2IIFA

Single chain integration host factor mutant protein (scihf2-k45ae) in complex with dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
204
structure length
204
Chain Sequence
MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVELSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGGSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Divalent Metal-mediated Switch Controlling Protein-induced DNA Bending
pubmed doi rcsb
molecule keywords Phage P H' site
molecule tags Recombination/dna
source organism Escherichia coli
total genus 48
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 2iifA01
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 2iifA02
1MULA 4YEWC 5FBMA 1IHFB 1B8ZA 2HT0B 1HUUA 1OWFA 4P3VA 4YEYA 2IIFA 2O97B 4YFTC 4YFHA 1OWGB 1IHFA 3RHIA 1P71A 1OUZB 1P78A 5L8ZA 4DKYA 4FMRA 1P51A 2HT0A 4N1VA 1RIYA 4YEWA 1HUEA 1EXEA 4YF0A 2O97A 4QJUA 2NDPA 4QJNA 4YEXA 1OWGA 4PT4A 1OWFB 2IIEA 1WTUA 2NP2A 1OUZA 5EKAA 4YFTA
chains in the Genus database with same CATH superfamily
1MULA 4YEWC 5FBMA 1IHFB 1B8ZA 2HT0B 1HUUA 1OWFA 4P3VA 4YEYA 2IIFA 2O97B 4YFTC 4YFHA 1OWGB 1IHFA 3RHIA 1P71A 1OUZB 1P78A 5L8ZA 4DKYA 4FMRA 1P51A 2HT0A 4N1VA 1RIYA 4YEWA 1HUEA 1EXEA 4YF0A 2O97A 4QJUA 2NDPA 4QJNA 4YEXA 1OWGA 4PT4A 1OWFB 2IIEA 1WTUA 2NP2A 1OUZA 5EKAA 4YFTA
chains in the Genus database with same CATH topology
1MULA 4YEWC 5FBMA 1IHFB 1B8ZA 2HT0B 1HUUA 1OWFA 4P3VA 4YEYA 2IIFA 2O97B 4YFTC 4YFHA 1OWGB 1IHFA 3RHIA 1P71A 1OUZB 1P78A 5L8ZA 4DKYA 4FMRA 1P51A 2HT0A 4N1VA 1RIYA 4YEWA 1HUEA 1EXEA 4YF0A 2O97A 4QJUA 2NDPA 4QJNA 4YEXA 1OWGA 4PT4A 1OWFB 2IIEA 1WTUA 2NP2A 1OUZA 5EKAA 4YFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUL A;  4YEW C;  5FBM A;  1IHF B;  1B8Z A;  2HT0 B;  1HUU A;  1OWF A;  4P3V A;  4YEY A;  2IIF A;  2O97 B;  4YFT C;  4YFH A;  1OWG B;  1IHF A;  3RHI A;  1P71 A;  1OUZ B;  1P78 A;  5L8Z A;  4DKY A;  4FMR A;  1P51 A;  2HT0 A;  4N1V A;  1RIY A;  4YEW A;  1HUE A;  1EXE A;  4YF0 A;  2O97 A;  4QJU A;  2NDP A;  4QJN A;  4YEX A;  1OWG A;  4PT4 A;  1OWF B;  2IIE A;  1WTU A;  2NP2 A;  1OUZ A;  5EKA A;  4YFT A; 
#chains in the Genus database with same CATH topology
 1MUL A;  4YEW C;  5FBM A;  1IHF B;  1B8Z A;  2HT0 B;  1HUU A;  1OWF A;  4P3V A;  4YEY A;  2IIF A;  2O97 B;  4YFT C;  4YFH A;  1OWG B;  1IHF A;  3RHI A;  1P71 A;  1OUZ B;  1P78 A;  5L8Z A;  4DKY A;  4FMR A;  1P51 A;  2HT0 A;  4N1V A;  1RIY A;  4YEW A;  1HUE A;  1EXE A;  4YF0 A;  2O97 A;  4QJU A;  2NDP A;  4QJN A;  4YEX A;  1OWG A;  4PT4 A;  1OWF B;  2IIE A;  1WTU A;  2NP2 A;  1OUZ A;  5EKA A;  4YFT A; 
#chains in the Genus database with same CATH homology
 1MUL A;  4YEW C;  5FBM A;  1IHF B;  1B8Z A;  2HT0 B;  1HUU A;  1OWF A;  4P3V A;  4YEY A;  2IIF A;  2O97 B;  4YFT C;  4YFH A;  1OWG B;  1IHF A;  3RHI A;  1P71 A;  1OUZ B;  1P78 A;  5L8Z A;  4DKY A;  4FMR A;  1P51 A;  2HT0 A;  4N1V A;  1RIY A;  4YEW A;  1HUE A;  1EXE A;  4YF0 A;  2O97 A;  4QJU A;  2NDP A;  4QJN A;  4YEX A;  1OWG A;  4PT4 A;  1OWF B;  2IIE A;  1WTU A;  2NP2 A;  1OUZ A;  5EKA A;  4YFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...