2J52A

Solution structure of gb1 domain protein g and low and high pressure.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G-BINDING PROTEIN G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j52A00
1JMLA 2LHDA 5JXVA 2IGGA 4KGRA 2NMQA 5HFYA 3UI3A 1FCLA 1F2RC 1FD6A 2KACA 1P7EA 2JZPA 2GB1A 1EM7A 1HEZE 2IGHA 2ON8A 1QKZA 4MACA 1IBXB 3GB1A 2KDMA 2JWUA 2RMMA 1PGXA 2ZW0A 4WH4A 1ZXHA 1MI0A 2ONQA 5HG2A 2KWDA 2N9LA 2JU6X 2K0PA 1GB4A 3FILA 2J52A 4HJGE 2LHEA 1Q10A 2RPVA 1MVKA 2ZW1A 2JXTA 1D4BA 1HZ5A 1XCQL 4OZCA 5HHDG 1K51A 1P7FA 1F2RI 4IOIE 2IGDA 1HZ6A 2J53A 2PLPA 3FILB 4GLSC 1YMHE 2I2YA 2N9KA 1FCCC 1YNTE 2KQ4X 2N7JA 4OZBA 2I38A 4IKGA 2QSDA 1PGAA 1MHXA 4D2KA 2EELA 1IGCA 1C9FA 2KN4A 2GI9A 1UWXA 5BMIA 5BMHA 1K52A 2PW9A 2JSVX 4KGSA 5HI1A 5BMGA 4HKZE 3MP9A 1XCTL 2LGIA 1GB1A 1MPEA 2PTLA 1MHHE 1K50A 1IBXA 1KH0A 2QMTA 1PGBA 2OEDA 2LUMA 3V3XA 4OZAA 1K53A 1IGDA 1XF5L 4KGTA
chains in the Genus database with same CATH superfamily
1OQRA 2LHDA 2WXHA 4G0NB 2UWQA 4KGRA 3Q3FA 1WF9A 2KLGA 3VTVA 1YX5B 1B1ZA 1FRRA 2CS4A 1J0GA 1P7EA 2KC2A 2NTSA 4F7ZA 2WX0A 3C8YA 3Q8CA 5LNK1 2KN5A 1FRDA 2L32A 4PT5A 4YT0B 3DBLI 4YL8A 2ZNVC 1QZEA 5C2TB 2LWPA 3IXSA 3IAM1 1D4BA 5AUIA 1XCQL 3EHVA 2G4DB 1D5ZC 1GG3A 1XLPA 4OW0A 5AEKB 2H88B 3W5UB 3T8MA 2MEKA 4IG7B 3VXWA 3KQ4A 4XYCA 1LXDA 4EZJA 2A4ZA 3B0AA 2M0XA 3AE5B 2LXCA 2WXMA 1L5PA 3RNGC 2IY0B 4ANVA 4B9KA 3UINB 3BZDB 2FE8A 2KWVB 3WA0A 4LDTD 1I4XA 1ZPSA 1C78A 3MFGA 1KLGD 4YSYB 1UF0A 1RFAA 3JYUA 3CSTA 4AJYB 2LJIA 2LUEA 1ESFA 4BKGA 2SEBD 2ZJDA 1K53A 5I4DA 1WRIA 3O13A 2N0SB 4MM3B 2KXJA 1FCLA 3LJ3A 2TSSA 1BT0A 3WAOA 2K3UA 3UQBA 2AQ2B 2RMMA 1QLBB 2K1FA 4J6IA 4XWWA 1VDVA 2I1KA 1R4MI 2KDBA 3ZNHB 3HRDD 4LTUA 4ZDVA 1N62A 2KX3A 1CQVA 1Q10A 1JWSD 