2IGFL

Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSNQTILLSDGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA B13I2 FAB (LIGHT CHAIN)
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1991-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2igfL01
4ONGH 3P9LA 4WW1A 2VLRA 3ARGA 2L7UA 4RWHA 5B38A 1IL1A 5ADOH 3LQZA 1LP9B 4M6AA 4UB0H 5I1LB 1IGYA 3DUHA 4K7PY 1FDLL 5F3HA 4UV7L 1HDMA 3H3KA 1K8DA 1JNHA 1AY1L 2XKUA 3FL7A 5CEZE 3WUWB 5IG7A 3H3PH 4NRXB 3OJMB 4NKOA 3L1OH 4ODHH 1PLGH 4FZ8L 4U1SB 3NFPA 3QHZH 3JBG7 4LOUD 5KVDH 3FFCD 4M6MH 3N1FC 4WFGE 3UAJC 4RMTA 4KZDH 4BH7B 1IM3A 4KMTH 4UIMA 1OAKH 3T3ME 4P2QA 1I7TA 1BD2B 1I9IL 3VRIB 4FQCL 1OY3B 4OCYL 3WEXA 1DQML 5T3XE 3SE4A 1XFPA 4ELKB 1XGUA 5HHME 5K9KA 3ROOB 2W9DL 4D0BB 2DMKA 5EOCH 4BSVA 1PKOA 1LEGA 2OM5A 2GK0B 3GMRA 4IMKC 3H9HB 5AAWA 3EYSH 3RDTA 5GZOC 2BNQD 4NO2A 4NFCA 1E6OH 3BO8B 1ZWIB 1BBDL 1BQUA 2CR3A 3PWLB 5E95B 5EO9A 1JVKA 3HUJB 4Z78B 5GISL 5L6YL 2AJYH 3D85B 3KPSA 1KTKE 4PRIE 4ZXBB 5JHDD 3RVTD 2RFXB 4L8DB 3WN5A 2OP4H 5JO5B 2RGSA 3U82B 5FB8B 3RP1A 2DLHA 1Y18B 2QHRL 2Y7QA 1S9VB 4X9FA 1OP9A 5HI5C 2NNAA 3O6KH 1QRNA 2B4CL 4ZPVB 3U4AA 4OLUL 1SEQH 4X6EA 5CD3A 3QPXL 1NGPL 2X4PB 3MCKB 4XHJC 4BZYA 3QULA 1CK0L 1FFPA 5HVHB 3KXFA 1QR1A 1XGPA 4OLVH 2VZ1A 1Z3GH 1MFBL 5I1EH 5GS0L 4G9FE 3IS0X 3T77A 3HLAA 1J88A 4WW1B 4ELMF 2ZWLT 1W72A 3QG7H 5E94A 5L2KB 2R9HD 4PR5B 1IAII 3IFLL 3RVUD 1CT8A 1J8HD 1ZXQA 2NX5B 3WNLA 2R1YB 4R4ND 4X6DF 5JIHA 1P7QB 4TNWK 5CHNA 5A2IH 3EYFA 4JN1L 4XPBH 3BRDA 1LO0L 4HC1A 5FM5O 4Q0XH 4KI5E 3JVGA 4H8WC 4TVPH 2QKIB 3OKMB 2C9AA 3OAZK 3U30B 3VFPB 1MWAB 1PX3A 1JJUA 1IGJB 2KZ1B 3HE6A 4BYHA 1CDJA 1UB5B 4JRXE 5BMFL 4FQXD 1BFOA 5L0QC 5GRYA 5JW3L 4UQ3B 3BUYB 2YXMA 2V9TA 1CBVH 4DKDC 1G6RH 3WMSA 4HJ0D 1EO7A 1AGFB 2GJ6D 3EKCA 3KPRE 1PJ9A 2A74A 4WFEE 1GRWA 3DPBA 3WIFA 4B50A 4ZFOB 3A67H 1U41A 1U8OB 1OM3L 5DMYA 3T4YA 3WJJA 2Z9TA 5JOEA 3HR5B 5ID1B 2GI7A 2YS4A 5GS0C 5B3JF 1G84A 3AY4A 2UWEB 1A1OB 3QDJE 4P5TC 1CGWA 2BVQB 2EE6A 2E7BA 3GHBH 4YO0B 3OR7A 1KJMB 2R0ZH 1IEBA 3MLVH 1OTUC 1R0AL 3G6JE 3BD3A 7FABH 3LKOA 1H0DA 4M48H 1H8NA 3VXRE 1I7ZB 3IJYB 1NKOA 3TESA 4L29A 1SMAA 4IEFB 4F9PA 4FFVC 2JJSA 5BRZB 5HYEA 5JDSA 4CVZA 1Z5LB 5FUOL 2XQYK 1ZLSH 5E8EA 4O02L 2I25N 1QZ1A 4DZ8A 1AC0A 4N1HB 4S11A 1T20B 4EQ2A 2VITA 3QUYD 1MCBA 1VPOL 2VLRB 4XXDB 5IOPB 5GRZA 1Y0LA 1UVQA 1TNNA 3DHJA 3MUY1 2YUWA 4NOFA 1K85A 3MRIB 3PDDA 4MJID 1HDMB 5JORA 1F4YH 1ETZA 4XNUL 3QCTL 5HYQB 3QXDB 1UM5L 2Y4SA 2P8MA 5F89B 5KVGL 2XICA 4EIGB 5GS1A 4ZOAA 3DX9A 4OLWH 3DMMD 1RUMH 3WIHA 3DGGB 3I6LD 4FRWA 4QTHB 4BFGA 3D0VB 4YEEA 1ORQB 4WCYL 4ISVA 2DJUA 2ADIA 1HKFA 2E9BA 2BNRA 5GQBA 5D4QA 2NW3B 3QUMH 4ELKA 3MLXH 4BK5A 2ARJQ 4QHLB 2CLVA 5DUML 5L88L 2YXFA 1GZQB 3S7GA 1ZA3B 1RULL 5TDOB 3K3QA 2G9HA 3TO4D 5IP4A 5KJRL 1RHHA 3A6BL 3V7MA 4MWFA 1DLHB 2ZUTA 3K0WA 1S7QB 2BSTA 1T1XB 3T2NH 4QHKJ 2VC2L 3GEWB 4PFEA 4HIXH 1IKNC 1KB9J 1UM6H 2X1XR 3OHXB 4E9LA 2IMNA 3BESR 5C0BE 1YY9C 4P4KB 4FQIH 1R3JA 2BY2A 4JRXB 2COQA 2H8PB 2O5ZH 1P7KA 2NNAB 1U93A 3ZE2E 1RZ7L 5GGRB 1CDUA 2AGJL 2B0SL 3MXVL 1HI6B 3VCLB 1K4CB 5I8OL 4LVEA 2AKRB 5F88A 1UJ3C 2YPLE 3FO2B 4ODTH 1RUPL 2OL3H 2FEDC 2YSSA 4PJ5B 4JKKA 4RFNC 3C08L 4KI5F 2CK0H 2YRZA 3DO7A 4P2OB 2HN7B 3E1F1 3U7WL 4P5KA 5IK3A 4P23A 5D6DA 3MPCA 4I2XE 4HD9A 5JZ7C 4PRIA 3Q6FA 2Q8AL 2UWEE 1NGZA 1RZKL 1U8QA 4UDTB 3SDXA 1B9ZA 5C6TL 5EZIH 4TOYL 4XAKE 3VXSE 4DGYL 5ESVB 4EI6B 1FYTB 4U1NB 2NYYC 3FB8B 4OLUH 4I0KA 3ARBC 1IM9B 2B4CH 3SDAC 5IM7B 2B20A 5FDWA 1T0NA 3S3SA 2DM3A 3NACL 3RTQB 4QY8A 3UJIL 2FO4B 4Y4HC 1IT9H 1IGJA 2DQTH 4NN7B 4D94A 3DGGA 3HNTL 3UYRH 5C0EA 5MEPA 2AJVL 3B3IA 4X6CA 43C9B 4PJHE 3PP3K 2VLKA 4D9QE 4PB0H 3HZKA 5IHBA 3GJFH 2PTTB 4QRRD 4QHLA 4KUCD 4PJGB 3CFDA 3VXMA 1OCWL 1X5AA 5D72H 3OXRB 5DD3L 4CMMB 5MP6H 3IDMB 2ENYA 2FX9H 2YN3A 1FIEA 5FYLD 5C71A 1KBGH 3TC9A 1PEWA 1DBJH 1OVZA 5IJKA 4P2RD 5GS0D 3S9DB 5E94B 1N3NB 1MLCA 2R0KL 5FAAA 3OGOE 3REVA 3AREC 2F19L 2FBOJ 4OZGA 1F02I 3IJYA 4I77L 4RGMB 4M1DH 5DRZB 4NNPL 4MAUL 5JW5A 1FJ1B 2YPKB 4NHUA 4KVCL 1FIGH 1A7NL 4X5WB 4YX2L 4XCNA 4M02A 4DZ8B 5B22A 3WLBA 2VJXA 1PY4A 5KSAD 2IJ0C 4MNQB 5A3ID 1CBVL 1A6AB 5KANI 2K7QA 2FHCA 2BNUB 4XMKH 1AFVL 3VJ6B 1PEZA 4NT6B 1OARL 3MLWH 5E24E 4OI8A 1ZMYA 4G3YH 4XZUB 3RI5K 2VWEE 1CIUA 4UTBH 4BQ8A 1PZ5B 3BAEL 2YD8A 2DQEH 3BEWA 5TF0A 3LN9A 4GMSL 2AK4E 4U1NA 3HR5A 3QPQD 1WFUA 2BSED 3NCBB 4H20H 5JLZB 4Y16A 1MIEL 5CGYC 3Q6GL 3UBXA 1DVFD 1T0NB 1YNTA 2EYTA 3O8XB 1RZFH 2IH1A 4YR6A 4NNPH 4ZPTB 4OM0L 3SO3B 1SQ2N 2XTLA 4N5ED 2BNRB 2Q3AA 4MVBC 5C07E 2X4NB 4MA1B 1BZ7B 1KTDB 5TPWL 1FL3B 1QSEB 4QRUA 4WI7A 5J13C 1IGML 1M6OA 1P84J 1KPVB 2FL5B 3DI3B 4ZFGL 2YPLD 1KN4H 3N50A 1I1RA 5LGHH 3R1GL 5HHOD 3TO4C 4OCXH 3L3DA 4YIQA 4LGSB 5ESQB 3T0EB 3V8OA 5CJXC 5FKAA 4D0DB 2YD5A 5GGRY 3RWEB 3ARGC 4S1QL 5IJVA 3H9SA 4HIJB 1U36A 3G9AB 4BSWB 4YNYA 3B9EA 4MZ2A 4CU6A 2VQ1B 3W9DB 2J6EH 4FG6C 3H7BA 4OZGB 5F9WB 3IFNL 4ZUWB 4R2GC 3D18B 2H3NA 2ID5A 2R2HB 1BQLH 3CX2A 3RPIB 2DQUL 2DQTL 5CD5D 3MNVB 4LSSL 4OUUB 5AWNH 15C8L 4G8FA 1DE4A 4RA3A 5CGMA 4M7LT 