2A83B 2NYYD 4X4XA 3MA9H 4GRWF 4OF5A 3JWOL 5ILTL 3C5SB 4XVUD 3SDXB 3NIFE 4DGYH 1KC5L 2GTWB 4XC3L 4CRPA 5ACLA 4OV5B 3BZEB 3QIUC 3FO9A 3O2WL 1I9IH 3OKEB 4HBQA 2KPNA 3KDMA 5ANME 4JZJB 4WTWA 3MRLA 2LAAA 5HDQL 1ZT4A 3VDAA 2E7LC 2ICCA 4ZFOL 2AV1B 4NRXB 4WUUD 1OARH 3BP5B 3P4LA 5JXEA 3I84A 3VG0H 1QFWH 4HCRH 2Z0BA 4G42A 1A6ZA 2NY2B 4LRIC 5EC2B 1QHPA 1CR9H 2MHAB 4RISL 4FXKA 3LKNA 4JO4L 4LCYB 5CJQL 1S5HB 3VFSA 4OD3L 4Q6IA 3HUJB 1CFTA 3ULVF 3PQYE 1PX4A 5A3ID 5FDWB 1QSVA 5BVPL 2Z8SA 2UVFA 1PG7H 4WGWB 1TJHH 2QHLA 3HLAB 5HHQA 4P3CL 2H6PB 1FYHB 3FCTA 3CFEA 3QFJA 2UUDK 3ZT5A 3CFDB 1RUQH 3HLAA 1E4JA 5E9DB 1C16B 1XF3B 4CL7A 3QUXC 4M48H 1P6FA 4LLMB 3T3MF 6FABL 4XXCA 4L4VA 1FVEB 1JZ5A 4ZD3H 3MV9A 4YHZH 5F44A 5DJ2A 5DT1H 3VXTB 3IFOA 4M5YL 1F3DH 3ET9F 1Y0LB 1E4WH 2EYRB 5SX4I 1Q94B 2YR3A 3D87B 2E7CA 3NABL 2DQIH 4M7KL 5HI4D 2EZ0C 2Y36H 3QNZB 3MJ9H 3FQRA 4XCEA 4Y4FA 4WEBL 3N50A 1AD0B 2O61B 1FORH 4LCWB 2MPAL 4PJBA 3D69B 2J8OA 4MAYA 2AJXH 1HN1A 4UUJA 2MKWA 4JFFD 5DT1L 1QHOA 3UJTH 3O6LH 2QADB 4UUJB 4FTVA 5IROC 3C87A 2JIXA 4R9HA 2VLJA 1K9TA 4GRLD 4PV9B 5F7NC 2P5EE 5EIIB 1J8HE 5KAQG 3WEXB 1FYTD 2O5YL 4NSKA 4CUCA 1FVDA 1K5NA 4Z5RA 1MJ7H 1CYGA 3C2AH 5ENWA 1ZS8A 4U31A 1Q0XH 4O9HH 5IFAL 5IBTL 2YN5A 1WT5A 4QXUL 3GMRB 3BUYA 2C7UA 5T3XD 5CZVL 4JCLA 3GSXB 3BZDA 5K9KA 2X4OB 4PJBE 4TVSa 1RIUL 1MREL 5IWLC 1CGTA 3PP3H 4MHHI 1BZ9A 5F1OB 5D2LE 3FN9A 3GRWH 3PJSA 5AG8A 4WHYG 5C0EB 5DI8A 5TDNA 4MJ6B 5IJVA 3AC0A 5E00A 1I9JL 2ED7A 1R0AH 5FGRA 5IVZA 1KV3A 4YXKL 3VRLE 4N9OB 4DAGL 1RMFH 1P7QB 4LASL 3NTCH 3CSPA 3CUPA 5FYKE 2XZCL 3D18A 3AM8A 4HK3J 3IU4L 3MZTA 4DGIH 1A47A 1JE6A 2VDOL 2WW8A 1EUTA 1K2DB 2Y5TA 4M7LT 3ZHLA 4ZYKB 2VIRA 5F9WB 1CD8A 2HFFA 3SDAD 5D71L 2QSVA 1SJEB 4L4VE 1B0WA 3D39D 5CGMA 4XT1C 4D0BB 3VU2A 3BQUB 4I0KA 5DVNA 5C08D 1M1SA 5EOCJ 5BOPA 1P84J 1DL7L 4XP5H 1CGXA 1B0GA 2OK0H 1RIHL 5MERA 4JO2H 4KMLB 2ITCB 3JWOH 4LBEB 2W9EL 3FB6B 4LOUD 3EYSH 1MAJA 1QZ1A 2XN9B 2XNAA 3MACL 3H9SE 4PJHF 1Q9KB 1JGVL 1WBYA 4U49A 1D6VH 2XXCB 3M17A 4G8EA 2WBJD 4LCCA 3B3IB 4Y5YA 5K93A 4KVNH 5F9OL 4AM0A 1BX2B 1YNKL 2H1PH 4KV5E 4N0FA 3T04D 1C5BH 2NY2D 2AEIT 2JCCE 1IL1A 5ISZA 1RURH 5CMAA 3FTGA 1OGAB 5C0DB 2H26A 2ZUQC 1G6RA 3CDCA 4X83A 4KTEH 1FQ9C 3VCLA 2VDNL 1KG0A 3MNZB 1F02I 4TOYL 2V6HA 4XCNA 3QJHA 3U30B 3F7RA 2GW5A 3PWUA 3S4SA 3EJZD 4GBXD 3ALPA 3SGKC 5EPMA 4NZTL 3VFTA 2XQBH 1KTLA 2VQUA 3G5ZB 1RK0A 1ZA3A 1A9BB 2F58L 1KXVC 4KVNL 5F9OH 1FGVH 1NCUA 3DVFA 4WDIB 35C8H 3HC0A 5DWUH 1T1ZA 2OCFD 2IADA 2B2XH 4JVUA 4MJ2A 1IGML 5DLMH 3BO8B 1VACB 2BRQA 5C92A 5GISL 1ZAGA 4XP4L 4OKVA 4LMQE 3VGFA 4EI5C 3S4SG 4KY1H 3FFCB 3KWWA 2E9IA 1DN0B 1M6OA 1DQQB 1LILA 5GGSA 2NNAB 5C09B 