2KAJA 1D6EC 2WHIA 4DHZB 2L0FA 4W9IA 3W1SA 3ZDTA 4RNAA 1K51A 2E6XA 2KZRA 1WGYA 1F2RI 1TKEA 5LXIB 4RCOA 1RFKA 2D3AA 3FILB 1DOIA 3DHHC 3TEYA 3AI5A 1I4HA 1V2YA 3RN9C 4ZRPA 2KK8A 4W9HA 1SE9A 1LGRA 1C77A 4MGYE 4BBNF 5E6NA 3CMMB 5JZEB 1F1HA 3SHQA 1P1AA 2PVGC 4LNFA 2R61A 2PE6B 2GI9A 3W9CB 1M94A 5BMHA 4WJPA 3N20C 3LYYA 4EKUA 4JWSC 4R3DA 4ICVA 1NI3A 3DWGC 2AX5A 4W9FA 4LDTB 1TS5A 2QIEB 4NQKE 3ZGZA 1SB3C 2K8BA 3H1UA 1PQSA 4CO7A 1SJED 3CSFA 1I7HA 2DWQA 2WGSA 1QOBA 1ZGUB 3DHGC 2JRIB 1FEHA 3V3XA 3L4PA 1XF5L 3NVZA 4E3CA 3QC8B 2K6DB 2LVPA 2NCNA 1YN4A 3WALA 3PGEA 5J18A 4DWFA 4HXDA 4G11A 3JVZX 1UBIA 3A4SC 2J0MA 1FXAA 1Y56A 1BXTA 3RT3B 2FUG1 3BK1A 2C5LC 4PYZA 1N5XA 2OOBB 5MPOA 5AZGA 4XDDA 5L83A 5DPTA 2PJHA 3MC0B 4NAWA 2YEPB 2MJ3A 4FHJA 4WJOA 4WJQA 2NBVB 2SAKA 3GE3C 1P7FA 2D2QA 2AYOB 4MH8A 1JRUA 4GDLB 1TGZB 2BS3B 4ZYNA 3PVLA 2BYFA 1FXTB 1QOGA 4M0WB 3U4EG 3HM3A 2LGXA 1UD7A 4NJ6A 1EUVB 2KQ4X 3APFA 1R4NB 3N1ZC 1GC7A 4OZBA 3ENEA 1MG4A 4NAMA 4RM9A 3KH0A 3PRMB 1T0RC 3VH4B 3HK0A 1ISNA 3DVNV 2VZKB 2I1JA 3IHPC 3M3JA 5BMIA 5IN7A 3R2IA 2GBRA 3AEAB 4C7YA 3PRZA 3N32A 2W9NA 3GOEA 5CX3A 1XXGA 5HKHA 1FIQA 3VUWA 2QCZA 3RMKC 1VZ6A 2RPQA 1H4RA 3RYTA 3ETRA 4RGTA 1RYJA 2XEWA 2MBQA 1CK1A 2Y5BB 4IM2A 3L54A 3VRAB 3MHZA 1TIFA 1FFUA 4MT5A 4OVVA 2NS5A 4BBNC 1PGXA 3TEWA 3NVYA 1ZKHA 2MX2A 2FIFA 1MI0A 4FBJB 2BPSA 2V3NA 2CHWA 1KF6B 2NPTB 4WWOA 4L1BA 4DDID 2LHEA 3BK2A 4GIVA 1XEEA 2DZKA 2Z59B 2K22A 2JWZA 4MGIE 1XQQA 4GSWA 2RDHA 3Q3OC 4N9F4 1OQYA 1VLBA 3KUCB 3PHXB 3ONSA 2D3GA 2GLSA 2I2YA 5EE1A 4ZOHC 3V6CB 2O6VB 3CWIA 1WGKA 3RFZB 2N9PC 4ANXA 1WXVA 4QAYA 4ZRKA 3U7ZA 2KDEB 3URYA 1GOZA 5IOIA 4K81A 4FJVB 1AW7A 2LFIA 4FXCA 3I57A 4I6LB 4GDKB 4DBGA 4DXFA 4NJ7A 4OVZA 2V3SA 2VZKD 4KGSA 4RM8A 2DAFA 5D94A 