2PXYA 1XGRA 4JPWH 4ETQB 4QYOA 4NBYB 4R26H 1KCRL 2AQ3A 2X4RB 4HKZB 4NFBA 1A3RH 1DCLA 1QLEH 5KVEL 3OTTA 4HWNA 2UVEA 4JRWA 3UEZA 4JZNA 3PNWA 3QZWB 4HIIA 4KHTH 3RVUC 2OQJB 3SE4C 3MZGB 3KPRA 2ITDA 2BRRH 1Q8MA 1X5YA 1W8OA 1P4BL 2CIKA 4RGMC 4Y4KA 4NQEE 1J8HA 4U1LA 1GJIA 2ZCLH 1NC4B 4P2CG 3EDEA 4BKLB 1S7TA 2BSSB 2X5PA 2NYYD 3MRHB 3QXTA 2FO4A 3U2SB 4NQCD 5I8OH 2X4OA 3ARBD 5HSFA 1D9KB 4HJ0C 5AG9A 4MJIE 2YKLL 4X6CB 1MCOH 3O6FA 1KG0B 3CAFA 4WWID 1WCBA 5I75C 5C8JB 1EGJL 3FT3B 4BQ6A 3D3VD 2JELH 3T4AB 2VDRL 1AP2B 4WW2F 1ZLVK 2DKMA 2EO9A 3MV8D 2R2EA 1P7HL 3LKNB 3T2NL 3TT3H 5ANME 4R0LC 1NLBL 2HN7A 2ICES 3U0WH 2P46B 3DV6B 4XI5D 1CLZH 5HHXH 3T0EA 2V17L 3Q6FB 2AAVA 3MREB 4YHMH 1XF1A 4OT1L 2DQJL 1GGIH 1T3FA 1U8QB 3SDXB 1DBAL 4OM1L 4JDVA 3HS0B 1P53A 3U1SL 1VHPA 5KS9B 1P4IL 4PJCA 1JRHH 1G7PA 4G6JH 4K9EH 4J1UB 4NWUL 2QSQA 3HTLX 2D03L 4JFYB 5LQBL 1OAQH 3SCMD 5MEPB 3RGVC 4NQXB 4JANB 3QRFM 1QKZH 4HS3B 5I8EA 3GI9H 5KOMC 2ADGA 1X9QA 3DSFH 4LCWB 3Q6GH 2G5RA 2BNQB 4N90E 5C07A 1ZOXA 3GIZH 3H0TA 4WI4A 1H5BC 4M03A 4H20L 4KI5C 3KYMB 3GMPB 5DLMH 2DQEL 3LSOB 2VXQL 1YEDA 2PUQT 2I60L 2YZ1A 3CLEH 4NZDA 5A2KH 1CDHA 1UM5H 1P2CB 1ZWIA 4Z9KB 3WE6B 1T89C 4OCWH 4LIQE 2J88H 4BKLA 4PJHF 1NCDL 2IPUG 2VZSA 3ILQD 1R5VA 3NA4A 1DVFC 1W0VA 4PV9B 4YX2H 1XCTB 3TA3C 5IW1A 2DQIH 5E9DD 1XF2A 1W0YT 2JIXB 3QISA 3MLVL 1AXTL 4PJIB 3QI9B 5IESL 4S1RL 1BVZA 1PQZB 4Z7VE 4DKEH 1G1YA 4J7RA 1F42A 4M5YH 5ECJE 4ZOEA 2P5WA 3LKNA 4U7MA 1CD0A 3PWJA 3MODH 1R3LB 4Q6IA 2VLRD 1UCBL 4CN1A 5GRVK 2QADC 2C3HA 5E08L 4I3SH 4JHZA 3CDGA 5GRUH 2F53A 4WU5B 4TSCL 1C16B 2WZPD 4CL7A 3MRCA 1PVHA 1X5LA 4KJPC 4FQLH 2NQCA 1FO0H 1AC6A 2RHEA 2IANA 4FQ2L 4HWUA 1PZ5A 4LLDB 1R3IL 3NFNB 3GM0A 4GBXA 3V4VH 1YMMB 3RPIA 1NEZB 3OAYK 1QFPA 1YDPA 1GC1H 2CKBA 1YYML 2QKIA 2D31A 2PXYD 3V0VA 3AREA 1E4KA 1WZLA 3QUZA 5I19H 4HKZA 2DYPD 2DBLL 5JUEH 1VACA 3FB5A 3BE1L 5HHMD 1KLGA 1GPOH 1QG3A 3VRLE 4L1HA 3PE9A 3WS3B 4Y5YB 1RK0A 1PG7L 4LQFL 4LSTL 4R4FH 3QUKA 3K2UH 1A6WL 5FECB 2JJWA 4JFFE 5EZIL 1I1AB 2EKSA 4K94H 4NWUH 4HWZB 4Y8AA 2NY2D 4UOJA 4JFXB 4Z95H 3VW3H 5JHDB 5JIPA 1FZJA 25C8H 3KYOB 5ESQA 2WP3T 2WV3A 3Q5YA 2G2RA 1CFQB 1RIUH 1O0VA 4KRNA 5FYKH 1NBYB 1MRDH 3O4LD 1WTGT 1QRND 1IEAB 5ACZB 4YNYB 2D03H 4I5BA 5IBLD 3TZVC 4HMEA 1Q9WA 4F58L 4O51B 3MOBL 4YDVA 2APTA 2H3NB 4GUPB 4RGNB 3U0WL 4HS6A 1T5XB 5T1LA 1D5XB 4QRRA 2PW1B 5AYUL 2SEBA 4HZLB 1SEQL 1KCVH 3P4NB 5ACLA 4E0RA 4UIKH 3PWJB 2HJLB 4PRNA 3MV7B 3G5VB 2BJMH 4URTB 4G6FB 1JPSL 3GSXA 1I7UA 4Y5XA 1MCRA 1UM4H 1FL6B 1OP5H 5FYLH 1YPZA 4M43H 3D48R 2YK1H 4EUPB 3BQUB 1FVEB 2IBGA 2J2ZA 2VIRA 5JDJA 2Z4QA 1DUZA 1PGRB 2GAZB 3PL6A 1KTLA 2VDQL 3RNQB 5HGHA 4Y4FC 1Z9MA 3KLAA 5IB4A 1AKJD 5I73B 4KROB 5BW7C 1F6AB 5E5MB 2H1PL 3L5IA 5DEGB 1BIIA 3V5HA 4NO0D 3ARZA 5HBBA 1QSFE 4KQ3L 2AJZA 2XG5A 2GJ6A 4Z7VB 3QCUL 3U0PB 1GGTA 1VEPA 5FEBA 3QIBC 4HS3A 5FKPB 3SCMC 3RGVD 2GCYB 4LSVH 5HYSA 5MERB 2V2XB 2MCPH 1H8SA 5TQ2L 1G9ML 2EDTA 4XP9H 1UKTA 1YMHB 5SWSB 3WIIH 5KVEH 1IGFH 4X6DE 1AO7B 3GBNL 5FHBL 1MAML 1JGLL 2WBJA 1UB6A 1I1AA 2EKSB 4GAJL 4K2UL 2XG4A 4CGTA 3I6GA 3ULVC 3UBXI 4EI5D 2R23B 5JPMB 3U30C 3DV6A 4PJFA 3LZFL 3B8SA 4I8DA 2QSCH 1MCIA 1DN0A 1KIRA 1NQBA 1YMME 4AEHL 1JGEB 3QUMB 3Q0HA 4PD4J 3O41B 4LCYA 5C0FB 1LNUA 4HKJA 4JGJA 4KDWA 4AZ8A 2PR4L 1XCTA 2V2WA 5DJZA 2OR9H 3O3DB 4RGND 5TH2A 1UM4L 1T04A 3MLUL 1CYGA 3IDJB 1HHGB 4YWGL 1BJ1H 2NW2A 4Y19D 3HZYB 4OCSL 1T0MB 3QXWA 1JPTL 1K4CA 2MKLC 4DK6A 5FF6B 4R3SA 3KXFE 1TZIA 4XPFL 3QSKB 2VC2H 4NQDA 2YRPA 3VG0L 5TGBA 2HMID 3S37H 5IEHB 4PJ5A 2ZSVA 3TV3H 3VXUA 1SY6A 3BGMB 3WD5L 4JFFA 4NQXA 1JHKH 2YPVH 4AENA 3EAKA 1UFUA 2ESVD 4X7TB 3VDCA 1IC4H 5EOCJ 1WZ1L 3OKOA 3BKYH 1CZ8H 5EUOB 4H88H 4JRYB 4M7KL 4NN6B 4R2GD 1BD2E 3TT1L 2EC9T 4KKAD 5DK0A 5J89A 4I0CC 1TNMA 4IRSA 1DUZB 4U6XA 3KPLB 5IJKC 5FYJD 1A7RL 5DI8B 4I18A 4F7CA 4AL8L 2DOCA 1F4WL 1K9TA 2GT9A 1AQDB 3OAZH 2AV7B 4E5XA 4IIQA 4U1JA 4K94L 3SE3A 1OB1A 4L4TA 5BVJA 2F58H 2AJZB 4HUWB 3DXAE 3L5JA 4ZO6A 2DQGH 4OF8A 4G43B 1CS6A 4WI2A 1CGSL 1D6VH 4TVPL 4P5TA 3C60B 5GHWH 3MR9B 1XF5A 2XKNA 1VPOH 3P0VH 2FJHA 1ZANL 1SJEB 2JLLA 4JY6A 2NZIA 5IQ7L 5LGJA 2OJEB 5A16B 5HDLA 2NY4D 5D8JL 4GW1A 2IWGA 3WHXA 2ZCKH 1XR8B 3V0WL 3WIIL 1ZGLA 1QTYT 2CUIA 3I75B 4WUKL 2PTUA 3DUSA 1LNUB 5C9JA 4KH2A 4OLVL 2EDRA 3E3QC 3GSNB 3H6JA 1KT2A 5DMIH 2IFFL 2OX5A 3FN3A 3GB7A 3KPPA 2XT1B 1UWEH 2V6HA 2R0LH 3QEGH 4TSCH 1RK1B 5L2KE 5F3BA 3UTTD 3EYOA 3F7YB 2CUHA 3X12B 3MODL 4BH8A 2A9ML 2BMKA 3GMMA 1ZT4A 3WLBB 4PRNB 1BIHA 1B4JH 1H3VA 2AJUH 2Z31A 1P6AB 1QRNE 1E27B 4OCRL 5E99L 3GKWL 4M43L 4F3FB 5J11C 3B83A 3HMXL 1I8IA 2VXVL 3ZE2F 1HSBB 1KFAH 4FTVD 4MJ6A 1U3HA 1T66C 2IPTH 2DTSA 4Z18A 4G80A 3SKOB 1CFBA 3ROLB 3VXSA 4X9IA 5EOCL 1E4WH 4PG2C 1DQMH 3L3JA 1OSZB 5EZJA 4LASH 5CIPB 2BY1A 1J1XL 2AQ2A 1CFQA 4IIQB 2OZ4L 4K94C 3O6FC 2FYYB 1YY8A 2DF3A 2B7DT 5GGTA 1QACA 4JAMA 2VDKH 3L7EA 3VD5A 2AJ3A 2RCSL 5FYKL 3MCLH 3GJFK 3BP6B 4DEPC 2H2SC 3P0YL 2SEBB 4HZLA 4TOYH 5I74C 2CXGA 1MFAL 4X4MA 2F54A 5IUSA 2ZG3A 1I9EA 2LE9A 2ZNWA 3DMMA 3KJ4C 1CK0H 4K8RC 4ODXA 3P9WB 1DSFL 1A6WH 3FQNB 3T0EC 