2J0GA

L-ficolin complexed to n-acetyl-mannosamine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
212
Chain Sequence
b'GPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 69
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j0gA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j0gA02
1N86C 1N86B 2J2PA 2FIBA 2H43B 1Z3UA 1Z3SA 4R9TA 1FICA 3H32C 3H32B 2J60A 4JYOX 2XNXC 2XNXB 2J64A 2JHLF 2Q9IC 3FIBA 1FZCB 2HODC 4R9JA 2J0YA 1LT9C 1LT9B 2FFDC 2FFDB 2D39A 2JHIF 3GHGC 2OYIB 2H43C 1FZGC 1FZGB 2JHMF 2J1GA 1FZDA 2Z4EC 2Z4EB 3E1IC 3E1IB 2J3OA 1FZCC 2J3UA 2WNPF 1FZBB 3HUSC 3HUSB 1FZFC 1FZFB 2J3FD 2OYHC 2OYHB 4NYTA 4EPUA 4ZFGA 2HPCC 1FIBA 2HPCB 2OYIC 2J5ZA 1FIDA 1RF1B 4M7FA 1JC9A 4JZCA 4M7HA 2J61A 1LWUC 1LWUB 2HLOC 2HLOB 1RF0B 3BVHC 3BVHB 2GY7A 2JHKF 2J3GA 1FZBC 2JHHC 2J0GA 1FZAC 1FZAB 1FZEC 1FZEB 1RE3C 1RE3B 2J3FA 1RE4C 1RE4B 1N73C 1N73B 1RF1C 2J61B 2Q9IB 2HODB 2J0HA 1M1JC 1LTJC 1LTJB 1M1JB 1RF0C
chains in the Genus database with same CATH superfamily
1N86C 1N86B 2J2PA 2FIBA 2H43B 1Z3UA 1Z3SA 4R9TA 1FICA 3H32C 3H32B 2J60A 4JYOX 2XNXC 2XNXB 2J64A 2JHLF 2Q9IC 3FIBA 1FZCB 2HODC 4R9JA 2J0YA 1LT9C 1LT9B 2FFDC 2FFDB 2D39A 2JHIF 3GHGC 3GHGB 2OYIB 2H43C 1FZGC 1FZGB 2JHMF 2J1GA 1FZDA 2Z4EC 2Z4EB 3E1IC 3E1IB 2J3OA 1FZCC 2J3UA 2WNPF 1FZBB 3HUSC 3HUSB 1FZFC 1FZFB 2J3FD 2OYHC 2OYHB 4NYTA 4EPUA 4ZFGA 2HPCC 1FIBA 2HPCB 2OYIC 2J5ZA 1FIDA 1RF1B 4M7FA 1JC9A 4JZCA 4M7HA 2J61A 1LWUC 1LWUB 2HLOC 2HLOB 1RF0B 3BVHC 3BVHB 2GY7A 2JHKF 2J3GA 1FZBC 2JHHC 2J0GA 1FZAC 1FZAB 1FZEC 1FZEB 1RE3C 1RE3B 2J3FA 1RE4C 1RE4B 1N73C 1N73B 1RF1C 2J61B 2Q9IB 2HODB 2J0HA 1M1JC 1LTJC 1LTJB 1M1JB 1RF0C
chains in the Genus database with same CATH topology
1N86C 1N86B 2J2PA 2FIBA 2H43B 1Z3UA 1Z3SA 4R9TA 1FICA 3H32C 3H32B 2J60A 4JYOX 2XNXC 2XNXB 2J64A 2JHLF 2Q9IC 3FIBA 1FZCB 2HODC 4R9JA 2J0YA 1LT9C 1LT9B 2FFDC 2FFDB 2D39A 2JHIF 3GHGC 2OYIB 2H43C 1FZGC 1FZGB 2JHMF 2J1GA 1FZDA 2Z4EC 2Z4EB 3E1IC 3E1IB 2J3OA 1FZCC 2J3UA 2WNPF 1FZBB 3HUSC 3HUSB 1FZFC 1FZFB 2J3FD 2OYHC 2OYHB 4NYTA 4EPUA 4ZFGA 2HPCC 1FIBA 2HPCB 2OYIC 2J5ZA 1FIDA 1RF1B 4M7FA 1JC9A 4JZCA 4M7HA 2J61A 1LWUC 1LWUB 2HLOC 2HLOB 1RF0B 3BVHC 3BVHB 2GY7A 2JHKF 2J3GA 1FZBC 2JHHC 2J0GA 1FZAC 1FZAB 1FZEC 1FZEB 1RE3C 1RE3B 2J3FA 1RE4C 1RE4B 1N73C 1N73B 1RF1C 2J61B 2Q9IB 2HODB 2J0HA 1M1JC 1LTJC 1LTJB 1M1JB 1RF0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 C;  1N86 B;  2J2P A;  2FIB A;  2H43 B;  1Z3U A;  1Z3S A;  4R9T A;  1FIC A;  3H32 C;  3H32 B;  2J60 A;  4JYO X;  2XNX C;  2XNX B;  2J64 A;  2JHL F;  2Q9I C;  3FIB A;  1FZC B;  2HOD C;  4R9J A;  2J0Y A;  1LT9 C;  1LT9 B;  2FFD C;  2FFD B;  2D39 A;  2JHI F;  3GHG C;  2OYI B;  2H43 C;  1FZG C;  1FZG B;  2JHM