2DNFA 2FUHB 4BAXA 2KFKA 2C60A 1MHHE 3LDZE 2ICIA 1V6EA 3FAHA 4A3PA 2KWCA 4CQNA 1PGBA 3TJPA 3Q8AA 4BKTA 4TSSA 4LNOA 3ZNZB 3ZJTA 2KDIA 4MH0E 2W3RA 5JXVA 3Q69A 1Z2MA 2O2VA 4GDLA 1F2RC 4HK2A 1I4RA 3WCQA 3AE9B 5C3JB 4XWTA 2BGFA 4WWPA 3T3OA 2DZJA 3QK0A 2BYTA 3TUOA 2DZIA 4IW0A 4XZ4A 3EC8A 2CU1A 5BYRA 2C7MB 3Q14C 1HTQA 3AB5A 3QIJA 2J52A 4DXGA 4B6WA 1EWCA 2IPKD 2CHXA 5LXHA 1K8RB 2JXTA 2MCNB 1QOAA 1WGDA 1T0SC 4LNIA 3PHWB 1TS2A 1A70A 3KYCD 3DVGY 3N1YC 1T0YA 3OAWA 1UELA 1FNVA 4K7UA 1WJNA 5FR6A 5EE9A 4BOSC 2WXJA 4ZRJA 3ZDMC 3NUHB 2ZCBA 4KX6B 3DDCB 1ACCA 3DPDA 3DBRB 3NS1A 1AARA 2G3QB 1E0ZA 4AP4C 2J0KA 3Q8BA 2N9XA 2J4XA 1T3QA 1WJ4A 4HDQA 2HTME 2BS4B 1R4NI 3MC8A 1L6UA 4E74A 4PYUA 2V1YA 1WJ6A 4G3XB 3NVVA 4WQOB 1OEYA 4XC2A 2EKEC 2LEKA 1K50A 2ZPNA 1JQ4A 3IVFA 1UGJA 2K5PA 2OEDA 3VR9B 2KTRA 4W9LA 3PV1A 2V0GA 3V61A 1TKGA 3M95A 2NMQA 1Q0WB 4KSLC 4FA6A 2FCSA 2WQYB 1Z5SB 4P16A 2JPHA 3OWEB 1G6JA 1I4QA 2M1MA 1PDXA 3H7PB 2DZMA 4DDGD 1WXMA 2BWFA 2MQJA 3VH3B 2FNJB 3DQVA 4C4VA 1WY8A 1TTNA 2N9LA 3T9LA 5C23A 3TIXA 4URKA 3NZUA 2V3PA 2OHFA 2PIAA 4FJYA 3H9DA 4YTMB 1WM3A 3PZDA 2ZZPB 3K9PB 1PUTA 1E6EB 3A9KA 4A9AA 2MP2A 4K7WA 5D2MB 1N60A 2J53A 2PLPA 2BF8B 3NZSA 1WJUA 1YQ3B 3QHTA 4W9JA 2WDVB 1VD2A 1YN3A 2Y5PA 3I63C 4XE0A 1C1YB 3BYTB 1J7CA 1T5XD 4JE3B 1ZP0B 1RWSA 3BINA 2C7HA 1TS3A 1C9FA 2LGYA 2X38A 4A6QA 3ZJUA 3RCZA 4EE2A 2KHWB 3AE6B 1GPXA 3AH7A 4K3CA 3ZXVA 3P2BA 2DLBA 4HKZE 3TEZA 4TMAB 3WAMA 5H92C 3CIRB 2BVCA 2LGIA 2PTLA 3P1MA 2KTFA 2M17A 3ZNID 1T6BX 1OTRB 5E6PA 3RI7C 3QARA 3D32A 4XX5A 4M01A 3PZ7A 5DPRA 3RPFC 4EFOA 2IGGA 3U52E 2KOXA 2RDGA 1OGWA 1NYQA 3BY4B 1L4ZB 3VHTC 1FD6A 4GMVA 1WXSA 3CF6E 1WE7A 3GE8C 3M63B 1FM0D 2IGHA 1JCKB 5JHBA 2UYZB 2G9HD 4MJSB 2ZCCA 1BMLC 1SE3A 2KWUB 2ONQA 