1NGPH 5ERWB 1T1ZB 4FQIL 5DJ8B 1EXUA 3RKDD 4C4KT 2J1KA 4IM8A 2FJFB 4WEUD 3JUZA 5EU7E 4XBEL 1EERB 3QXAA 3QJFB 5J6GA 2XN9A 4UMGA 4BA8A 2VLRE 4O2FB 4U7KA 4LVNC 3TVMD 1OSPL 1RK1A 2O26U 4AM0B 1MFNA 5BQ7B 4U1HA 5DT1H 4U6HA 1QBBA 5D1QC 3MOQA 1K4DB 1KIPB 3EYUH 4MXWL 5IVZB 2P45B 4H0HB 2LU3A 1F6AA 5F3HB 4RNRA 3BRGC 3L3KB 1E4WL 3MV01 4ETQA 3QB7C 3F6LA 1OD9A 1T4KA 3BUTA 5HI4C 3RRQA 1KF9B 5I18H 2VLJE 4X8JB 3O2WH 5F9JA 3ALWA 1GGUA 1SJHA 4Y5YC 1L0XA 2Z31B 1NMBL 3D87B 5HD8D 3ULVL 3GBML 4P4RA 3F7VB 1IARB 4XMLL 3MLZL 4NO5A 2IPKA 3WEXB 5EOQH 2BOBB 4KZDL 1KJ2L 2XA8L 3OKDB 1H15B 4BSVB 5JHLL 5F1SA 1S7VA 5DK2A 2ZKHH 1IEHA 4MDIA 4UOW0 1Q72H 4C57C 3WDHA 2ZCHH 1JWSB 2O61A 2X4TB 3RZWA 5B3NA 1HHKA 1MFEH 5ELIA 1RIVH 3AFLA 5EO9B 1G7IB 1R5WB 1N4XL 4F37K 3C60A 1G9NH 4Q9BA 1FE8H 4X4XB 2RFXA 2F8OA 2VXTL 1A3RL 1A6ZB 1FGNH 1QLEL 5MEQB 2NY2C 2XRAH 4R96A 1DQJB 5A3IC 5IFHH 3N0PB 2O5XH 5DTFA 3P11L 4LSSH 1UZ8B 1DLFL 4X6EB 2OTUB 2CGRH 3MGTA 1EHAA 1XR8A 1ZGLB 1I8KA 3X3GH 4LP4A 1MCQA 3AMKA 1QO3A 1JZ7A 1K2DB 2FBJL 1T3FB 4C56B 5CJ5A 1JZ6A 4HF5H 5FIEA 4KV5E 5GGVY 1YC7A 2ZCHL 1QFWH 3A6CL 5DK0B 1RMFL 2WINA 12E8H 1HYRC 2P7TA 2MCG1 3LRSA 4JPVH 1G7PB 1HZHL 3BP4A 5IMKB 3IXTA 2OMNA 2GT9B 3D3VE 4E5XB 1X4YA 4U1JB 3SN6N 1K8IA 4EBQL 5F71A 5E8DL 4W6WB 1E4KC 1S7RA 3ES6A 3RY4A 2YC1B 1I1AC 5DQDH 2ADGB 1E27A 4F3FA 1LO4H 1W72H 3P77A 3S88L 3QFJE 5IW6A 5C09B 1IE5A 3V6ZA 4HJJL 3Q2CA 1IQDB 1YEIL 3LIZL 3PWNA 4Y2DC 2QJDA 4XC1H 1G7JA 4HC1H 2PYFB 2GFBA 3ARBA 2HP4A 4DW2H 3QUXD 4BQCA 5AG8A 5GXBB 2R4SL 1MJ7L 3KYAA 3RX8A 1W0WA 1G6RL 1FNEB 3QXVA 4Z7QF 3QIBD 4LHUA 5JIKA 1A6TB 5EWIH 1GGCL 1YPZE 2JCCE 3QT2A 3BDYH 1G7QA 3RUGF 3QQ9C 2EZ0C 1WBYA 5EULV 4KROC 1B0RB 4FQHB 4KJQD 4XGZB 4WV1A 3N1MC 4LHUG 2R15A 3HNSH 4XPTH 1N2RB 4GO6B 2J4WH 3X12A 2A83A 1G0YR 3I85A 3DRTB 1BX2B 1Q9LA 5GZNC 1FIGL 2WBJD 3VWKA 1FFRA 4GG6F 5DTFB 32C2B 4N0YL 5C2BH 3C6LC 3IDGB 3MNZB 4YHKL 1ZHNA 4RGNC 5E2TH 5IVXF 5E8EB 3IYLW 4WO4A 1NUDA 1HSAB 2E9IA 4PJHA 3HA0A 1G0XA 5DXWA 2F5AH 4RZCA 5KSBA 4PRHB 4MA7L 4U6HB 1KCRH 3IDIA 3OB0H 3C2AH 3QQNA 3P4OB 1E6OL 3SCMB 3ECBB 2GW5A 15C8H 1KJVA 3R06A 4NRZB 2QHRH 1NSNH 4NGHL 3G5XA 3TLRA 3D69B 3TFKD 3K2MC 2GTWB 2AJXL 4R6UA 4X6DB 3OX8B 3ARFC 2IAMB 2J8HA 1G9EA 1M05A 1TENA 2IALA 5FECA 1F6FB 4RAUB 3ZKXB 3MV7D 4WWKB 4JM2F 3SGJC 1OQOA 2V7NA 4PLKC 4N0UB 4OGZA 1JPGA 3N85L 5D9SA 4OFKA 2ED8A 3QHZL 2HJKB 4ZFGH 3MOAL 4HPOL 3C2AL 3ZDZF 1BWMA 5IROA 2DIAA 3H3PL 4F8QA 3WIHH 3KYOA 4MLSA 4HS8L 4MDIB 1P9MC 3IJSB 1FNEA 1QUNA 5I1DB 3KVQA 4OCLC 4YUEL 1QSZA 5CSBA 3RI5F 3VGHA 4PBVC 4QXTB 4O51A 2VXSL 5DGQA 1SBSL 3TN0C 1L7TH 43CAB 2EE9A 3OGCA 5J1SC 2EH7L 5SV4A 1MI5D 1RIUL 2GSIA 3MRPB 4Y4KD 5HHNA 1CDYA 3S34H 3L3KA 4G6FD 5IQ9B 5C0JA 1FNSH 4PP1D 5DDHA 1CFVL 2DLEA 1CU4H 5GGRA 1RV6X 4FTVE 3HE6C 1UC6A 4L4VB 4LSTH 4P2RE 3WFDH 5EUKB 2JIXD 4KKLC 4WGVB 2W0KA 3TYFB 1U8JB 4OCNC 1IAOA 1FVEA 4FQQA 4ODWB 4UBDC 2VKXA 5KSBB 1MJJA 3LQZB 4DW2L 5EU5A 3PF2A 5SWQB 2R1XB 5DR5L 1BFTA 4YFEA 1S7VB 5DK2B 3FOLA 5DUPL 3M1BA 2Y6SD 3T09A 2X89A 3S37X 3MRKB 3ZHDA 2R8SH 3RWHB 4L4JA 2QTEA 4NP4L 5I76B 5I1KL 2BERA 4JVWA 1D6EA 1OAUH 4ZYKA 1CGUA 4GAYB 2EIBA 1KEML 4U6TA 1JK8B 2JCCF 3PWUB 4MJIB 1F58L 1KSRA 2P47B 3D39A 5C0EB 4QCIA 2UYLA 1MCLA 1NEUA 3QDHA 2QADD 2VDPH 4TNVK 5KOVC 5M95B 3E6HA 3VFUA 1FAIH 4N0UA 3MLTB 5D9SB 3ULUD 1MQKL 2XZCL 4P46B 3CDCA 3VXSD 4JFEE 2R23A 4FQXA 1HQ4A 4M7LH 3UYOD 5DMJB 1BQHA 4KJPD 2FO1A 4NOBA 3RVXD 5B39G 4P3CL 5D1QA 1E4XL 5BRZD 4J23A 3BGFC 3PV7A 3VU2A 3S35H 1ZVYA 2C1OA 3DUUB 2NY5C 2H2SD 3I50L 3ARGB 5B38B 1PYWA 4WV1B 4NKIL 3WNOA 4OZIB 3OGCB 1TTUA 4JFPB 1KYOK 1U8IB 5ICYA 1L0QA 1MQ8A 3OR6B 1S9YB 3VFMA 1DEDA 1BZ9B 2VNCA 4KPHL 1QRNB 1RZJH 5IG7B 1I3VA 2YC1A 4NRXA 2Z8RA 3RFZC 4M5ZL 3QULB 1K6QH 2I07B 4R4NC 2ESVE 4MD0B 5F6IC 7FABL 4FFZH 3RA7H 1MCPH 2I9LA 3GI9L 4U2YA 2VE6A 2FLRT 4JFDE 3QDMA 3NFSH 3ARBB 3DVFA 1EPFA 4AY0A 4GMTL 3IFOB 4QGYA 5GZOD 1FZKA 4FQXC 4I18B 4DKAA 4F7CB 5I6XC 1LK2B 3PGCB 3RGVA 3DX7B 4G6ML 3MLYH 1QVOB 4CJ1A 2O5ZL 2VKWA 3ARXA 3BKJH 4AK1A 1IVLA 3QEUA 5EIVA 1WBXB 2FR4A 4Y4HA 1KYOJ 3STZA 1J87A 4Z7OF 3CGTA 3O6ML 1XF5B 3JWDL 3GSOB 3RX7A 2JB5L 3BN9D 4PYGA 4A6YL 4HJGA 5D1XC 4JB9H 3FMGL 5IMMA 2QQLL 1N0XL 1J0IA 5D7IB 3WFDL 1WFOA 2D0FA 2Y1VA 1UEMA 4LPXA 4XMPH 2P48B 3NABL 1XIWB 4OTXL 4F58H 4HKBA 3FB6B 4Y7MA 2JELL 5GS1C 1CLOH 1WUNT 1RZIB 3EOBA 1IMHC 2FB4H 4WO4B 1AI1H 1IAMA 3WFCH 1XT5A 3MBEB 1CG9A 3T77B 4FQJH 3L9RA 4PG2A 1KGCD 5GGSA 2F5BL 3W39A 3ECBA 5E2WH 3CNKA 1L7TL 3QNYA 4WI5A 4WJ5A 1IZKA 5T3XL 3UCRA 1V7MH 2X1QA 3E0GA 1JNHB 5HHOB 1CXKA 3W0WA 2W0FA 1WLHA 2ITCA 5HHPA 5I9QB 1C8PA 1NANH 1TQBC 3GNML 2PO6B 1KLFA 5IFAL 3GJEB 1F3DJ 4CADA 2WWKO 2X40A 4PP1C 1IGCH 5AZEL 1DDHB 1DE4B 3WFEH 3R8QA 4J4PA 2Q20A 5EZLB 5C6PB 3VG9C 5DA0B 2LAAA 5CEYB 5DO2D 3HI6H 2BHYA 3RIFF 4JHAH 5C0AA 4NCC1 3Q48A 2IF7A 3GZKA 1FC1A 5T1KA 3PNWB 1HOCA 1XGYL 1C7TA 5J13B 4XXDA 3DMMC 5IOPA 4O02H 4Y19B 1KB5B 3L3GA 2DWDB 5JR1L 2VLLA 5FGBA 5MI0B 5AD0A 1PDKA 4FP8L 4OI7A 4K3HA 5C08E 4NO0B 1A7OH 3H9HA 3HFML 1M7XA 3TBSA 3MACL 3WFBH 3IRPX 4OZIE 4KI1A 2X44D 3QFJD 4IOFC 