2OR8A 3G9AB 4M61A 4HK0A 3FB7A 5FGCB 2J8UF 4FQHB 4JQIH 3ARDC 1DANU 4RQQB 2NNAA 1UWEH 3OGOE 1XR9B 1FIEA 3QO0B 5C0BB 3L1OL 1AGDB 1UEYA 5DRNA 4F7EB 1INEL 2WWKT 4X8JB 2XV6B 4MMXC 4L8BA 2PCPB 3IAPA 3QZWB 4NHUB 3CD4A 2C3XA 5GGVY 3LEVH 2PYEE 4WJ5A 3PL6C 2CRMA 1UKQA 1NGPL 2Z31C 1F00I 4Z7WB 2UZXB 4JN1H 2FNBA 2IALB 4S0SD 3OAUH 4A2MA 2B4CH 2W0FA 5HHNA 4UDUB 4YPJA 3G6JB 3ILPA 4U1JB 2I07B 2HTKD 4YHMH 2VC2L 5I1LB 2Y5TB 4NC2B 3SHSA 3MLXH 1NANI 1PYWA 1NBYB 4LSUL 3BGFB 4NJAH 1OTUC 3UYPA 3MRPB 4WV1C 1P4BH 2FLRT 5D1XA 1YECH 3LEYL 2BFVL 4GQPH 5FHAL 5KS9E 1XCTB 2BY1A 3IVKA 3ESVF 4MNQD 2JCCB 2BP3A 2FL5B 5B38B 3NFNA 4ZFGH 2YPVL 4YR6A 3IDJB 4Y16B 3PIQA 2H2PD 4FFYL 1A1MA 1IAII 1U8IB 5F9AC 5GSRB 5JW4R 3OPZL 1RZ8A 4MB3A 4WV1B 4PJCE 1AR1D 1TPXC 1UB6B 4HZLA 1V3JA 5BS0B 4LSTL 4LEXH 5JIIA 2H8PB 3HG1B 5FFLA 2ERJB 3SY0B 4C54A 4WO4C 1A14L 1VERA 1V3KA 4APQD 2HJLA 3QXWA 1P9MC 5IOPB 4JG0L 1XGYH 4MXQC 4IMLA 4UT6H 1ZMYA 1KC5H 1A7QL 4XC3H 5K59F 5HGAB 2VL5B 4KK6D 4OUUA 3L5JA 4PRBB 3PWVA 4H25B 4WHYH 4XNXH 5GHWL 5H94B 3C8DA 4R90H 4FS0A 1DDHA 3VXQA 4PJAE 1WAAA 2ZCKH 3TVMC 4CVUA 1IC7L 1NFDE 1ORQB 2NR6D 4MA7H 1G7PA 1EJOL 4JRYA 4G5ZH 3B9AA 2C1OB 2XZQH 5TQ2L 1BJMA 4P2RB 2Z9TA 4LSVL 3GHEH 4UTBL 2R4RH 1HCFX 5E4EB 5CBAA 2DQUL 4I3SH 1H5BC 1QSEE 1LD9A 1T0MA 3VI3F 4EUPH 4XMKH 1G9EA 5SV4A 4B5EA 4ODWA 1T2JA 4Z18A 1ZLWH 4P2QB 4XMLL 5GZOC 2W59A 1OB1B 3CSBA 4BKLB 3MCKB 2EDRA 2YD7A 4NN5C 4Q9BA 1EGJH 1JPGB 4F15C 4JFPA 4X99B 1NAMB 3MLPA 1JWSB 4KROD 5IB2A 3V4UL 2C4FU 4PGDA 1NC2D 1W0WA 1HEZA 2GJ6B 4KJQD 4I18C 5F71A 4ODXA 1RIVL 2BOBA 1W0WB 3GSNL 1CU4H 3FB5B 4FFZH 2A6DB 2AKRB 3QBTB 1QVOB 1EO8H 1OP9A 5C0IB 1NUFA 2R23A 4DGYL 1HSBA 3ARSA 3FAXA 4G43B 5L2JA 4NC1E 3MSPA 4FZEL 4AEIL 4TSBH 2VO5A 2VDQH 4K07A 3BHBA 5HY9B 4UINL 1LE5A 3MLRL 5HHME 5ICXA 3QDGB 4Y89A 3TA3B 1GGYA 4HUWA 3DUUA 2CO6B 1DANT 1AY1H 4ZOBA 1NEUA 4HUWB 3EYVA 5MP6H 4K3EL 3B8SA 5LAXA 2AXGB 1B0RB 1GC1H 4QHMA 2F53A 5FO7B 4OBRA 3IFLH 4R0LC 3SDCB 3SKMA 5FA3B 5EZOH 2X9YA 3BT2L 1CDCA 1QKZH 1LK3L 3WIHA 4UIKL 1BEYH 2W07A 2YD1A 5E24E 3MROA 1KTDA 5ESAB 3HCVA 2R1WA 1AH1A 3O3UN 2GHWB 1UB5A 1RQ5A 5GS1A 1UH4A 5I1KL 2X42A 3TBYA 1IQWH 5F7KC 3QNXA 3W82A 1YJDL 3B9KA 1CDBA 2ADFH 2RBLA 4H26A 5E2UL 4FOMA 3GSXA 2R9HD 1JWUA 1HH6A 2X4QB 4OGAC 3RI5K 1EAPA 5D6CB 4M43H 2W0PA 5GS1C 1BBDH 1HQRB 3O6KH 5MEPB 4QRSB 4FTVD 1KN2L 4H8WL 2ADIA 1HQ4B 1RVFH 4ZS7H 4CDGC 1TMCB 4MJ6A 2DMKA 1XZ0A 4NQDA 4K3DL 4FZEH 5E8OA 4TPRL 4AEIH 1OSZB 4YHPB 4KHTL 2H41A 4F37K 1LO3L 1U8MB 5HYSB 5IBLD 3IDIA 3ZE2F 4DN4H 1AY1L 5TH2A 5E8EA 3GSWA 1FNSH 1VCAA 2E7HA 3PGFH 2B5IC 3BFOA 4WU5B 3MV9E 2APFA 4PS4L 5GRUH 4UINH 1UM5H 5IB4A 4P3DA 2BNUA 1JPFB 5IG7A 