2IIEA

Single chain integration host factor protein (scihf2) in complex with dna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
204
structure length
204
Chain Sequence
MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGGSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Divalent Metal-mediated Switch Controlling Protein-induced DNA Bending
pubmed doi rcsb
molecule keywords Phage P H' site
molecule tags Recombination/dna
source organism Escherichia coli
total genus 55
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 2iieA01
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 2iieA02
4YEWA 2IIEA 1OUZA 5L8ZA 4YEWC 1P78A 2HT0A 1EXEA 1WTUA 5EKAA 1IHFB 2O97B 2IIFA 1OWGA 1B8ZA 1OWFA 4YFTA 3RHIA 4YFTC 1P51A 4YEXA 4QJUA 1RIYA 5FBMA 2NDPA 1MULA 1IHFA 1OUZB 2O97A 2NP2A 4YF0A 4DKYA 4PT4A 2HT0B 4YFHA 4P3VA 4QJNA 1OWGB 1HUUA 4FMRA 4YEYA 1OWFB 1P71A 4N1VA 1HUEA
chains in the Genus database with same CATH superfamily
4YEWA 2IIEA 1OUZA 5L8ZA 4YEWC 1P78A 2HT0A 1EXEA 1WTUA 5EKAA 1IHFB 2O97B 2IIFA 1OWGA 1B8ZA 1OWFA 4YFTA 3RHIA 4YFTC 1P51A 4YEXA 4QJUA 1RIYA 5FBMA 2NDPA 1MULA 1IHFA 1OUZB 2O97A 2NP2A 4YF0A 4DKYA 4PT4A 2HT0B 4YFHA 4P3VA 4QJNA 1OWGB 1HUUA 4FMRA 4YEYA 1OWFB 1P71A 4N1VA 1HUEA
chains in the Genus database with same CATH topology
4YEWA 2IIEA 1OUZA 5L8ZA 4YEWC 1P78A 2HT0A 1EXEA 1WTUA 5EKAA 1IHFB 2O97B 2IIFA 1OWGA 1B8ZA 1OWFA 4YFTA 3RHIA 4YFTC 1P51A 4YEXA 4QJUA 1RIYA 5FBMA 2NDPA 1MULA 1IHFA 1OUZB 2O97A 2NP2A 4YF0A 4DKYA 4PT4A 2HT0B 4YFHA 4P3VA 4QJNA 1OWGB 1HUUA 4FMRA 4YEYA 1OWFB 1P71A 4N1VA 1HUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEW A;  2IIE A;  1OUZ A;  5L8Z A;  4YEW C;  1P78 A;  2HT0 A;  1EXE A;  1WTU A;  5EKA A;  1IHF B;  2O97 B;  2IIF A;  1OWG A;  1B8Z A;  1OWF A;  4YFT A;  3RHI A;  4YFT C;  1P51 A;  4YEX A;  4QJU A;  1RIY A;  5FBM A;  2NDP A;  1MUL A;  1IHF A;  1OUZ B;  2O97 A;  2NP2 A;  4YF0 A;  4DKY A;  4PT4 A;  2HT0 B;  4YFH A;  4P3V A;  4QJN A;  1OWG B;  1HUU A;  4FMR A;  4YEY A;  1OWF B;  1P71 A;  4N1V A;  1HUE A; 
#chains in the Genus database with same CATH topology
 4YEW A;  2IIE A;  1OUZ A;  5L8Z A;  4YEW C;  1P78 A;  2HT0 A;  1EXE A;  1WTU A;  5EKA A;  1IHF B;  2O97 B;  2IIF A;  1OWG A;  1B8Z A;  1OWF A;  4YFT A;  3RHI A;  4YFT C;  1P51 A;  4YEX A;  4QJU A;  1RIY A;  5FBM A;  2NDP A;  1MUL A;  1IHF A;  1OUZ B;  2O97 A;  2NP2 A;  4YF0 A;  4DKY A;  4PT4 A;  2HT0 B;  4YFH A;  4P3V A;  4QJN A;  1OWG B;  1HUU A;  4FMR A;  4YEY A;  1OWF B;  1P71 A;  4N1V A;  1HUE A; 
#chains in the Genus database with same CATH homology
 4YEW A;  2IIE A;  1OUZ A;  5L8Z A;  4YEW C;  1P78 A;  2HT0 A;  1EXE A;  1WTU A;  5EKA A;  1IHF B;  2O97 B;  2IIF A;  1OWG A;  1B8Z A;  1OWF A;  4YFT A;  3RHI A;  4YFT C;  1P51 A;  4YEX A;  4QJU A;  1RIY A;  5FBM A;  2NDP A;  1MUL A;  1IHF A;  1OUZ B;  2O97 A;  2NP2 A;  4YF0 A;  4DKY A;  4PT4 A;  2HT0 B;  4YFH A;  4P3V A;  4QJN A;  1OWG B;  1HUU A;  4FMR A;  4YEY A;  1OWF B;  1P71 A;  4N1V A;  1HUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...