5A1AA 4QT5B 3CC5A 4GW5B 4K3JL 4J6RH 2LU7A 3HMXH 5D7JC 4ZYKB 3I3DA 1OW0A 2FX7H 3AVEA 5E70A 4EDXB 4PGEA 1VA9A 2P43B 4JRXD 4M3JA 1CR9H 3F7QA 1UCBH 1XR9A 5F9WC 1A02N 1INQB 1MPAL 5HYJE 1B4RA 4KK8D 2NTFA 1CDIA 4NQCA 4P2OC 1BLNB 3C8DA 5DJ6B 5KN5B 2NW3A 4K7PH 4L5FH 5J06A 1WITA 3BPOB 1CXFA 2P5EA 5CFHA 4YHKH 5L8LB 2E5EA 1ZA3A 5BRZA 4LPWA 1YEGH 5TPWH 3F62A 3WO4B 5A43C 3BQUC 1XGPB 2NPLX 3QQ9D 5I0ZA 1U8JA 1NPUA 3DXAA 3SKNA 1IAOB 4O2FA 5D2NE 4RDQG 3LCYA 3O3AA 1T89A 5FYKU 1RZFL 5K93A 2EDEA 1YC8A 3FOLB 1MIEH 3ELAT 5EC1A 4LF3B 5ALBL 3SQOH 1AH1A 3P0VL 5HYQA 4Z5RB 4POUB 5C0CD 5GRJL 3ZE1F 1BVLB 5E00B 3VFVB 3RY5A 4X7EC 1SYSA 2R4RL 1EMTH 2FECL 3PUCA 3OQ3B 2HFFA 3IF1B 1FL5B 4K07A 3IKKA 1BFOB 1JNLL 3FMGH 3TIDB 1F8TL 5HDBE 1F4WH 5E9DA 4AL8H 2HTKD 4P46A 4OQTL 2Y9RT 1MY7A 4Z6AT 3KPMB 5CP7A 5E2VL 3BP5A 1A7NH 1I7RB 2X05A 5HYJD 5KSAA 3LSOA 3NH7H 4KRPC 4MAUH 2MMXA 2WQRA 1EFXD 2VN4A 2YD2A 4K3GA 1A4KB 2BVOB 5GGVH 5L7XL 1PFCA 3DROA 4H88L 2LTQC 5D1ZA 4ELME 1NAMA 2VLJD 1FG9C 4EDXA 1GOFA 3VMOA 3JV6B 4TUJA 3QZWG 3LKSA 4PJXA 3V2AR 4RWYL 3VXNA 4YXKH 4BZ2H 5IB1A 1W0VB 1FV1A 3MX0A 3NFSL 4JN2A 4ODSL 43C9A 1S8DA 2VLKB 1BFVL 4G5ZL 1S3KL 5J3HD 1DVFA 2E9JA 3H42L 4JFDA 1S7WB 4NIKB 1Z6JT 4G8IB 4LLQB 1T2QL 2Q76A 1Z5LA 3OXRA 1T66D 3IXAB 1RZIA 2E27L 1VFAB 1MCOL 4N90D 3ARED 1NAML 4FQCH 3GMNA 1H9VA 4M62H 3PDOA 2VE6B 1FNFA 2KQMA 5H94A 3T3PE 3O0RH 2FSEA 4M6ML 2XNAA 2UUDK 2EDWA 3ULUL 2DL2A 2C3XA 5HHOA 4JFQA 1FYTD 4LLDA 4ODHL 4A2LA 4CNIB 4W6XB 4YK4B 2R29H 2HAZA 1CVRA 4L3EA 2ZOKB 4LPUA 3SO5A 1ZHBA 2VL5B 4Z76A 5JNYB 1VGEL 1FJ1A 2YPKA 4RMSA 4GBXD 4MHHG 3RTQA 2V2TB 5CS7A 2LU4A 4JJHA 1EIBA 2FGWL 4UBDD 1RHFA 2VZTA 3IFPA 3CFEB 5FOBA 4HAFA 2PNDA 2D9CA 3I9GL 3QPQC 3SKMB 4YC2C 4MA3A 4XWOD 3VRIA 1MF2L 2GSGB 1IZJA 3V79C 5JQ6L 4G8GE 3V52H 3P4MB 2ORBL 5MI0C 1RUPH 4ZSOA 1GZQA 4JREB 3VE0A 1EFQA 4PYHA 2CJUL 3MUZ1 4R0LA 4IRJC 3RDTB 1IBGH 1JHTB 2C4FU 4ELMA 1S7XA 3V7AE 1CXEA 1F00I 4XPGL 5EBWB 1NCNA 3LQAC 4OD2B 4GG6B 3O6LH 3HCVA 3EYUL 3MLRL 4KFZC 3VWJC 3U7YL 1UEYA 4MB3A 2CK2A 1HHIA 1R3HB 1IGMH 5E5RB 1TQCB 3LV3A 3MLSH 4O4YL 1AGDA 4MJ2A 2A1WH 5AYQA 1WC7B 5DJ0B 3TYGH 1RI8A 1UKSA 3QDGB 3HC3L 4KY1H 4YHIB 2JJVA 1S5HA 3THML 1T21B 4A6YB 3RWFB 3RNKB 1KCUH 4JCMA 4NUJB 1I9RH 2QQNL 3DVNB 4X99B 3TH3T 4XRCA 4Z7VF 1JTTA 4RAHA 1VSCA 3BP7A 1KIQB 2QSTA 1EV2E 4W70A 1EZVX 1HK6A 2CRZA 4Y16C 4O9HH 1DQQB 1Z9LA 4OLZH 5KBNC 5ESAA 3MV9A 3W9DA 4ORZC 3PHQB 1KV3A 2QADB 1YEFL 1MLBA 3S4SB 2GJJA 4POYA 3PL6B 2HH0H 4L3EB 3LAFA 4WI6A 4JQXA 4LCCB 1N5YH 1G6RB 2O93L 3CFCL 5C08A 3MSPA 3P30L 5EC2B 1NC4D 3CK0L 4KV5F 4YGVB 4IOIB 1CGVA 3GBLA 2GJ6B 1AKJA 4QHUA 5JW4Q 5MEOB 2XQYG 3N85H 5CP3A 1QRKA 4NJ9L 4RA0C 4MA3B 1QBLH 2GCYA 4ZFZB 3QH3A 1MCWW 3X3FH 4BQBA 4XVTH 4XPHH 5HYJA 3KYKH 5DEFA 1AD0A 5CJXA 4X6BB 4ZSOB 4LLUB 4HG4K 1BF8A 1Q94A 4OZHB 1JRHI 4QTIL 1KPVA 1QLFB 1FO0L 1AXSB 2VDMH 4OGXH 2B5IB 4LCIL 4D2NA 1NAMB 2M2DA 2IPUK 2JB6B 4PJFB 5JQ6H 1JGDA 5EBMA 1JI2A 4CN4A 5E08H 4GRWF 1IGIH 4E41A 4GFTB 3KS0J 3TJHC 3QEHA 4WUUE 1ND0B 2FJGB 3MRPA 3O6FB 1D5MB 3EOYG 3SDDB 2H41A 3TA3A 1BEYH 2Y7QB 3C8KA 1E6JH 2CDEB 3LKOB 4XH2B 4JFOA 5CD5C 5IF0A 4S1RH 2DB8A 3SE9L 5E00A 1E4XI 5HVHC 4H8WL 4ZQKA 2VDNL 5DSCA 1RZJC 4N5UA 1DQLH 2PXYB 2V5TA 1TJIL 4U1GC 1MWAL 2AVGA 2QBWA 2ZUWA 3HNTH 3UYRL 1HNGA 5T3ZL 1V3KA 3TIDA 2Y36L 4AENB 3FRUB 4NQDD 2Q86A 3QIUA 5KSVA 2NY1C 4JZJB 4ZUVB 1W72B 5L2KA 3F6IA 4D0BA 1OD7A 2R1XA 3T65B 2UZYB 4Q6IC 5INCB 3FFDA 2E6PA 1ETZB 3FHQA 2I5YH 5DLML 5C0RH 4H0IA 3VFGH 1ZHBB 3C9NB 3C8HA 3H42H 3DVGB 4OKDA 1BP3B 3DI2B 2Q8AH 4MSWB 4Z0XA 3DSFL 4TUJB 2WUCH 1MWAA 5EPMA 2Z92A 3K4ZA 4TTDC 3TJEL 5GZND 3PWUA 5HPMA 5MENE 1OAQL 3CFEA 3EOTL 1UXWA 5FOBB 2XWJA 3SGKC 5HGGS 3WKML 2OL3L 5HGBA 5D7IE 4ODTL 3SE3C 3VG9B 2VN7A 1MFBH 2GSGA 5C8JA 4MQ7B 1INDL 1IFHH 1JN6A 5E4EB 3O3BB 5L7XH 1U8OA 2FJHB 3MRLA 3BMWA 1HCVA 4IBLT 2BVPB 5IMLB 4ENEC 1B3JA 2FRGP 4LEOA 1YEJH 5A16A 1IAIL 4EN3D 3WE6A 1X7QB 3S37L 3DETC 1F2XK 1ZE3C 1JGDB 1EAJA 4L3AA 2BVQA 4LPCA 4PJ9B 5C09D 5SV3A 5IFJB 4RQQB 4JPVL 5DC4B 1ROWA 3HMWL 4GKNA 3RWEA 3WKNA 5IHZB 3HZVB 4FNLH 1KT2B 4UDUB 1RIHH 3STBA 3WN5C 2JJTC 5IF0B 2XY1A 4L4VD 2APXA 2DQCL 3W82A 3O4LA 4LLYB 2X41A 1IJ9A 1X44A 4M9OA 2B5IC 3QCVL 5ANMB 4GRLC 3VXOA 4BJLA 1ZT4B 1HHJB 3K4AA 4Q9RH 4UQ3A 4UV4H 3HC0B 4PGDA 3LRGA 1MI5B 1L7IH 3FRUA 3NGBB 1JGLH 3QIUB 5FHBH 4OZFB 1RPQA 3QFJB 1C16A 3GJFA 4LRNL 4AEIH 3MRJA 1H3PH 3H0TB 1U92A 4XP9L 1I8IB 1LO5A 2V9QA 3WIFB 3F58H 3ZTJH 2Z31D 2OJZH 4GXUM 2IANB 3PP3H 1VFBB 2A6JA 3EJZD 5CEXB 2Q7NA 4RCAA 5B8CB 1RUAL 4HDIA 3BZFB 4M7JH 3TN0D 4ZNEE 3MROB 2CDFB 2N7BA 3INUH 2PN5A 3OJ2C 4EN3B 3DVGA 3VDBA 3PWPB 1F4AA 2ZKHL 1EGJA 4DGVL 3U36B 5ITFA 4L9LB 2ENSA 3LDBB 4IOIA 3RWCB 2XTJC 4UU9A 4AG4H 3H9YA 3WXVH 1IQWL 3DYPA 4Q58C 1W8NA 1R24B 3KPQA 5BS0D 1AQKH 1HWGB 1EJ6A 4Q9RL 4A2MA 5DHXB 4N1EA 5FYLL 5DJYB 3O3BA 2BOCB 2FWOB 1I75A 4LGRB 1U8MA 4LMQI 1S5HB 4YHYB 4CVXA 1T6WA 5D93B 4AQ1B 1ZTXH 1EUTA 3UTTB 1CL7H 1PW3A 5EORL 5GGTH 3GHBL 3DARA 4P5MB 1LO3H 1JWUB 2PF6A 1OWRM 5JOFB 3QO1A 2D7PA 3PIQB 1Y0LB 4TULL 1N3NA 3MV8E 4MLIA 5DT1L 1J5OH 