3MRRA 3OJDB 1CGSL 1FL6A 2YA0A 5FOBA 3TPUB 4DFIA 1WWWX 4LCYA 3TVMD 2ZOLA 4PJIA 4PRIE 2DBJA 3P4NB 3C2SA 4M3KB 2LAGB 4JZJA 3LD8C 1K8DB 2BC4B 1I9RH 4PJGE 4XNUL 2W91A 2CRIA 1YQVL 2J4WH 4EUPB 5I71C 2FIKA 4R26H 4JRWA 3I02A 1A3LH 1TTFA 3N0PB 1R3LA 3EO9H 4KQ3L 4X6DF 1UM5L 3UTPE 5BVJA 3STLB 3FCTB 5A2JH 4G8IA 1LEIB 4S2SB 1J8HA 4QGTA 1QFPA 2JJVA 5GJSH 3TF7C 2X4TB 4WHDA 2G60H 3DV6B 4PRHA 4Q0XH 3KAAA 4YHNB 3U7WH 2X4SA 3D5OF 4LHJB 2EYRA 4J3WA 1DEEB 3KPSE 4ZXBC 4OI8A 3QCVH 4BSVA 3OJMB 5KSVB 3HMWL 4JY6A 4LSVH 1JI2A 3GI8L 1F90L 5T3ZH 2L0DA 1M71B 2CLZA 2AJSL 4RZCA 1OF2A 2E9JA 3FB6A 5C2BH 3WFBH 4Z78A 1W72A 3W9DA 1N6QH 4XPHH 2CO7B 5F7EH 4ONOA 2OSLA 1TQBB 4PJCB 4U1SA 3RWJA 2KDGA 4LIQE 3IETA 2H6PA 5IB1B 1ZA3B 4JKPL 1G7QA 1EDQA 1F2QA 4PYGA 5EWIH 5E03A 2ADJA 3RWEA 1WK0A 1R3JB 1S7WB 4HWZA 2C3HA 2J88H 1M7DB 4PJCF 4X7SL 1YEEH 4ZTPH 5LGJA 4JY4B 3SE9L 4AENB 4BZYA 3MNWA 1C1EH 1NGQH 2UWEE 1A3RH 4RFEB 3MNWB 5ITFB 2R0ZH 3DYPA 1J0YA 2G5RA 3F58L 2DWEA 2A1WL 5AD0A 1KGCE 2LFGA 1CS6A 3WIFA 1JPSL 1MI5D 3BKYH 4K3HA 2D4FA 3K2MC 2F53E 1TQCB 3TBSB 4HS6A 5DJCB 3CSYB 4L8DA 1WBZA 4NQDE 3QQ4B 2EKJA 3VG9C 2QKIA 5IMLA 3VD3A 4TUKH 5L0QC 5FGBC 3FQUA 5GZND 1CLOH 4ONFH 4PJ7B 4PRDA 5I8EB 2Q8AL 2FYYA 3O3EB 2CIKB 1EFXB 2EDDA 2Z92B 1LP9A 4XAKD 2WNGA 1HDMA 3BXNB 5DFWH 2A83A 1CVSC 1P7QD 3GSQB 4ZDHB 1RHHA 2O5ZL 1Q9OB 1WISA 2AEQH 5I1AB 1I7UA 3FRUA 5DDHA 3BKYL 4DVBA 1FL5B 4JJ5A 3N1PC 4K9EL 3IDUA 1E6OL 1I7UB 3FRUB 4KUCF 3DIFA 3U7YL 3NACL 4ZO7A 2DQEH 1NCAH 4FNLH 5T1MA 1KCVL 1P2CB 2DKSA 2ZJSH 4UU9A 5IMKA 5IHUH 3VXRA 3FFCD 4U1KA 4JPWH 3TA3C 1YEGH 4GAJH 3T3PF 2FO4A 3ZE2E 4H0HB 1A7BA 4R2GD 4M02A 3MR9B 3QP3A 4NUJA 5D7SH 3VXOA 1EAJA 4KRPC 4HUMB 2VH5H 4QHUB 4RFOL 5KBNC 4JQXA 4PJEE 3T4AA 3V0AC 2HRLA 2AJZA 4ZPTB 1YEFL 1I8KA 2QQKL 4OT1L 1GOGA 5DJYA 4FFYH 4LK4A 4MD5B 1OPGH 1K4CA 2AGJH 5GZNC 1J9CT 4IHOA 1RAMA 5J3HC 4KKNA 4U6HA 3SQOL 1F4HA 5FAAA 1MRCL 5I1LA 1TETL 3HS0A 4HW6A 3GSUA 3CFKA 4X9BA 2PTTB 4NC1C 3UZQA 4DCQB 4D0BA 5INDA 3BIBX 1QBBA 3QCTH 3VFRA 1MY5A 1KPRA 4WU7B 4Z0BL 2DI9A 4PTUA 5DRXA 1ZLSL 4BSWA 3QG7H 4U33A 2H2PC 3EO0A 4QYOA 2R2CA 2YD3A 3VXTA 4I77L 3ARUA 4J4PA 3K1DA 4RZCB 1F5WA 5I74C 5JW3L 1RZJH 1Z9SA 2HFEB 1AGCA 3CVHL 2VLJD 4GRLA 3S88H 1KJ3L 1AD9B 3UC0H 4PRAB 4TPRH 3QDJE 2YXMA 3KPMB 2BSSB 3T2OA 1P4BL 4CMHC 3UTSB 1GGCH 5CEXB 1UXWA 1FAKT 2RHEA 4JFFE 1XCQB 5C6WH 4WO4B 2EDXA 2V9TA 5DZNA 2Y06L 5CD3B 5D7LB 1KXTB 1KIRB 4XX1G 5E6IB 3S35X 5I1GH 1A7NH 1TPXB 4Z0XA 5SX4H 3DMMD 3RNQB 5TDOA 3GSOB 4P2RA 4LSPL 4G6AD 1IT9H 3GI9H 4OSUL 1BIHA 2LVCA 3KYKL 3CSYA 5TF0A 3KPLA 3ROOB 1U3YA 5KOVC 2P7TB 1P1ZA 3L3IA 1CU4L 3WFCH 3DUSA 3QRFM 5J9PA 4PJHB 4KI5E 2WLYA 5D2LF 4BZ2H 1G9NL 