2JU6X 3Q3MC 1DOXA 1NENB 1KRHA 2RSUA 1LQBA 4WWMA 1J19A 2RPVA 2WXFA 3MC9A 4LLGM 1YN5A 2HTHA 1GJZA 1I35A 2DYOA 2KLCA 3HIZA 2LRUA 3ZKJC 1V5TA 2Z0EB 1KOTA 4IM3A 3R8BA 2WS3B 3PSEB 2LVOA 3AEEB 1R7SA 4KSKC 1QF6A 1PGAA 1MHXA 1UWMA 2KN4A 3UQAA 1ZUD2 1SGHA 2D3BA 3KLSX 4K3BA 2UU7A 3SEBA 2DYBA 5BMGA 4GXBA 1EO6A 3VQIA 4II2B 4NJCA 3HVZA 2WXOA 3QA8A 5GXGB 1KH0A 2G45B 4HCNB 3KVFB 2XK5A 4B0EA 1FNUA 3E9SA 3N9YC 1NVID 2ZNVB 4HVBA 3ECIA 3C0RB 1SBBB 4PS3A 2L00B 2LASA 1V86A 3SFDB 1Q5WB 2KACA 3L13A 1ET6A 2GMIC 1ZOYB 2D10A 2KDFB 1CMXB 1V1PA 4W9GA 2WLBA 3IT4B 2KWDA 4GOCA 4EZKA 2WXRA 3VUXA 4TQ1A 2JT4B 4RGMA 1PYWD 2KNBA 2BB6A 2KT7A 3SR6A 4ZYSA 3UIPB 2D11A 2KFJA 4RFBA 4EZLA 4II3B 4IOIE 1E90A 2IGDA 1SIJA 3P42A 3BVMA 3AXCA 2LGSA 4REZA 4JX1C 1V1PB 2M19A 1TY0A 2CU3A 2Y3AA 3N3KB 5AUKA 1TJEA 4HPMB 2AL6A 2Z0DB 5BYQA 2QSDA 4D2KA 4HJKA 3AE4B 4MGZE 4DK5A 3APCA 1GNUA 4HCPB 3V05A 5IKCM 2PW9A 1WX7A 3NS8A 5EE3A 4EEWA 2M4NA 3PRPB 1SE2A 2LVQA 4DHJB 2WDRB 2CR5A 3HM6X 3BVGA 3RD2A 2WXNA 2WU5B 2O2VB 1UNSA 2PE9A 2EKIA 5E6OA 2MWSB 3AE1B 3RNAC 4RMAA 2L05A 2DHZA 1JMLA 1HA5A 4JWUC 3KWVA 1XT9B 3HHMA 4ZHOA 4WIPA 3ZQ4A 3DBRI 4W9KA 1SXTA 3U8ZA 3L10B 2WU2B 3BIID 2WDTB 1WE6A 2KDMA 1WH3A 4JQWC 3SFEB 2FAZA 3V6EB 3EFCA 2JYEA 4OVUA 4MSQB 2YEPF 2JF5A 2QILA 1ENFA 1FXIA 3ZTCA 2BQQA 3QX1A 3HUIA 1D3ZA 4KZ0A 4HLEA 2BWES 2L7RA 2HE7A 4GDKA 4RH6A 4I6NB 2KYWA 3NVWA 1SE4A 2AQ3B 1WR6E 2LXAA 2MW5A 2WXPA 1F52A 2J0JA 4KKJA 3ZRFA 4WURA 1QQRA 2IBIB 1V8CA 2G4SA 4ANUA 4C4VB 2KQSA 3A9JA 1E5WA 3TMPB 2XN9C 2L83A 1K52A 3ABVB 1I4GA 2JSVX 2L52A 3RNBC 4C7ZA 1KM7A 2BKFA 3QJZA 1B9RA 1WXAA 3QWZB 5TSSA 1F9JA 2WXIA 3A33B 1D5MC 3VTUA 2GRIA 3Q2AC 4JGHB 3QQ8B 5D6JB 1J7BA 2NR2A 2E3TA 4FHKA 1N61A 3WANA 1R4MB 1JROA 1E8YA 1XO3A 2DX5B 5GMVA 