2VTFA 4X80L 1QFHA 1V3JA 3MV9B 4WHTB 1TMCB 2BHUA 1P1ZA 2YN5A 2G75A 5I1CL 3SDCB 2OBGA 5AZEH 3U79A 3O4OB 1PZUB 3ABZA 5LAXA 1P9MA 2XN9E 3KJ6H 4WIQA 2Q8BH 3BN3B 5C7XL 4PREB 2MPAL 4WTWA 1YEEL 4JFYA 1ZLVH 4WWKC 1IFHL 1U8LB 4P2OA 5DZNA 1GXEA 2XFXB 4LAQH 5E6ID 5T1KB 2R9HC 3GMLA 5E7FA 5L2KD 3O2VL 3ME0A 3EGSB 4WNQB 3TJEH 4HK3N 5GGUB 1LO5B 1I1FA 4LU5H 4OFYA 3IDNA 5TFSH 1JUFB 2R56H 1FYTA 3IFLH 5IB3A 2CRYA 3VFGL 4Y2DB 3P73B 1RHHB 1A6PA 5F1NB 4MWFB 1WIUA 1MJ7H 4IS6B 3KLAB 2WUBH 3ULUF 4HC1L 4PLJC 4F57L 4H8WH 1BIIB 3O3EB 4OJFL 1A7PH 2YWZA 3C5ZB 1ZLUK 3NAAH 4S10A 4UILL 4P4KA 1YEEH 1MH5A 3RIFK 1M7DB 5IVXA 1R5WA 1ZEAL 2EXWC 4PG9B 1IGIL 3MRNB 4YPGB 3VH8A 1A6ZA 5MEQA 4I77H 5I1CH 2JK5B 1MVUB 5FUZH 4HUXB 2AJUL 2WBJB 4WI9A 3LEXA 1EX0A 3NPSC 4P5TD 1PD6A 4NWTL 4P9ML 5FYJE 4JFZL 1JWUA 3FQRB 3MGTB 1ONQA 3FONA 1I7UB 3BH8B 2Y72A 4M1GL 4ZD3L 4MNGA 3K7UA 3EJJX 2BXZA 5IVNA 3I3BA 1PKQE 1QFWI 3NZ8B 4U3HA 4KMLB 4G6AC 4R8WH 5B3JE 1K6QL 4LVHC 1DR9A 4B7IA 1UYWH 3LD8C 3ALPA 5J4MA 3LRSB 3MACH 4PB0L 1MHCA 4FP8H 2HWZH 5E5MA 5T1KD 3V6OC 2AXHA 3FZUC 4TPRH 5DJDA 4WW2C 2HFGL 4KQ4L 1G9NL 1E0OB 2VAJA 5K9OB 4M93C 3QWRD 4JHAL 1CDBA 4QEGA 3MRJB 1JN6B 4Q6YA 3EGSA 3UPAA 2WWKT 3RUGB 1ACZA 5D7LE 1EEZB 1I7RA 1CD8A 4BFIB 2V5RA 5F7FA 3BKCL 2IBZX 4YPJA 4Q74A 1VFBA 3P30H 5I8KH 2W65A 4QOKE 3MV8B 1CGYA 1U8NA 5HHQB 1D9KC 2BVOA 3D85D 4HFUH 4NN5B 5C86A 4D9LL 4NPYA 3MGOA 1FORH 2R2BB 4K9EL 1FAIL 5IFJA 2EYRA 3ZO0A 4RQQA 5HGAB 3KJ6L 4RX4A 4JKWA 5ACZA 1OGAE 5JO5A 4LSPH 1MELA 3LHPL 3REVB 3AAZA 2D7TL 1P5UA 3QDGE 1KTDA 2EDHA 4B41A 1TCRA 1CZ8L 2DQCH 3K4DA 5TE6H 4HS6B 4PJBA 3TO2B 5GS2H 4QRUB 1QSFD 1JMZA 2VDLL 4RMRA 3WJLA 2ZPKL 1MJ8L 4PJIF 3IB4A 1D5IH 2QQLH 5HDOA 1QR1B 2A1WL 4D3CH 4K9EC 1NFDB 4PP2B 3BWAB 2H2PC 4PB9H 1CN4A 1XZ0A 5E03A 3OB8A 3PWPD 4HK0A 4PRPE 4DWHA 5DWUH 2AV1B 4MAYC 4PR5A 1IAIH 1XEDA 4BFEA 1G6VK 3KGRA 4PJ7E 4Y88A 4YEFA 3KPPB 5DQJA 2YD9A 2AEPH 5L88H 3ESVF 2FEDD 3LD8B 5EO0B 5DURD 2X10A 4JQVA 1J18A 1YNTB 5FO8B 1QFWM 5DEGA 2VABA 3V5HB 4YHLH 2LQRA 4YBQD 1DANT 4PY7B 1CICC 2DQFB 4DQOH 1BJ1J 3BHBB 5KVFL 4NQVB 3QZWA 4HIIB 4OLWL 3RDTD 3SOBL 3GHEL 1NGWB 4HGKC 3L5HA 4APQB 1AGBB 2NY3C 1F90H 4Q2ZA 1NMAL 4LRNH 4PRBB 1A9BB 1T03H 1VGEH 3TEUA 4PJAE 5JPNB 4NM8L 3HN3A 3FT4A 4F2MB 5HHQA 1JPGB 2DM2A 4K3DL 3FTGB 2H45A 3HUJE 2CMRH 4OGAC 5JW4M 4JG1H 4G9DA 4NPYB 4N8PA 4ODVL 5ID0B 1ZS8B 4I18C 4JHBA 4WUUB 3OV6A 5LCVH 1N59B 2NY6D 1EAPA 5FA4B 3S97C 3VD7A 3VFNA 1JF6A 3T0BA 3CU1A 3STLA 5FK9B 4P59L 5E99H 5IHLB 1SY6L 3W5MA 1AGDB 4NDMB 4PG9A 1Q0XL 3EDFA 3JTSA 3UTZB 4M9PA 2MQ0A 3L95A 1E6JL 4EN3C 3VI4F 3RUGE 4F37F 4LARH 5DD0H 3RNKA 2Y23A 3MUHL 3IS1X 4ZAKD 2YMXL 4PRDB 3X13A 1LILA 1ONQB 3MREA 1CFTB 1WQVT 2NX5E 1CQKA 1Z9SA 4JY5L 2LVCA 1AJ7L 5F1KC 4P3DB 4YHNB 5HXMA 1LD9B 2KL6A 3V0WH 1PBYA 2JJSC 4LMQE 4QRPE 3CH8A 4GXVL 2Z35A 4D9QD 2NXYC 3ULVE 3GSUA 1KACB 4GRLD 5C08B 1YNKH 4Y1AA 2F8XC 4J1UA 2ATKB 3RL2A 2MOVA 4L4TB 5BVJB 4OQTH 3MRDB 3HE7A 3HNSL 3T3PF 4JVPA 4F7EB 4JANA 3HRPA 4W4OC 3W2DL 1KG0A 1A2YA 3QWRA 4UT9L 4TSBL 4EIZC 5EU7C 2Z31C 3ZHLA 4LAQL 1JL8A 5E9DE 1RAMA 4XNZC 5HYJB 2UYLB 1MVUA 2UV3A 4ZO8A 5EWIL 1IILE 2R2EB 3RKPA 3SJVA 1J7VR 1LK3H 2MPAH 3JWOH 3TWCL 4OV5A 1IAKB 5JUEL 1I8MB 3DO3A 3QDJB 4K8RD 5I19L 3OKDA 2XIDA 1D9KD 3U4EB 2IQAB 4X98A 3UTPE 5J11B 1ZS8A 2EH8L 3EO1B 1RJYA 3G6JB 3LKQA 4ERSH 1EO8L 4RAVA 5GS0H 1MRFL 3EJYD 5DJ8A 3RY6A 5BV7C 1EAPB 5F8RC 4MNGB 5FA4A 4M7KH 3AB0B 3TVMC 3M45A 1IC4L 3V5DB 4GAGL 5D2NB 5CWSB 4FQ1H 2C1OB 3VXRD 1NANI 4HV8B 3TYGL 4K23L 5EU3B 1JI1A 1YEGL 1J0HA 4I3RL 3NCYS 2HTLC 4JEGB 1DBJL 1RZ8A 2DWEA 2FH6A 2VDOL 4HXAL 4XWOC 2Q6WA 4DCQA 4FMKA 3QR2A 3KWWA 1SVZA 3D9AL 2XQBH 4XWGL 3PGDB 1D5ZA 4ZUSB 5K59F 1QPXA 2WAHA 1HIMH 3VD3A 5I1JH 1NAKH 4P4RB 1QHPA 4MD0A 4HMDA 4OF5A 5F1IB 5INCA 4GLRI 5JA8B 1FAKT 3FQTB 2DQIL 5D71H 1YUHB 4JHWL 2P7TB 5HHVH 4Q9QL 4ALAH 1CCZA 2V5SA 3MGOB 4GAFB 3VGDA 1NSNL 3IFOA 2D2OA 3MUGB 1ZT7A 1BM3H 3FO9B 5IMKA 4QHKI 2ATKA 4ONOA 4D8PB 1N5YL 3QHFH 3IAPA 4NNXA 4HWEH 1T7ZA 2HT3C 1NMAH 1OTTD 2ICWA 3ES6B 4LLVB 4ONFL 3VA6A 1JHLL 4DGIL 2XZAL 3QUXC 2KPNA 1G9MH 5IW1B 3W11D 4MJ5B 3L7EB 4C59B 1NGWA 1RIVL 1TCRB 2I9TA 4JFFD 3HRZA 5JXAH 4ZXBD 5IVOA 3QEQA 2NXZC 1UB6B 3O11A 2H1PH 3AB0C 3W81A 2QQNH 1B0GB 4OFYD 2EZ0D 5F7EH 2R1WB 5BCAA 1X6NA 5GRWA 5JHDA 4KUZL 2ICWI 3QJHA 4PUBL 4CAGA 3MRCB 3MXVH 2WBWB 1NGYA 2IC2A 4C56A 4I5BB 2EXWD 3AXLA 1BGXL 5ADPL 2WINB 1WWBX 4HV8A 3KS0H 4GUPA 3RBGA 3C6LD 4PB9L 3SY0B 1K4DA 4HIXL 5IVZA 2WW8A 2WM0A 5JW5B 4WJ5B 5IBUG 3A0OA 3IDUA 5D96C 2R4SH 5B39B 5JXEC 1WV7T 2FH8A 5F6HI 2DDQL 3VXOB 3SKJH 4XCNB 5AYUH 3A6BH 4I2XB 4PJBF 2Q6WB 2DQFA 4KZEL 3BXNB 1FHGA 4PGDB 1YNLH 4X5XA 3EYQC 2WIIB 2ERJB 5FCUL 1T7WA 3HAEG 1RK0B 4O5LL 1J12A 1FBIL 3NCCB 5D2LF 3WKMH 1HXYA 1MEXL 5B38G 4N68A 1W72L 3EOTH 1TTGA 2IG2H 1MNUL 4V1DD 3O2DL 3CSBA 3UTSA 3BEWB 4U6XB 4F9PC 2AK1H 1H15A 2MQ3A 2ICEB 3D3VB 4HFUL 5ETUA 3MUGA 2BSRA 1GC1C 3SPVB 4F9LA 3UC0L 1JWSA 3WL9B 4N0CC 3FFCE 1UXSA 4P4KC 1IEAA 1RZJL 3GRWA 3C09B 2ZCLL 5CKAA 2PYEB 1RURH 4KI5D 2FNBA 3QA3A 4MNQD 5HYSB 4F80A 5ICZA 4PBXA 4KXZI 4LKXB 