1TJGL 2I27N 3QUYB 5HYJB 1LO4L 1X3DA 2J88L 4OD1H 3BXNA 4ELME 1V3LA 4XP4H 2PXYA 5EBGA 3ALWA 2IMMA 1CI5A 5AZEH 3AFLA 3GMLA 4B53A 1IAOB 3FHAA 5FKPB 4NDMB 4PG2A 1P6AB 4NM8H 4HK0B 3S97C 2FX9H 2B1HL 4PB0H 5EN2A 5HPOA 5I0ZA 3O6FC 2X70B 4HZAA 3WUZA 4M6NH 5EZOL 2JKXA 2CKBA 3RWCB 4NRZA 2EC8A 1NAMH 1IGJB 3KLHC 3PV7A 4JAMB 3UYOD 3QUZB 3ARFA 4XCEB 5EUKB 4X6BB 5TGBA 4UNVA 3IJHB 3NFPA 3W9EA 5DMGD 4XPGH 3U79A 3BJ91 4WJ5B 5EZIL 2HWZH 4GQ9L 5HHOB 3KGRA 2P5EB 4G9FD 4X6DA 2MHAA 4LHUB 3BQUA 3ZYZA 4K7PX 1D9KB 3BKCH 3S96A 5DUPH 2FDBP 5EOQL 4XC1L 3X14A 3DXAA 1WCQA 4NRYB 2PO6C 3TO4A 3V5KA 3RVXC 3PP4H 2EYTA 3C09C 5I6XC 1RUQL 4PJIF 4NQUA 4P2RE 3V5KB 3R1GL 1XZ0B 3WHE0 5ITBH 2J12B 25C8L 3M1BB 1JYNA 3NBNA 4EBQH 5SWZB 3S7GA 2L7UA 4Z8FH 4MXVF 3S37H 4KK8D 2VLKA 4JFFA 5L7XH 5TE4L 4WFEE 3U4EB 4WU7A 1WWAX 4FQXA 3WD5H 5IQ7H 5DK0B 5HHPB 3ZSTA 3QWQB 5AZ2H 3TIEB 4IJ3C 4QXGL 3O41A 1U8KA 3PJSB 4ELMB 1HSAA 2VDNH 4JO1L 5GGQH 4X5XA 3PP4L 4NIKB 3SJVE 5C0EA 1YY8B 1UQSB 2YBRB 3DV4A 4MDIA 1ZT1A 5IT2H 3MBXL 4Y5VC 2OI9B 3CVHB 1EXUB 2GTWA 5KVDL 3UTSE 4NQCE 5C2UB 3RVWC 4WW2A 3JWDC 3ZZ1A 4PJFA 4ZOAA 5C1MB 2VZOA 3GMMA 2BY0A 5DJXA 1F3JB 1IKNA 3EDEA 3CMOL 4YHOL 1I8MA 5IVXA 2OTUA 3T0EE 2I24N 4Y4KA 1MEXL 5HBBA 1BD2D 3ARXA 1MLCA 3HAEH 3F7VB 5H35A 5A2LH 4EDWH 3CDYA 4F7MB 3BYTA 3MBXH 1HE7A 2P5WA 4HWNA 1PKOA 4N8VG 4W68A 1FO0H 3RIAF 3EOTH 4OLVL 3LN5B 5E5RB 2QHRL 3K80A 1W2KT 2P8LB 3E8UL 2ARJA 2EKSA 5J6GB 2AXFA 2A9NH 4LU5H 1IKFH 3QDMD 3BP7A 5J8OA 3BH8A 5D71H 3UP1A 2GT9B 2HJFA 1LE5B 5C0BE 3QO0A 3NVQA 5FO9B 3NAAH 4O5LL 3F5WB 5F9WC 4TVPE 5INCB 2X41A 43CAB 3FONB 5E00B 1ED3A 1CICD 3L3KA 3IS0X 5EO0A 1B0RA 4QRRB 2W65B 1OD9A 4L8SB 1MRCH 1U58A 3UBXA 4WWID 5AZ2L 5CGTA 1YN6A 2HLAA 3MRBA 2Z8RA 4M9OA 4TUJB 1PG7X 5IKCB 4JPVH 5D1QC 3LN9A 3VE0A 4M93C 4Y1AD 1G7LB 4Q9RH 1TVBA 3O9WA 4R4BA 2YD9A 3I9GL 3EKCA 3GMPB 2B1AL 2EICA 4LPCA 3RHWK 3TBYB 1JBJA 1VFUA 1TZIB 4HPYH 3MV7B 4FQQA 4QHNB 1UZ8A 2FZ3A 1A5FH 3MOBH 3I3EA 1SY6A 4WCYH 4CN4A 5EIQA 4AMKL 3MRFA 1PBYA 2Q20A 4NQEA 5D96C 3VW3H 1MRFL 1Z9LA 3BMWA 1K3IA 4NNPL 1F97A 5B38G 2XTLA 3MROB 2MKLC 2IC2A 1JMZA 5J12B 1MUJA 1R5WB 3MFFB 1BBJB 3L7FA 3C6SA 4DVBB 4LDLB 5AD0B 5ISZE 4M1CC 3D25A 4GW1A 4YUEL 1M6OB 4D9RE 3RL2A 4UT7H 1UJ3C 1G6RL 1MHHB 3T0BA 5GJTH 2FWOB 3MLYH 4YBQC 2X4OA 2ZZUT 4NQSA 4P23C 1MHHA 5CJOH 3HE6C 4X9IA 4C58B 1WAAF 2BHUA 3F7QA 2VZVA 2ICES 1UGNA 4PJAF 5FB8B 1B90A 4KU1A 4LIQL 1IGCH 1FE8H 4MWFB 1QYGL 4PG9B 1V5JA 4IMKA 1WVZA 1KEGL 1NJ9A 4UT6L 4F8TA 4F57L 2OXGA 2CR3A 3G6DH 1RHFA 4LCWD 4OZFB 4X80L 8FABA 4J8RB 1HHHA 4JREC 2BSED 1YDPB 3QUXB 3ZTJH 1J0ZA 4FG6D 1Q1JH 4L4TD 2VIRB 2B1AH 1N4XL 5GS0L 1T3FA 1IFHH 2HG5A 4X6CA 3VXRD 