F;  2J1G A;  1FZD A;  2Z4E C;  2Z4E B;  3E1I C;  3E1I B;  2J3O A;  1FZC C;  2J3U A;  2WNP F;  1FZB B;  3HUS C;  3HUS B;  1FZF C;  1FZF B;  2J3F D;  2OYH C;  2OYH B;  4NYT A;  4EPU A;  4ZFG A;  2HPC C;  1FIB A;  2HPC B;  2OYI C;  2J5Z A;  1FID A;  1RF1 B;  4M7F A;  1JC9 A;  4JZC A;  4M7H A;  2J61 A;  1LWU C;  1LWU B;  2HLO C;  2HLO B;  1RF0 B;  3BVH C;  3BVH B;  2GY7 A;  2JHK F;  2J3G A;  1FZB C;  2JHH C;  2J0G A;  1FZA C;  1FZA B;  1FZE C;  1FZE B;  1RE3 C;  1RE3 B;  2J3F A;  1RE4 C;  1RE4 B;  1N73 C;  1N73 B;  1RF1 C;  2J61 B;  2Q9I B;  2HOD B;  2J0H A;  1M1J C;  1LTJ C;  1LTJ B;  1M1J B;  1RF0 C; 
#chains in the Genus database with same CATH topology
 1N86 C;  1N86 B;  2J2P A;  2FIB A;  2H43 B;  1Z3U A;  1Z3S A;  4R9T A;  1FIC A;  3H32 C;  3H32 B;  2J60 A;  4JYO X;  2XNX C;  2XNX B;  2J64 A;  2JHL F;  2Q9I C;  3FIB A;  1FZC B;  2HOD C;  4R9J A;  2J0Y A;  1LT9 C;  1LT9 B;  2FFD C;  2FFD B;  2D39 A;  2JHI F;  3GHG C;  3GHG B;  2OYI B;  2H43 C;  1FZG C;  1FZG B;  2JHM F;  2J1G A;  1FZD A;  2Z4E C;  2Z4E B;  3E1I C;  3E1I B;  2J3O A;  1FZC C;  2J3U A;  2WNP F;  1FZB B;  3HUS C;  3HUS B;  1FZF C;  1FZF B;  2J3F D;  2OYH C;  2OYH B;  4NYT A;  4EPU A;  4ZFG A;  2HPC C;  1FIB A;  2HPC B;  2OYI C;  2J5Z A;  1FID A;  1RF1 B;  4M7F A;  1JC9 A;  4JZC A;  4M7H A;  2J61 A;  1LWU C;  1LWU B;  2HLO C;  2HLO B;  1RF0 B;  3BVH C;  3BVH B;  2GY7 A;  2JHK F;  2J3G A;  1FZB C;  2JHH C;  2J0G A;  1FZA C;  1FZA B;  1FZE C;  1FZE B;  1RE3 C;  1RE3 B;  2J3F A;  1RE4 C;  1RE4 B;  1N73 C;  1N73 B;  1RF1 C;  2J61 B;  2Q9I B;  2HOD B;  2J0H A;  1M1J C;  1LTJ C;  1LTJ B;  1M1J B;  1RF0 C; 
#chains in the Genus database with same CATH homology
 1N86 C;  1N86 B;  2J2P A;  2FIB A;  2H43 B;  1Z3U A;  1Z3S A;  4R9T A;  1FIC A;  3H32 C;  3H32 B;  2J60 A;  4JYO X;  2XNX C;  2XNX B;  2J64 A;  2JHL F;  2Q9I C;  3FIB A;  1FZC B;  2HOD C;  4R9J A;  2J0Y A;  1LT9 C;  1LT9 B;  2FFD C;  2FFD B;  2D39 A;  2JHI F;  3GHG C;  2OYI B;  2H43 C;  1FZG C;  1FZG B;  2JHM F;  2J1G A;  1FZD A;  2Z4E C;  2Z4E B;  3E1I C;  3E1I B;  2J3O A;  1FZC C;  2J3U A;  2WNP F;  1FZB B;  3HUS C;  3HUS B;  1FZF C;  1FZF B;  2J3F D;  2OYH C;  2OYH B;  4NYT A;  4EPU A;  4ZFG A;  2HPC C;  1FIB A;  2HPC B;  2OYI C;  2J5Z A;  1FID A;  1RF1 B;  4M7F A;  1JC9 A;  4JZC A;  4M7H A;  2J61 A;  1LWU C;  1LWU B;  2HLO C;  2HLO B;  1RF0 B;  3BVH C;  3BVH B;  2GY7 A;  2JHK F;  2J3G A;  1FZB C;  2JHH C;  2J0G A;  1FZA C;  1FZA B;  1FZE C;  1FZE B;  1RE3 C;  1RE3 B;  2J3F A;  1RE4 C;  1RE4 B;  1N73 C;  1N73 B;  1RF1 C;  2J61 B;  2Q9I B;  2HOD B;  2J0H A;  1M1J C;  1LTJ C;  1LTJ B;  1M1J B;  1RF0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...