3T1WA 3O45A 4YXLL 4XGZA 3HRZB 1XR9B 4KKCC 4NKMA 1D5XA 2E7HA 1ZK9A 4QRRB 3O2DA 3V4UL 4S1DD 2OK0L 4M5ZH 2CGRL 4WWKA 3CUPB 2DQHH 1TPXC 1XGQB 3BIBX 3ET9F 4YHOH 1T7YA 1U6AL 5JZ7D 4LEXH 5JXEA 2P5EB 3ZSSA 1T03L 1T2QH 1WWWX 2VSDA 3IAGC 5DJ2A 1AHWA 1EZVY 3IDGA 3MNZA 4WDIA 4NKIH 3O8XD 5C0FA 2AS5M 1YPZB 1EVTC 2PW2B 2CDGB 5K59E 2EC9U 3AXLB 5B4MD 4W81A 1BHGA 4DQOL 43CAA 1OHQA 4PRHA 2FIKB 3SY0A 3L7FB 4P3CH 1IGYB 1KJ3L 5IHUH 3FJTA 2R2CA 1FZOA 4KKLD 4NQDB 4LF3A 5TGBB 3ORJA 4OSUH 4MB5A 4IOSD 5KG9B 3TH4T 1U8LA 4DCQB 5EU6D 2OTPA 3VFVA 3HZMA 3TM6A 2UVFA 3NFPB 5GS2D 5FGRA 3FN0L 2R0LL 3QEGL 1TETL 4YFLF 2GITA 4QHNA 5F72S 2P1YA 3EFDH 3PJSA 5DMIL 1FRGH 2E9WA 2J5LC 5I1IL 1H3XA 5E4IA 3HHRB 3SJVB 1A7OL 3HFMH 4I9WE 5DD1H 4HKXB 3DETD 3CZFA 1G7JB 4PBWD 3VGFA 2CKBL 1EHLL 3RL1A 2PYED 1ACYH 1Y6KR 1CICD 5EZOH 1DL7H 1JGUH 4NSKB 1A6TA 2BNRD 4KJYB 1WIOA 2PKDA 1FNSL 1UA6L 4AH2B 1T04B 4G7YH 3D2UD 2IAMC 4NN6C 3SDYL 1ERNA 4PLOB 4P5TB 4E41E 3BZEA 1T0MA 3DOSA 5TDPB 1T2JA 3QEQD 4JN2B 1CGXA 4LLMB 4U31A 5D1XA 2APBA 3VWKB 3B2UC 5I1EL 3UTQB 5F7EL 4HBQA 1KNOB 3QQ4A 2H6PA 1OT2A 1JPFA 3WNMA 2DICA 4S2SA 2IFGA 4HUVB 4Z7UA 4X7TA 5D1QB 3MBXH 1F4XL 2EEBA 3EJZC 3RTQD 5I71C 2WWMC 3SBWC 2ARWA 2VDKL 1J5OL 5I16B 4P23C 1S9WB 2QEJA 4OT1H 4YHML 1MHEB 4H25B 1I1CA 4Y89A 1WJ3A 3T2OA 1JV5B 1N0XH 4HLZG 4Z7QE 4PJDB 2B1AH 3TV3L 4LASL 4XVSL 3H3BC 3M8OH 3CPLB 1S9YA 3B9DA 3DX6A 3I02B 3K1DA 3VFOA 3MRKA 4JHWH 4XXCC 3LMJL 3O6MH 3VWJA 5I74B 2RAMA 4R8WL 3OAUH 2X4UA 3WFBL 3N1QC 4XNMA 3KPTA 4BM7A 2AXGB 4X7DC 4WI3A 1L6XA 3EYQD 3TNNA 1QPPA 3LKPA 3QG6B 3MLYL 1S9KC 3ARSA 2I9LB 2XQBL 4XWGH 2B39A 3DURB 4NKDA 3ESUF 2IPKB 3V95A 2DLFL 4M6OH 2HJKA 2A2QT 4ODUB 3D1MC 4X6CE 1DBBH 5HDBF 4R0LB 2BVUA 4NYLB 3SGKA 1LEIB 1N64H 1CL7I 2DYPA 4EVNA 5EO1B 4LLWA 3MRBB 5FGBC 4KHTL 3X11A 3MUJA 2FR4B 5E2WL 1RFDH 4LKXA 4M62L 1A7PL 3QQ3A 1IEBB 4X4XA 1D5BB 3QEQE 4R7DB 2A6IA 4R26L 1R3HA 3CXHJ 1H0DB 1AGEA 4IRZH 3BDYL 4XCEA 1NBQA 5I15H 1FCCA 1EEYA 5TFSL 4NHCH 1Q9OA 5D5MA 2R69L 1XZ0B 4YQXL 1HE7A 4ZS7H 1DBKH 3JVGC 1RIHL 1MVFA 3BIKB 1FG2B 1T1ZA 3LRHA 4UUJB 3QUXA 1N5AB 3MFFB 1MCDA 4QGTA 1TZHB 5C0BB 1VFMA 4RIRA 4ODWA 4LRIC 2IBZY 5BQ7A 4PLJD 1U8PA 2WP3O 3ISWA 2DM7A 4XNXH 3C5SA 4K7FA 1F11B 5JORB 2YPLB 2PO6C 1URLA 2N4IA 3TIEB 1S7UA 4GS7C 4W4OA 5D2LE 1JE6A 4IIQC 5FUCE 5GS1B 4G6MH 4NQEA 4N8VG 4O5LH 1GL4B 2VO5A 4XCYA 5A2JH 1A47A 1WZ1H 4I0PB 1AGBA 5HI3D 4KZEH 3SKJL 1RMFH 2FDBP 1FVDA 4JO4L 3RWIA 3F12B 1KELL 3S3PA 3QH3B 2BOBA 4K7PX 1HQ4B 2DWDA 3CSYA 4NRYA 4OZFH 4ODXB 3FQNA 3LQAH 5ALBH 3SQOL 4OCMC 4P2OD 3W11C 5KVGH 2H32H 3CVHA 4O2EB 3G04A 4HH9A 4GRLB 1C1EH 3MRBA 4KRLB 3AS3A 2YOCA 5IT2L 3QUYA 4GLRH 1CD1A 4QNPF 5DFWH 5GRJH 4XNQB 3QEHB 1N2RA 2BZDA 3ARVA 3QI9D 4I48A 5T5NF 3VRJB 5D1XB 3KPSD 1DQLL 1AGEB 1TZGL 1U93B 1OAXL 3CDYA 1EHXA 4EUPG 1NJ9A 3WS6A 3ZL4H 3MV7A 2PO6A 4K2UH 4AIZA 5IFHL 4ZQKB 4ODBD 2ZUQC 4MS8C 1R3IH 1CDGA 4PRPD 1XF4B 3RX5A 5GSVB 2X4SA 1PG7X 2C4XA 1S9WA 4AEEA 4DZBA 4HS8H 5D7KD 4LDLB 3U6RA 2AI0H 1DJSA 1A64A 2YEZB 5GRUL 1QYGL 4Y19A 4U6VH 1U8PB 1KBGL 4OLYH 3UAJD 1NGZB 1DBMH 2D7OA 5SWZB 1YJDH 4IHOB 4Y1AB 4G8GA 3I02A 3VFOB 3CU7A 5D71L 2OL3A 1F11A 3ULSB 5DD3H 2GYSA 5ESVA 4EI6A 1WT5A 4DKEL 2G60H 4NUGL 4HBCL 4XBPB 5HDQL 1LO2L 3ARWA 1IM9A 5IM7A 3QEUB 4Y4HB 3ZMRA 4PV8B 3LDBC 2EDDA 1T83A 4M4PA 4Y5VC 2FX7L 4KK8C 3BZEB 4N9GA 2AXFB 5EN2A 3TNMA 3S5LG 3HMXA 5EH1A 4Z8FL 2NTFB 5JHDE 2V7NB 3M8OL 3NACH 3UJIH 2B1AL 3I6GB 4KK6D 1TTFA 1EA9C 1KNOA 2PTTA 2JTDA 3OBAA 5TJWK 3O6FD 2GK0A 3GMRB 4G7VH 4ZO9A 3HAEH 1S78C 4CMMA 4HKJB 3MOBH 3NIGF 3MRMB 2NTSP 3V5DA 2X89D 1QNZL 5CWSA 1J05A 1HHGA 4XHJD 2J8UE 4NZTL 4TUOA 3K80A 3OB0K 4F15C 3W39B 4D0CA 1I9RL 4R3SB 3C08H 1PKQB 4OF6A 4DVRL 3E8UL 2ITCB 1P7QD 4D9LH 4HAGA 3V6FB 2QR0B 3K1KC 2J4WL 1WT5C 5C0RL 1YQVL 4QXUH 4CADB 2OZ4H 1DDHA 1O7VA 5DUBB 3OXSB 5D5ME 2X7LA 3IKCB 1FH5L 5F7WC 5CLWA 3IXAA 3HB3D 5CEYA 2P24A 3OKOB 2YD3A 4K8RL 3QG6A 3LKPB 1GPOL 2H32B 1UKQA 3PWNB 3JV4A 1ZHLB 1RU9H 1VDGA 2FZ3B 3FQTA 1DTUA 4L3CB 5D1QD 4JE4B 5LVEA 4RZCB 4HUUA 2GUOA 4JLRB 5C9KA 4I13B 4GXVH 4JDTH 1RVFH 3GKWH 2ZUYA 4FZEH 2AJXH 1I8LC 5IBLC 3SGDH 5C6WH 3B2VH 3BZFA 4WW2A 4NO3A 4P57B 4Z76B 5D1ZB 5FFLA 3S88H 3I6KA 1UT9A 1S7SB 2IPTL 5BZDB 3PWPA 2YMXH 3FN0H 1HHHB 4L8BB 1WBYB 3NTCH 4WTZA 5CMAA 3VFSA 5IEKB 4DN4H 2V2TA 4I3GA 3D6GA 3HE6B 1EUUA 1OP3H 3VXNB 1B2WH 4IMLA 1YEKH 4OCRH 2HG5A 5E8DH 4OCYH 1WFNA 4JY6B 5LGJB 4HGWB 3ULVF 4FS0A 3VFUB 2VDML 5BZWA 5MHSD 4OI9A 3UDWA 4TN9A 1Q9OB 2BOCA 2FWOA 4QTIH 4RRPA 4Z7WB 3QDMD 1KXTB 1U8KA 4CN6A 3WHE1 2Q76B 5D7IF 5D8JH 1WFTA 1KGCE 5DRNA 3CFJB 1T1YA 1TJHL 4F7MB 1OT1A 4ELMB 1QBLL 4JGMA 2D7MA 5ID1A 3TPKA 4ZUTB 3OKLB 3C6SA 1ZANH 2OSLA 4JZOB 3VXUD 2AQ1A 3GMOB 5C92A 3QUYB 5I73C 4HIJA 4PS4L 4JFPA 2X4QA 3RVWD 4BH8B 4DTGL 3VRJA 1MFDH 4U33A 4DFHA 2R1YA 3H7BB 2OK0H 3WNKA 4GS7B 2JJUA 3WUWA 2XKSA 3PQYA 4HPYH 1WAAA 1FCGA 4ONHB 1KCSH 4Y16D 4X5XB 4P99A 1KC5L 4M48L 3E2HB 5JMOC 2VDPL 4QYOB 3HAEB 3K8LA 2HYMA 1QA9A 1Q1JH 4MS8D 3IRZA 3F5WA 3ULVD 1N6QH 3GFUA 1KIUA 1G7MA 1EBPA 3UTSB 3ROLA 5DHYB 2F58L 5EOTB 1CXLA 1MQKH 2XZCH 