4FMFA 3MLUH 5D93C 1HHJA 5MEQA 5I1DA 3PWPA 5IG7B 4XVUC 3LIZH 3OJDA 2P5WB 3MGAA 1NDGB 4F9PA 15C8H 1PQZB 4WEUD 3TNMA 5D7JB 4D0CA 2AJYL 3RGVB 1NMAL 3T1FA 1MHEA 1PD6A 2HLFD 1YEHH 4B7IA 1Y0LA 1YEEL 4FQHA 2A38A 4RQQA 1MCBA 4QRPA 3L95B 5IUSA 2IH3A 4QEGA 2BNQE 3TO2B 4HEPG 4OLWH 5ICYA 2VLRD 3CU1A 5JNYB 1IGFH 4DZBA 3O3BA 4OTXH 1MJUH 3MJGX 1N64H 2AEPL 1CDIA 1EO5A 2NX5B 3IXTB 4HJ0D 4K55A 3MRMA 4OLZH 3SKNA 4AT6A 3M8OL 4Z7VB 3VXME 1SJVA 4JZNB 4P5MB 5KSAA 1G84A 1VFAB 3WL9B 4C55A 4ORZC 3LN4A 1LO0H 1M7DA 4PRAA 3BYYA 4Y5XA 4OF3A 1ZANH 3UC0L 5FDYA 1AI1H 5F6IB 1ZV5A 4PRHE 4QT5A 1HZHH 2OJEB 1RY7B 1MCRA 4OLYH 1TVDA 3GUTA 1FO0A 4MD4A 1XGQB 3HI5L 3JV4A 1EHNA 2VISA 4OCLC 4LKCB 2QL1A 4LHUG 3DRTB 4GKZB 3WIHL 5KN5A 4Z7WF 1MFDH 3MV01 3I2CH 5IBUB 1V3MA 5D9SB 3VWJA 3DSFH 4YQXH 1JYVA 1DQML 3SCMB 1KTDB 1V7MH 1AQDB 3CZFA 1VEMA 4Y19A 2XKSA 1Q38A 4U4BA 3IAQA 4PJ9C 5DD3L 3K4DA 1I9JH 5BMFL 2F5BH 3NIGF 5I76A 5HDBF 2R2BA 3WFDL 5HYQA 3RZCA 5TFSH 3MBED 5IHBA 1NLDL 1AHWB 5BRZB 1WZMA 5D2NC 4Z6AT 3D39A 3GBNL 1FFNA 1XGRA 1AGEB 2J6EA 2BMKB 2H8PA 3OSKA 1PG7L 5JTWA 4KHXH 4TYUA 1RZKC 2FX8H 2Y1VA 4KJWD 2WK2A 3WKNA 3L7FB 2YPLB 1GGTA 4MNGE 4MJ4A 3DO7A 5L2KB 4OUOA 2VXUH 4NWUH 4OIBA 4OT1H 5C0IA 5L2KA 2D7PA 4OF7A 2R2EB 4BA8A 4C83A 4JHZA 4MQ7A 4GT7A 1T66D 3SGEH 1NCCH 4IIQC 3N1GC 5JHDB 4C57C 2M26A 2A77L 3GZKA 4XNMB 5LGHL 2JJSC 3QUZA 3DTXA 3MGTA 2Q86A 4YGVB 4GRWB 3W0WA 5EBLB 5T5NF 3RDTC 3HNSH 2X4NA 1RVFL 2ZUUA 3QWOA 4NQCD 1MCFA 1YEKL 4ZS7L 3W39A 3I2CL 1FORL 1S7SB 3UCRA 5EZIH 3TYFB 3D2UB 1FL5A 4MD5A 1EEQA 1D9KA 4XPGL 3S96B 5KVGH 1NCWL 4YC2B 4IHOB 3V7AE 3PGFL 2ATKB 3DSNA 3I3BA 2EH8H 4NRYA 3IGAA 3AROA 4K9EH 3HHRB 1RU9H 4LCCC 5C71A 4LMQI 4X4ZA 1QLRB 4JPVL 5AYUH 1MPAH 1UXSA 3JVGA 3O8XB 1HNGA 2EIDA 4Y2OA 4MZ3A 5C0CE 2NY6C 1T7WA 1CFVL 2GJ6A 2AJ3B 3ROLB 2WIMA 1KCUL 5K9JL 4PBWD 3H42H 5DO2D 1KEMH 4OF0A 3TJEL 3IFLL 3ILQD 5DQJB 3CAFA 4PJ7F 4UV4H 3F7YB 3CZJA 1CTOA 2P5ED 3ARRA 4G9FB 4P2CG 4IRJD 4RMUA 4POYA 2ESVD 1KELL 2ZUVA 4H1LB 4M5ZH 5C0BD 4U05A 1IGTA 4PRIB 1J0JA 1MFBH 2GYSA 3FFDB 3D2UD 4WY7L 4AIXA 5I1KH 2JB6B 4XP1H 2JF1A 1MIML 4ONHB 2Q87A 4BUHA 4O58H 1D5ZB 4OV6F 4P2QE 5CSGA 4OSUH 4NOBA 4U1LA 5AUMA 5HGGS 5EWIL 2AJUH 3HB3C 3E2HC 3IT8D 1EA9C 4L8CA 1HYRC 5D7LD 4ISVB 3QCTL 3F65A 3BISA 1AGFA 2IEPA 3CX2A 4Y4KB 1H9VA 3MRIA 3K4ZA 1U8QB 4HUKB 2XZAH 4RSVA 5DURD 4ELMA 3VMPA 2FGWH 5I66B 2BDNH 2HT2D 2EDBA 5JUEL 2H32B 4P5TA 5JQHC 4WI9A 5DEGB 3BUYB 1BAFH 1OLZA 1D5BB 3P4NA 3JTTA 4BQ9A 3QG6B 1DBML 3FB7B 4NN6C 5GGSY 4MXQD 4F8QA 1GHFH 4OCXH 1UACH 4APQC 5M7QA 1HK6A 4JRYD 1J12A 3RWHB 4UZGA 3EYUL 2IADB 2E8YA 2YWYA 4I48B 5HYJE 1PY9A 1IZKA 3I85A 4PV9A 1MHPL 5FCUH 4M6AA 4HGWA 3GMLB 