4HEA1 1YJJA 4KVGB 4W9DA 3UI3A 1V49A 3ALBA 4A55A 3KW5B 3TEXA 1QKZA 2MBHA 4HRSA 1V81A 5JH5C 4F1SA 2VRRB 3VUYA 1WGRA 2W54A 5C1ZA 4FJZA 5CHWA 3PLUA 2V4LA 1C79A 3ZLZA 3WAPA 3BYYB 3O65B 2D3CA 1UZXB 1IPGA 2KVRA 5KHQA 2WNMA 3UF8A 1AYFA 2KC1A 3RNEC 1HZ5A 3P63A 4WAFA 2L0TA 2NBWB 5D7GA 1NI2A 5TR5A 4YXDB 3AU4A 4AOFA 1AWDA 2CJOA 2IY1B 3AEDB 2AWTA 3AEGB 1YNTE 2RD0A 2ZVOA 2JRHA 4MM3A 2KMCA 2WDQB 2LD9A 2K8HA 3Q8EA 5BO4B 3RUIB 4WQMA 1IYFA 2MJDA 5DPSA 5HI1A 4X57B 5J2RA 3UGBB 1P0RA 4UDUC 1GB1A 2BS2B 1XLOA 2NBUA 2N4FA 3Q8FA 4JIOU 1UGMA 2C7NB 1IBXA 4LJOB 3MJ5A 5T8IA 2KJ6A 2LRWA 1VZ7A 3VDZA 4TKNA 1YX6B 3L17A 3I9V1 5EE0A 1PFDA 3RNCC 1RAXA 1L0YB 1STEA 1WX9A 4BFRA 3AMZA 1EF5A 4K7SA 3KUDB 3FC4A 1OEYJ 3IG3A 2ON8A 4HWIB 4NPNA 1XLNA 1YD8U 3VAWA 2V4IB 3DCGA 3P4QB 2M8SA 1V80A 2FCNA 4RGOS 3GP7A 1NDDA 2O6VA 2K0PA 2WXQA 1UH6A 4YSZB 1C76A 4MGKE 4JPSA 3V62A 2GBKA 5FKAC 3EGRA 3ML9A 1GUAB 3VFKA 3R3MA 1L2NA 1UBQA 1X1MA 3MTNB 3MHSD 2ACZB 3R2TA 5FR3A 5DCNA 3Q6BA 4DHZE 4GLSC 4EOYA 1P9DU 4P6VF 4F8CB 2YVCA 4P1CC 1FFVA 3K9OB 2BBCA 4N58A 3U7DA 1AN8A 1M4VA 5G5HA 4MEMA 1CJEA 2IZVB 2QEJC 5CHVC 1EWYC 1WMHA 4WWNA 3ZO5B 4G50A 3VTWA 2EELA 1IGCA 3PPAA 2NTTA 4RF1A 3VR8B 3EECA 2GBNA 4HPPA 5AZHA 2JQRB 3AEBB 3OLMD 3ZW3A 1NEKB 1N5WA 2C9WB 2WXKA 4FADA 2L8JA 1XCTL 1VCBA 1MPEA 2MA9B 4IWPA 3B08A 4USAA 3ZYYX 4LK0M 1WZ3A 3DBLB 1SJHD 4JL9A 2R2QA 4BOZB 4MELA 3M62B 2ZPYA 1IGDA 2IYDB 4E71A 4M02A 1J8CA 3UIOB 4YTNB 4W9CA 4BKSA 2QJLA 2D5GA 5HFYA 1WM2A 4LJPB 2H89B 1OFFA 5LLIA 2JZPA 1HEZE 1E8WA 1MFWA 4KV2A 2BB5A 5BYSA 3GB1A 1I42A 4TQ0A 1WX8A 3GZNI 3B1LX 3JSVB 5G5GA 2CJNA 3HVDA 3E56A 4L23A 1WR1A 5E6JA 3ZJVA 2B76B 1ZDVA 3FILA 1V5OA 1OQQA 4HJGE 1MVKA 3W5VB 4GGQA 2BT6A 1TBEA 3NHEB 4OHJA 3OJ3A 4OZCA 4FULA 4N59A 2DYMA 