1OSZA 1RZKC 5EZJB 3GRWL 2P5WD 4G8EA 1J8HB 2NX5D 3G6AB 5TE4L 5K9QG 4X4ZA 1JHTA 2HT4D 1JNNH 3G04B 5J57B 3H7LA 3I3EA 3T0AA 4Z7UE 1HHHA 5CMAB 3VFSB 4LCWE 5HYSG 1GGIL 1I9JH 5C0CB 2EIDA 1JPTH 1Q9KB 4Y2DD 4P0DA 5DVMA 3NIGE 5DJAB 1AO7D 3BP6A 3G08B 1JNLH 1XF3A 3BVNA 2E6QA 4HIHB 5HHNB 4QF1B 4OUOA 3MRGB 1NLBH 3W0WE 4OQTA 1PSKL 1FN4B 1NJ9B 4Z7NE 3DLQR 3LS4H 2N7AA 3VG0H 1LO0H 2CIIB 4U2ZA 1ADQA 1KB5H 1YECH 2VLKD 4GMSH 3BPLB 3I2CH 5DURB 2IEPA 3MJ9L 3LPFA 3QUZD 4UTBL 5FYKD 3HE7D 3MRFB 2BDNL 5DRNB 1F97A 1MF2H 4YE4L 3ARDA 5CEZL 2O5XL 1GGYA 5J7CC 4ZNCD 3OKLA 1HINH 4PD4K 4ZNEA 1T20A 4GH7B 2VUYA 2EDQA 3NA9L 4XNYH 4GG8B 4XPAH 1B6UA 1QSVA 2EEDA 4CMHB 3BD5A 5E1AB 5DF0A 4F33A 4DAGH 3PHQA 3NN8A 3CMGA 3S6CA 4TNVF 4M7JL 3WSQL 1U3HC 1GYAA 3S36X 1CXIA 3ZDYF 2YBRB 3O6KL 4ZXBC 4JPKL 2VXSH 4MXVF 3EOAA 1A6VL 3TGXA 1XH3A 3D39B 4OF0A 4YHPB 2OP4L 4QCIB 1I8LA 3HB3C 1CR9L 4P5KB 5IK3B 4GRMB 4ZUVA 2E7MA 4WEBL 5I71B 2YUVA 5EOTA 1NCAL 4R90H 4TQEH 3RUGA 3GMPA 4NZRH 5FGCE 4WY7H 3ZTNH 4EOWH 5DS8A 5SWSD 5EA0H 1HH9A 3NIDF 4OZHA 2CO7B 4UAOB 5TDOA 3MV8A 3RWDA 1UH4A 1QFUL 5CBEB 4ORGB 3L3HA 1B6DA 3L5XL 1I4FB 2QQQA 1AR2A 4DEPB 3CSGA 4RGOH 2YD1A 1RVFL 5HVWA 4S1QH 5DD5H 5TDPA 1UXWB 2W9LA 3QIWA 1AIFA 2XV6B 3U7AA 5BZWB 4RMUA 5BO1L 1KENL 1A5FH 5D7IA 5I17A 1JPFB 4YZFF 4KMQA 4FQ1L 4ZO7A 3FB6A 3FO2A 3RWFA 1KPRA 3TBTB 4M3KB 1ZHLA 4OJFH 1MHEA 2VZVA 4H25A 4XRCB 5LGKA 1P69B 5K9QI 4PRIB 2WUBL 2K9UA 3VMNA 3SDAA 2MNUA 1SEBB 1JV5A 4N0CD 2B1HL 1LE5B 4XB8A 3WFZA 5B21A 2Y25A 4UDTA 4WHCA 1CLYL 4YXHL 1K8DB 1OTSC 2VLJB 5D5MF 1MLBB 3RVWC 5T1MB 1PY9A 3NABH 3VWKD 4Z95L 2BP3A 1NCUA 1L9MA 2X4UB 5CJBA 3MV7E 3ZYOA 5DK3A 5EZOL 4S1DC 5IEKA 4X83A 4M61B 5E2JA 2DQGL 2J3SA 4K3EL 2EE3A 1ES0A 4NBZB 4QTHA 4PRPA 5C0AB 1YEIH 4KJWD 3F8UB 4Z7UF 1U95B 3LPWA 4G9FB 3DURA 1FNGB 4F7TA 1RJZA 2Y07H 3B6SA 4HEME 4XP4L 1CICA 1DANU 1MCJA 1BF2A 1MWAH 3VXRB 1CFNB 2RBLA 3VGBA 4OZ4B 3RKDC 4XC1L 2VSCA 4PRBA 2XXCB 1ZSDA 1A8JH 3W9EB 4LHUB 2BVPA 4HQQH 3LIZH 3RWDB 3PWVA 4GW5A 3FTGA 1GIGL 2CDFA 2F19H 2DYPB 4OSUL 1T1XA 4ZTPL 3S4SG 3QUML 5ID0A 4M5YL 3UX9B 3L9RB 1INEL 1U2CA 4FQLL 3QWQB 5L8KB 3BZ4A 3OJVC 3DJ9A 4GKNB 2NY4B 1AXTH 3VFNB 5IB1B 4MCZB 3ULUC 4X4YA 1RZGB 1AO7E 1R24A 3EW3B 3MRGA 5I9QC 1QBAA 5SX5K 3X3GL 5LXGL 4NZJA 4D9RD 3SGDI 3BT2L 3PQYB 1A6UL 1S78D 3UTZA 3ZKNC 2AABH 5T1LB 1L0YA 1AR1D 5CCKH 1CDCA 4P59H 1U8MB 2ED9A 4JO2L 1MOEA 4NZUL 1UWGL 1C5CH 3ARDB 4M8VA 4WTXA 3HC0A 2KH2B 3QUZC 4MNQA 1G7MB 4MXVE 2AEQH 4NJ9H 4ZDHA 5DRXB 5JOFA 1N7ML 3QO1B 3GJFB 1MFEL 2EDOA 4GKSA 4WWKD 2AEIT 1ZLSL 5L2JB 3SDCC 2EDFA 4G8EB 4YH6A 3RVVC 2VIRB 4W68A 4CNIA 4M7ZC 2IAMD 3G5ZA 3RY6C 5CHNB 2R2HA 3FCTA 1JWMB 3KDMA 3PDGA 5IWLC 2XTJD 1IAIM 4J3WA 2MCPL 1N4XH 4N8VB 1U3HD 3EOAB 4L9LA 1XGRB 4O9HL 1GH7A 3O8XA 2IH1B 4X0KB 1Y6NR 4M7ZB 5HPMB 3QCUH 4RDQF 4KAQL 4MQTB 2X70A 1EDQA 1V7NH 5D2NC 4YHLL 5KS9E 1KELH 1WSST 4QF1A 3DECA 4R4BA 2DM4A 4NC1E 3RJQB 3TVMB 1KEMH 4DUVA 3OL2A 1KCUL 1BZ7A 2W59A 1KJ2H 2XA8H 1YMHA 5SWSA 3RTQC 4NRYB 3THMH 3MCG1 3CFDB 1FL3A 1QSEA 4PJEA 4XP6H 3HG1B 2DLTA 3GSVB 1M1SA 3ZKSD 2AGJH 1I3GL 1EJOH 3T4YB 5DR5H 5I1DA 4TRPH 4XMLH 2MSPA 5JPMA 3DXAB 1BQHG 2UWEA 5MHSE 4XP4H 1MFCH 4D0DA 4XBEH 3O3AB 5E8NB 4Z7NF 1D9KA 3MGAA 2GSIB 5EIQA 3HUJF 1BGXH 2OMBA 5ADPH 3ZT5A 3JV5A 4ZUWA 1CE1H 3MC0A 3D18A 1IBGL 1FYTE 4RX4D 1CU4L 3G5YB 3U9PL 3WLWC 1FQ9C 4YHZH 4AEHH 4BZ1L 4YQXH 2ZUUA 1BREA 3FT2A 3LB6C 4DKFH 2X6MA 1ZGLM 2EH7H 3DRQB 4P2QB 1A6AA 3M17A 4ZDHB 2GTZA 5DRXA 2EEAA 2DQDL 1UH2A 5IKCA 2M8XA 1KCLA 4MAYA 5K9KB 5ISZE 1U92B 3BH8A 1JNJA 2XOTA 5IB5B 4WNQA 3MJ7B 4Y5VB 4OQ1A 4GKSB 5DS8B 1RFDL 1V8HA 3GGWA 4X7SH 2OLDA 4X9BA 2VLJA 3MJ6A 4E41D 1IGTA 2EICA 2P8MB 5GJSL 3GK8H 4HWEL 4U3XA 4IS6A 1F3JB 3KPOA 4KKNA 3RZCC 3UTOA 1KENH 5CSZA 1P4BH 2XY2A 1AD9A 4MMXC 3VFWB 4YR6B 1IC5L 4NNXB 2C3VB 4Z8FH 3GIVB 4U4BA 4HUWA 1FV1B 1NUFA 5DFTA 3IFNH 5DJDB 5TDNB 2F15A 2HLFD 3MMEA 1FNGA 5I8EB 1J1XH 3TVMA 4RGOL 1UWGH 4ZFZA 1AGFA 2DTMH 4XAWH 1V3LA 4HXBH 1B4JL 5GRVL 5I17B 4U0QB 3RWJA 1QFUH 2HT4C 5AWNL 1YEDB 3QIBB 4HUXA 1JPSH 4NGHH 5D7JD 4M7LL 3GSVA 1HCFX 1XAUA 1LP9F 1QLFA 2VXVH 1Z9OA 5T5FL 4R90L 1QHOA 1ZA6B 2PCPA 3JSSA 3WHXB 2R2BA 2AI0L 3SDXF 1UWEL 2Z8WC 4I3SL 1MY5A 3H9SD 2IFFH 3SDAB 1NGYB 3DUSB 5C9JB 1EHNA 1GCFA 3U4BL 1RZGA 3BRFA 1QLRA 2FX8H 2LABA 3P4LA 4PJ7A 5DJCB 4PY8J 2CDEA 3H9SE 1EEUA 1F3DH 1MHPL 1A22B 2JIXA 3ARFD 5I1KH 1WCQA 2AW2A 4PJGE 4B5EA 3F7YA 3QNZB 4ERSL 2BY3A 1H5BA 4OKVB 2VLMD 4M8QA 2NY0C 5EBLB 6FABL 3GMMB 3ZHKA 4XPTL 3DVNA 5GHWL 4LBEB 3QDMB 4JO3L 4WU5A 2PXYC 4OCWL 5C07B 3BPLC 5D7KE 1N0LA 4QRQA 3MRRA 4K3EH 5GS3A 2VQUA 5DA4A 1FZKB 4YDLC 5IV2B 5ESAB 2ATPB 4TSBH 3KLHC 1JUFA 4Q0XL 2N56A 3G5ZB 3X17A 1IGTB 5CZVH 4I4WA 3BEVA 4N9OB 3C5JA 4U1IB 3QRGH 3FKUS 4JDZA 1GVIA 3UTSD 2BSRB 4KVCH 3EO9H 4G3YL 5BVPL 2C3GA 3QG7L 4M1DL 1N8ZB 1EH9A 4NKQB 1MHHA 2HTKC 2V7HA 4JFEB 4OGAD 5H2BB 4NQVA 3WJLC 1XF2B 3UMTA 3U4BH 1A7RH 2P8LB 4JY5H 3MRNA 4YPGA 2K1MA 2D7QA 1LHZA 3WD5H 5E1HB 3B5HA 1QSFB 3U1SH 3WIHL 3QDGA 2XWTA 4CVZB 5JDSB 5E0QA 4GKZA 5E6ZA 3GRWH 4CMHC 4NUJA 3BKYL 1T6VN 2XZQL 3N1GC 4WV1C 