5D7IE 2ZWLT 5CJXC 4QRRA 3RFZC 2W9LA 3OKMA 1DQLH 3HR5B 4YHPA 1EV2E 1FDLH 3BSZL 4ZUWB 2VABB 3TCLA 5HYSA 1I9RL 3FMGH 3ULUH 4KTEL 1U92B 1DN0A 1FNSL 4UV7H 3PHSA 4C4KT 1BFOA 4M61B 2I07A 1X5ZA 1K3ZA 3QDMA 4V1DE 2AAVA 3WXWL 3F8UB 3MV8A 3R0NA 4YZFF 4YHZL 4KGLA 4FP8H 4KJWC 5FIEA 4HPYL 1P7KB 5D5MA 4ZAKB 3UZEA 3P9WB 1DQLL 4PGBB 3E2HB 4K2UH 2MQ3A 3ZE0F 1L9NA 3X12B 1BQLH 2MOVA 2P46B 2Q8BL 4G8GA 4J3TA 5CBEB 1EHLH 2BC4A 1I1AC 1I7RA 1NGZB 5DUML 2LU3A 3MXVL 4L4JA 1X5JA 5IM7A 5JHDD 2D0HA 2ORBH 4PR5A 4K94H 1CE6A 1ACYL 5DRZA 3EGSA 1YC8A 1OWWA 1OAXL 3QB7C 3EGSB 1O0VA 3FT4B 3TJHC 4H26B 2NCMA 2BNRA 1IARB 2GK0B 3RVUC 3IAGC 2FZ3B 3OR7A 3KNBB 4Z95H 4K8RL 4U0RB 5DHVH 4UQ2A 2FJFA 5ALCL 5IW1B 1UWEL 3RPIA 3LEXA 4Z7WE 1MHPH 2Y6SD 1D7FA 4NNXB 4KJQC 5DS8A 5DXWA 2VR4A 3VI4E 1UENA 1GOFA 1Z5LB 2VR5A 1A9BA 5JDJA 3BIKA 3IDGA 3QI9C 5FA4A 1QFUL 5CSBA 5DHVB 3PWJB 3HC3L 3QT2A 5FYKU 1KCKA 5TE7L 3OKEA 3FO1A 3FT3B 5GZOD 1ZSDB 2OMBA 3QI9D 5HI4C 3WUWB 4U1KB 2CPCA 2HN7B 3IDNA 1MFEH 3X3FL 1T7XA 3MLTB 3TV3H 5DUMH 5IGXL 2VXTL 2YBRA 3AMKA 3DV4B 5IIEA 2OXHA 3VFGL 4BK4A 2LTQC 1Q8MA 2BVOA 4WW2F 1B88A 5F9JB 4LCIL 3L5WB 5LGHH 3G5ZA 3OAUL 3DECA 1N4XH 2VITA 5F88B 3VFSB 1F13A 4GS7C 2DTML 4Y2DD 3RL1B 3MXWH 3W2DL 1HHHB 4RNRB 3ARGB 5E7BA 4YFLI 4M03A 3KPRD 1YY9C 5HTSA 3FO0H 3HS0B 4CU8A 5DK3A 4ZFFA 4BQCA 4JG0H 5INCA 4JFPB 5E95B 3SEPA 2A74A 2V17L 5IVOA 1IM3B 2A73B 4GSDL 3PWPD 4GOSA 3TT3L 5CGYD 3V7AG 1E6JL 1FYTA 2A9MH 4FQCH 4KJPC 1A9EB 1KPVB 2A6DA 2VUOA 5J57B 1OY3B 1S8DA 4XHJD 5E8NB 5TQ2H 5EU3A 1KBGH 2H1PL 4UOJA 1DN2A 3VH8B 3K3QA 2CGRL 5HHMD 4CW1A 4JM2A 3EJYC 3NFSH 1LDPL 1G7QB 2VWEC 5C9JA 3U6RB 2VZ3A 3BPCB 3UX9B 4EOWL 2CDGA 1KYOK 2FX7H 2QQLH 4ZUTB 3FKUS 3MQIA 4NO5B 4XNXL 4P46C 1A6UL 1I3GH 1A2YA 4GBXB 1GAFH 2B0SL 1Y18B 5FGCE 5EBWA 4WO4A 3CXDL 1XGRB 3QIWA 3BN9D 4PRPE 2BY2A 3MBEC 1SYVB 4PJ8D 1NLDH 3ALXA 1JI1A 4UTAH 5BXFA 3FB8A 2IG2L 2KZ1B 5F7MC 5C9KA 5I8OH 4MA3B 3GGWA 5GRJH 1SHMA 4BFIA 1XEDA 1UADC 3MC0A 4OAWA 4Z5RB 4RGOL 1AFVL 3WS6A 1DDHB 5JUEH 4W6XB 2P7TA 3MOBL 1A7OL 1OSPH 3S98A 1UYWL 4V1DD 1LEKA 1LO0L 5T1KB 2A2QT 4OM1H 4P4KD 3O4OB 1DQJB 4RBPH 1AO7E 3NMEA 5D70L 5EBLA 1CICC 5JPMA 2AK4E 3QWOB 4R4ND 5FOBB 3QPQC 3BGMA 1SYSA 2DMCA 1A7PL 2AW2A 5DC0A 1RIUH 3VJ6B 4JRXD 1GRWA 3P9MB 2RAMA 4RGND 3FZUD 5DJDA 2D03L 3MLYL 1GGIL 3MV9D 2YRPA 3OHXB 3HNTH 1R3LB 1V8HA 3BT2H 1JF1A 3VXSA 1TENA 5BVJB 2IAMD 1FZOA 3AVEA 4ORGB 3GNML 3LKOB 4JN2B 1KJ2A 3JBG7 2VZSA 3O45A 4X6CE 4JLRB 4HPOH 3HAEB 3ZDXF 5EU7E 5A40E 1X5AA 7FABH 3L5WA 1MY7A 4IOFD 3PQYB 4AEFA 2OL3H 4LLWB 1GIGL 4GRMB 4HMCA 1UJ3B 5C0FB 2V7NA 1T2QL 3EOYG 3QQ9C 3HG1E 1IM9D 4HBCL 1TFHA 3F7YA 4QXWA 4XTRD 1YEIH 4XBPB 4GRWH 4HDIA 