3HPLA 2FEEL 2NXYB 3FOMB 4BUHA 4MNHA 4MZ3A 5E8NA 2EXYD 3MFGB 4IDLA 5EBGA 1Q0XH 2AV1A 4HXBL 5GGSB 1ZTXL 4RFOL 2Z0BA 1T0PB 5L6YH 1DQQA 5DFVC 4X4ME 1TFHA 5K9JL 1Q9WB 3FN9A 4WFFE 4QOKA 5T5FH 1NCCH 2HKFH 1JGVH 4KXZH 2CLRA 3K8MA 2HA1A 3S36L 4MXQC 4NHCL 3GJEA 2Z93A 3L7FA 1E4JA 1EGJH 4XP5H 5EC2A 4KTYA 3L95B 3EO0A 1L6ZA 3R4DA 4V1DB 2VABB 3WLWD 1MIML 4L8CB 4DTGH 1X3DA 4IJ3B 4XAWL 1T4KB 1AKJB 5CILH 4KK6C 5FO7B 1ORQA 5DJXA 3MLPA 1JCKA 2NY3D 2AJVH 4OZFA 4PRDA 3V4UH 4MAYB 1T7VA 3MRRB 4YXLH 4G6KL 1N64L 2UWEF 3NCFB 3GHEH 4XZUA 4CVUA 3BQUA 3O81A 2CUMA 4GAJH 5CZKA 3IU4L 3L1OL 5IBUB 1P6FA 2ARJB 4HDIB 3EIFA 3P3YA 3ARUA 1HILB 1REIA 1BD2D 2NY6C 3UZEA 4F9LC 5EUOE 3UC0H 3AY4C 3UBXB 1AD9B 1ITBB 4WUUA 4YHZL 5BS0B 2Z92B 4N8CH 5EU4A 4UU9B 4YFDB 5DJAA 1RZ7H 5CILL 3MLZH 2DQDH 5F7DA 4FQJL 3TBYA 5HGBB 3SDXE 4AH2A 1I3RB 2J6EA 3C8KB 1G7IA 2A6KB 4APQC 4UNVA 2FB4L 2BJML 4WENB 2DQUH 4P9HC 1QD0A 1MEXH 5DJYA 2CIIA 3TO2A 3GUTB 1CLZL 5HHXL 1BFVH 3MYJB 4G5ZH 4UOW1 5TQ0H 2EIEA 5HJ3B 2B2XL 3CVIL 4PJGF 4FNLL 3BISA 4BZ2L 3V7AG 3DRQA 3TT3L 5I1AB 5KAQG 2QV2A 2JCCB 4WGWB 3L3DB 1DN0B 1KIRB 5DQ9A 4J8RB 3UO1H 2J8UA 1UM6L 5DC0A 5IJVB 4JJ5B 4XT1C 5LGHL 2K3TA 1FZMA 1MFCL 1KTRL 2IAND 2KZWA 5GGVL 4EUPA 5GIRA 4F33B 3LHPH 5DQJB 3NFNA 5KAQF 1LQSR 1U58A 1XIWC 4QWWC 5GRXG 5KJRH 1A14H 2KKQA 3NMEA 5C0IA 1YQVH 5J9PB 1KCKA 1J1PH 5C0AE 1JYXA 3BPOC 3BDBA 4BH7A 1CXHA 1WEJL 1I1YA 2ZNXA 1SYVA 3MCLL 2Z8VC 4HZAA 1LWRA 2HRPL 2LV4A 3GM8A 4JCLA 3QFJA 1V7NL 1J10A 2E3VA 4C83B 4G7YL 4APQA 3TBWA 5CP7B 3VW3L 3BP5B 4Y8DC 4PJIE 3RWJB 3TNNB 3MRLB 3VXMB 5JPNA 2CR6A 5DHVH 4G7VL 2XZAH 4QRPB 2ARJA 4ZS6C 1ZT1B 5IB3B 2BHZA 1OLLA 3P11H 4Y2DA 4EKXA 1CQYA 5L9DH 1U3YA 2C3WA 2CKBH 6CGTA 1EHLH 2YHGA 2HWZL 2EYTB 1SJXA 4NC2B 1N59A 4GQ9L 3WFHB 4PJ7F 4PJXE 4TNWF 1UYWL 1LEIA 3H2WA 4KK5D 3SQBA 2HKFL 1S8DB 4X5LA 4PJ5E 3RJDA 5CGTA 2Y5TA 1S9VA 2X4NA 2HTLD 3ZT6A 3MR9A 1OQXA 4E0RB 4CVXB 2XZQH 1MCNA 3FO0H 5I66B 2GY5A 4LPYA 4HQQL 4LAJH 4LBEA 5D5MB 3X13B 2BNUA 3VJ6A 5LWYH 1D5ZB 4ZUSA 4MNHB 3DTXB 2R0ZL 3NGBC 4J8RA 3EFFA 3QUXB 4DN4L 3BGFB 5J1AA 1MJUH 1J86A 1EK3A 3MJGX 5JOPE 2EDXA 2ZCKL 4U6YB 3IVKA 5F3BB 1KTLB 1YUHA 2CLRB 3RWGB 5FGSA 3P4OA 1EO8H 2DTML 1OGAD 3A67L 3EO0B 1OTTC 2RIKA 1AQDA 2XXMB 5FYJL 2HLAB 1ES0B 4HWBA 2C26A 2NY1D 2XA3A 4S0SD 3VXPB 3T2PA 4GQ9H 4TSAH 1M71A 1CLYH 5CIPH 4CVWA 4YXHH 3S8WA 4JKMA 5MERA 5JW3H 1SBBA 2J88L 1SHMA 2P8LA 3LH2L 1FFQA 3GNMH 3MLWL 1BQSA 4OZ4A 3BQUD 4MJ6B 5GSRA 2XWTB 4R2GB 5C6TH 4U1LB 1QFOA 4KRMB 1WIPA 4OV5B 1IAKA 5MENA 3RZCD 1I8MA 1T2XA 1XMWA 3UJTH 1B0GA 3P73A 1X4XA 1S5IH 4AJ0A 4YHYC 3CX5K 5KSUA 5D96B 5F9DC 1IKFL 3U4EA 4I0PC 4OD2A 4GG6A 3WHE0 2HRPH 3CXDH 3OZ9L 2HJFB 1ZLWK 1VENA 3FFCA 4DOHB 2X4OB 1TQBB 5HGAA 1WAAF 3SKUD 2HVJA 4NNYB 3GSNA 1H3WM 1QNZH 4M6NL 5CJOH 4O2CB 2PYEA 3IDJA 1J1PL 3RIAF 2MWCA 3FT3A 4MNQE 3IETA 2LVEA 4ZMAT 1X5KA 4ENED 5C0GB 4O4YH 5E6YA 4AT6A 4F7PA 4HX1A 5F97E 3FHAA 5E6IA 1MRCH 1T21A 5B39A 3BPNC 3U7YH 3GKZA 1YZZA 1BPVA 1CFSB 1TDQA 4XX1E 1A1NA 1OCWH 2JE8A 4L3ED 4U0RC 4KRPD 3REWA 2OQJA 4NZRL 4NFDA 1HXYB 5EUOA 2X4SB 5FM5M 1I1FB 3QAZB 2PW2A 2CIKB 4Y4KB 1A1MB 1RULH 3WBDA 3L5XH 4YZFE 4GBXB 2EIZA 5HY9A 3MA9L 1F5WA 1UJ3A 2NY0D 5SWZA 1XIWD 3WDJA 1OWWA 4C56E 4JPKH 2D9QB 1NUNB 3MO1A 3IU4H 4KTEH 4ODVH 3BI9X 1D7FA 4XXCA 2VL4A 5I76A 5GJSH 1QSEE 5F1OB 2JF1A 4MD5B 4X8JA 5TQ2H 1RUML 3TPUA 5C0CE 2J5LB 3OKKA 4C83A 3KLHD 1A6VH 3T0EE 2X1WL 4P3WA 1EFXB 5I1HH 5D7LD 3CUPA 5C2BL 3U7WH 3ULUH 4TUKL 1OAXH 3SEPA 2F54B 5I1AA 4ALAL 2JCCA 3QCVH 3I50H 1BQHB 1FDLH 4W4NA 1G0DA 3S35L 3VD9A 5DJ2B 3FFCB 4KWUA 3NA9H 4XNYL 1RJLA 2YK1L 2X4TA 4JRYE 1PSKH 5GIRB 1UWXH 1NGXB 2D0HA 4UTAL 4OCXL 4U1HB 5F9AC 5T3ZD 4LHJB 3JTSB 3LQAL 1T5XA 1NCCL 3EDDA 1NC2A 4RNRB 4PTUA 1XCQA 4JM2C 1ZV5A 1U3ZA 1BZ9A 4OIIL 2ZOLB 3CFBA 4MHHI 1KEGL 5KG9A 3QDME 1SYVB 4JO4H 4QNPE 2ZPKH 2E7LC 3M17B 4P49A 4JZJA 4XP6L 3BD4A 4HK3J 4HK0B 3QO0B 4HJJH 3MJ7A 2VR9A 4JGUA 4Y5VA 2CRIA 1LO4L 3PABB 4JR9H 2D7TH 1J1OL 2OI9C 1MRFH 1ZVHA 3CXDL 5FDYA 3WDIA 1IKNA 1NEZA 3PL6D 1S9XA 1VEOA 5FGCB 3KPOB 5FM8A 5IR1A 2CO6B 5CIPA 3ZE0F 3AREB 2BK8A 3WL9A 4OCSH 4P46D 4WW2B 2WSKA 3K2UL 1VACB 3FB5B 3L3OA 3QCTH 2I5YL 4NQSA 5DVKA 5I0DA 4HFWA 2VISA 1AFVH 1NFIA 2BVEA 1QSED 4U1MB 4ZSOE 5KZCB 1HN1A 3HI5L 4Y5YA 1ULVA 4JY4B 2DBLH 1JIBA 2H9GB 3WXWH 1KPUB 1LE9A 4PJGA 1PX4A 4XP1H 2UZIL 4FA8A 1A3QA 2R69H 3LOWA 3RHWF 3WS6C 5I15L 3WJJC 1UCTA 4PJXF 4K71C 1U91B 3MZTA 4Z7WA 2WWMD 3OF6A 2G2RB 5KS9F 3SDCD 4WDIB 2AABL 2EE2A 4JFHD 5IHZA 1K5NB 2R0KH 3VXTA 3S5LB 2XN9D 3JZ7A 5LWYL 3ULUE 2VR4A 2P42B 2X2YA 3L3IA 1YMMA 1OL0A 1Q72L 4OZFG 2X4QB 1A9EB 2FX9L 1KN2L 3V0VB 2A6IB 3CPLA 4LCCC 1XCQB 4MGXA 2HJLA 5C07D 1U8HA 3LEVH 3PHOB 3VXUB 5DRWB 3SDDD 2ZZUT 4ONHA 4NCDA 3OKYA 1KLGB 3WS3A 2RQ8A 4UT7L 1YEKL 3REWB 1J0KA 2AXGA 3DYOA 5IW6B 4J3SA 5I2IA 4WFHD 2IMMA 3ULVH 1ZEAH 4PJHB 1EEQA 1H3GA 1BECA 3IDYB 2BC4B 2H26A 2EIZB 4R97C 5HY9B 3GI8H 5BS0E 4G9DB 2VLLB 3T1FB 4JDZB 4FZEL 3FZUD 3R06B 1KJVB 4P2QD 3MO1B 4UINH 2HJFA 2I24N 4JDTL 3CLEL 5ENWA 1Q38A 1OB1B 4KMTL 2NY7L 5ALCH 1NGQH 4IJ3C 3VDAA 3UJJH 3Q5OA