5SV3A 3CPLA 3QEQA 4H5SB 4YWGH 2EDLA 2HG5B 3X17A 4X6CB 3PWNB 3NA4A 3QEQB 1HHJB 1MEXH 1JWSA 1DLHA 2EO9A 2VSDA 3G08A 2YKLL 3SGJC 1OOAA 1QQDA 4GXVL 4LNVA 5EO9A 1GGBH 5SWZA 2I9TB 1QRNA 4JFEA 1C8PA 1PSKL 2IF7A 3MLSH 4HWZB 3SQOH 2W9EH 4R8WL 2EIEA 3EOBA 4Z7OF 2F15A 4HBCH 3EOBB 3IRZA 3Q6GL 5TJWK 1YN6B 2LTQB 4BFGA 5I8CB 4JCMA 4Y2DB 5C0RH 3DYOA 4XP9L 2NY7H 5C7XH 1DBAL 2MPAH 1GVIA 2I9LA 1NGXA 2YC1B 3EYFA 3BZFB 4LF3A 1OF2B 2F9BT 4R90L 2DL9A 1ORSA 5CUSH 4Z7VA 5IVNA 3DUUB 2PW2B 2JB6A 4GAGH 3TBSA 2X4PB 4NQEE 2EE2A 3N9GH 4HLZG 3UTSA 5D2LB 1KCLA 1U93A 3B2UC 1REIA 4XC1H 1TZHB 4PRDB 5I8EA 1WFTA 2APTA 3RY4A 3MV8E 2J3SA 1JNLL 4Z7UA 3PHQB 1H15B 3P11H 1AGFB 3VFUB 3QCUH 3FQNA 4NBZB 4JVWA 4Z0XB 1NFDB 1JFQH 3NH7L 3X11B 5EC1B 4F3FA 2J8HA 3OJ2C 3SE3C 3HZYB 3NIFF 4LKXA 3DOSA 5DHYB 2FH8A 3GRWL 1VADA 3TV3L 4CVZA 4NN7B 1N0XL 1RSFA 1NSNH 1RI8A 3DIFB 3CMOH 5SWQA 5F7YC 1F3RB 4F2MB 2MFNA 4G6KL 4S1RL 1T83A 4PJHA 2IQ9L 1E4KC 1LEKB 4PJXE 1MH5B 1R3KB 4X98A 1ZA6B 1NCBH 1JV5A 4U6VL 3QDGD 3F12A 1U36A 4JHWL 1G9MC 1FPTL 4N5ED 3S5LB 4OZGB 3OF6D 1P7KA 3U36B 4MZ2A 2AQ1A 3ORJA 4GKNA 4G8GE 4F7TB 1FAIH 4O00A 2A9NL 5F8RC 4X9FA 1QSEA 3IU4H 4EXKA 1S9XB 4KRNA 4WENB 4NKMA 4JFDD 1IEAB 4NT6A 3GBMH 4S10A 1NGWB 3TA3D 5DZOA 3VXUD 1IEAA 1RZ7L 2P5WE 3MA7A 2VLLB 3ZKSD 4LP5A 1AO7D 2VLRB 2VUYA 3L9RA 2BNUB 2DLIA 5T5FL 2EZ0D 4Y4HC 1VGKA 4M7LL 1RIHH 1C7TA 2J2ZA 2G5BB 4LEOA 1C5DB 1AR1C 1KGCD 4TTDD 2GK0A 3TT1H 4ERSL 3RGHA 2WUBL 3H9HB 1NMAH 3RWIB 4DUWA 1CBVH 1Q9WA 5D7JA 3FOMB 1KT2A 2RJMA 3H9HA 3RWIA 3CFJA 4PD4J 4PJ5D 4POUB 4HAGA 3U4AA 2DLGA 2UZIH 4HKJA 1RZ8B 1J1OL 3JXAA 4XAWH 5I1EL 4OLWL 2ZSVA 6CGTA 1DVFB 4N0UA 3QHFH 4KAQL 4V2CB 3DI3B 4HIEB 3SE4A 3VWKB 4AL8L 3ULUF 5AUMB 3C8KA 4UTAL 1N0XH 2AJYH 1AKJA 1BVKB 1F11B 3P30H 2C5DC 1C16A 2WBJA 2VL5A 4LLMA 4X7TB 1I9EA 4KJPD 4QWWC 1B9ZA 1BJ1H 4N1EA 1KCVH 2ZJSL 1F6AB 3VRJA 2CH8A 5ISZB 3LV3A 3J8F7 3EOAB 5F6HJ 2DQHL 2X7LB 1CK0L 2NXYD 4I0CC 4ODBD 3C6LD 1Z0MA 5DD1L 2NTSP 4N9GB 3NABH 3QG6A 3ZDYF 1HXMB 4WCYL 1KIQB 3EBAA 2GITA 5DVKA 4M9PA 4XCYA 3ZE1F 5ADPL 3QDJD 4J6RL 5DHVA 1XFPA 5BRZE 4HWEH 1RZGB 1TJIL 1QPPA 4QY8A 2XY1A 4MA7L 1CBVL 1T1ZB 2X5PA 4Z7UB 4Y0GA 1QLFA 1CN4A 1J1OH 3FQNB 2JK5B 1CFSA 2DWEB 2DS4A 3E0GA 3L3JB 5CILH 5GGVL 1G6RH 1KJMA 1MUJB 1R5WA 5E6IA 4EI6B 2KUTA 2GSIB 1WQVT 3VDBA 4LLYA 1SVZA 1HHGA 1T1YB 2WWMC 1VFOA 2ZPKL 4LLYB 1BFOB 1E6JH 3B43A 1BZ7A 2XFXB 3SKOB 3OGCB 3C5JA 5ACZA 5DD6B 1EEZB 5I73B 4GG6E 1IEBA 2FCBA 1OT1A 4OM0H 4KXZH 2FYYB 1S9VA 1IAIL 3PG2A 4N90E 1CXEA 4S1DD 4UDTB 1W0YT 4U3XA 3VXPB 3N85H 3EAKA 3U2SA 2YSSB 4CMHB 3W5MA 2BRRH 4GJTB 4YC2C 3KJ4B 1LE9B 3G6JF 2F53B 5EU7C 3JSSA 4NJAL 4ZUVB 3AB0C 1TNMA 1E28A 3T0VA 4X8XA 3BEWB 2A0LD 3TBWA 4EZMA 5DYOA 1NANH 4YBLB 5GRXG 3GJFB 2VDOH 1BD2B 1ZTXL 5C0CD 4NRZB 3DJ9A 2C1PA 2IG2H 4RAUA 3M1BA 1QSFD 4IIQB 4JAMA 1G7HA 3R06A 4CMMA 3QA3B 4TUKL 1SY6L 3AXLA 2JCCF 4OQTH 3T4AB 2L7JA 2FR4B 2Z4QA 4PJDE 1G7MA 4Z7OE 3QUML 4U1GB 2B0SH 4M1DH 4LSRH 3E6FB 1OAQL 3P77B 3P0GB 4YNYA 1U91A 4G8GB 1FPTH 5T1KA 1QLEL 1TJGH 5KVFL 4JFDB 3VD4A 1U2HA 3WLBA 2P5WD 3ZKXC 4YO0A 4O2CB 5F1KC 3U9PH 2ZSVB 2NX5D 5BJTB 1XGUA 4AIOA 1LQSR 2EC9T 2E7BA 2Y36L 1ZKAA 1XF2B 3STZA 4KPHL 5D2NB 1I3VA 4GKSA 3QXAB 4P2OC 3QUMB 3V6ZA 5KG9B 1WZLA 1EK3A 4CNIA 2PTTA 5C8JB 5HVWA 4AM0B 2EH7L 1FO0L 2YHGA 2GJ6E 4IOIB 5HHOD 3RVWD 2E27L 4NZUH 4HAFA 5LBSH 3NPZB 3TN0B 1I8MB 3V4PL 1PG7W 2AI0H 3IKCA 2DKUA 5IMOA 5F7UA 5CFHA 3ULVC 1KIRA 4MA1B 3BIAX 5H2BB 1T04A 2DIBA 3KYMA 4KHTH 1DVFD 4IOSD 5DVOA 3I6KA 1YN7A 1TVHB 1RK1A 3LRGA 5C6TH 5E08H 3VFOB 4KROB 3TZVC 2CMRL 1YPZB 2IMNA 2HJKA 4LLDB 4KC3B 5EH1A 1SEQL 3D9AL 1MIEL 4HJGB 3L3IB 2CRZA 5EB9A 5EBMA 3ARED 4JO3H 5GRJL 3FHQA 1OVZA 1S3KH 4XNZC 1MJJB 3RVVD 3T0ED 1NAMA 4ZOEA 3UBXG 2WANA 3UJTL 1YEIL 4LPWA 1JHTB 2FATL 3EDFA 1IC5L 3TNMB 2COQA 4W81A 1FYTB 4R4FH 2XZAL 3RRQA 4Z0BH 2QSCH 3CXHJ 4EQ2A 5JIHA 5JOFB 3OV6A 2FB4L 4S1DC 2DTSA 4AH2A 1GGBL 4YHLL 1X7QA 1J05B 5IHLB 3HB3D 1JGLL 5D7JC 4HJJH 4D3CL 2BY3A 1JHLH 5D1XC 1WFUA 3VXMA 1AI1L 5JA9A 5DJ8A 1P4IH 3MRHA 3DHMA 3DTXB 3MGTB 3W0WB 3SKUD 3U9UB 1CLOL 3B5HA 3MTRA 2O61A 1OAYL 4XB8A 3CLEL 4M62L 2AK4A 3SJVB 4LVNC 1CQKA 2D7TH 4DEPC 3MCG1 3KYAA 3REWB 5D7LE 2Z8VC 2YRZA 5E2VL 3TBWB 4D2NA 3VWKC 2VLJB 4NCDA 3SDCA 3C8HA 5CIPB 2C9AA 5B8CC 3G6JE 1T2QH 3B2VL 2K7QA 5ICZB 1EZVY 3RHWF 3MFFA 3BPLB 3NACH 1MF2H 5CIPH 2R1WB 4UQ3B 4LPUA 2FATH 5DJCA 3AXLB 2QKIB 4LSDA 3LB6D 1JPSH 2YWZA 3GSRB 2X1QA 1I1AD 2WBKA 3WUWG 3JTSA 3TBTA 1X5XA 1MJ8H 4K2UL 3VWJD 2P8MA 4WY7H 4K3EH 5J12C 2ZUXA 3OAYK 3UTPD 4FRWA 3EFDH 4KK5D 1IGTB 4PRIA 2JIXB 3TLRA 1HDMB 4R7DA 3CVIL 3GM0A 3QIBC 3RNKA 5I71B 3IDIB 1ONQA 5JW4M 1D5ZA 4D9RD 1MHCB 3HC3H 3DUHA 4NJ9L 5F7HA 3LKQB 4MJ5B 1T89A 4MQ7B 2H3NA 3CLEH 1Q9LB 1E27B 4IRZL 4ODSL 4OGYL 5GHWH 3BP6B 4MA8L 1NUNB 5E1HB 4W4OC 3EO9L 4OB5H 5E99L 4UNUA 3MRQB 3QEHA 5FYLE 3LS4L 2CD0A 2DYPD 1AQKH 2VDLH 2NYYC 1FYTE 2Y07L 2P8LA 1QBAA 4G5ZL 5T1LD 1T7VA 5E2TL 1IVLA 3WS3B 4NKDB 4LHUD 4N8CL 1OM3L 5GQBA 2E7MA 2R29H 1QSEB 1YPZE 3QUZD 5KZCB 3ZKND 2EECA 4WUUE 5AEAA 3C08H 3NOIA 4OFYA 5FM4A 4G8FA 3V0WL 5K33A 1DQTA 4D0DA 4TUOB 5IW3A 5FCUL 2FHBA 3LKOA 4JN2A 5HYFA 4DW2L 3D85B 1JYXA 1RZKL 1MFDL 3LKPB 4R6UA 3J7HA 2NQCA 3GHBH 1IM9A 3OX8B 4U3HA 2R8SH 3MRJB 4EKXA 4PRHB 2JELL 1BQSA 1CGSH 5DMIH 3RI5F 2B4CC 1KPUB 1INQA 2GTZB 3PXJA 1X5YA 1DSFH 2X6MA 3CU7A 4NNXA 3P4MA 3EOAA 3BH8B 5IF0B