2QDFA 4PK1A 1RM6C 3A1QB 1JW9D 2XK5B 3N1XC 3P4PB 2WX1A 4MSMB 1FNWA 4C80A 1F77A 1GC6A 1YJIA 1EF1A 2K25A 4KDLB 4NZLB 1MG8A 1QT9A 2DENB 3EUB2 5AZFA 3X0WA 2IJ0A 1HTOA 2LJ5A 3QCAA 3ZXRA 1BUIC 2GOWA 2QC8A 1T0QC 4S0RA 2LI5A 3DBHB 1HXYD 4US9A 4P7IA 2BYVE 2FBWB 1YQ4B 4US8A 2K39A 2JXXA 2N1WA 3AE7B 2REXA 2L76A 4IM0A 4A20A 2MLBA 3NY5A 1WYGA 1FMAD 1LFDA 4BZAA 2PMVA 3H8HA 1C3TA 3DOWA 4ARIA 2GBMA 1WYWB 1JWAD 4HROA 3FKYA 4KGTA 3PO0A 3W1SC 3GZNB 4JLCA 2N1VA 3AECB 1U4AA 2PVOD 1KFYB 3L0WB 5EDSA 5IA7A 1EU3A 1TZ1A 4YSXB 2OJRA 4KZCA 3PLVA 2AQ1B 2MBOA 3IAS1 3A9JB 2JWUA 3P4SB 3DWMA 2ZW0A 2M0AA 1YOVB 1KJTA 3PTFC 4ZHPA 2MHJA 2Y5CA 2YLMA 4A8XC 3H6NA 3C19A 2VH1A 4KKIA 1VRAB 1CZPA 2R2OA 3H7SA 2KVZA 5HHDG 1S3SG 2FIDA 3SD5A 5G55A 1NBFC 2PKOA 1TS4A 1GAQB 1SSNA 4KIKB 1FCCC 1C4PA 4YWGG 1QOFA 4AJWA 3L16A 2OJWA 2BW2A 3EFUA 4M8MA 3I3TB 1VR9A 2O6VD 2FCMA 2L3ZA 1KLVA 5CTRC 5DPWA 4MDKE 3RZWC 3A1QA 1FPYA 3APDA 1C4AA 2W82A 4B0MA 2FCQA 3GS2A 4H2AA 4IDIA 2IO1B 2KJRA 3R7RA 3NZ3A 2MJEA 1JRPA 1SEBD 3U2SC 2HD5B 5JHAA 4FLHA 3LB8C 1VJKA 4CHKA 3OG5A 1E8XA 4ANWA 3ZUNA 4NQLB 2JYTA 4NAWB 4KDIC 4NNJB 4PS7A 4L2YA 2KTRB 2MSED 2RGFA 4LCDE 3ZNGC 1HQRD 4LNKA 1IBXB 4DQOC 3PS6A 3R66C 2XNAC 1TYGB 1VZ8A 1E10A 3NJTA 1JWUD 3LXFA 3VRBB 4ICUA 4PS8A 3WIMA 2BTEA 1LO5D 5J17A 1P98A 1GB4A 1YQBA 3Q3NC 1ZXIA 3B2FA 2ASQA 1TY2A 1ZE3D 1WMHB 2MH7A 2ZW1A 3A4RA 3ZRCA 1XD3B 2K8CA 5CHFA 2LZ6A 2WYQA 3RNFC 3AULA 4YTPB 3TL5A 2HJ1A 1RLFA 1DOYA 1HZ6A 2GBJA 1YMHE 3DVGX 5KHOA 2B3AA 3B2GA 1TZOA 1D5XC 1WGHA 4IUMB 1E9MA 2KJHB 3PT2B 4BKSD 2M56B 4IKGA 2JZ3B 3PZ8A 1IP9A 2NPTA 2V9HA 2WWZA 3DVNU 3KYDD 1J7AA 3TSSA 2XBBC 3MJWA 1SF0A 4GN1A 1C4CA 2MBEA 4HKQA 2LMCA 2WXLA 2DAJA 1LM8B 1E7UA 2QMTA 4HDOA 4B95A 4AS1A 1ROEA 4BVUC 3DBHI 2BYEA 3AM9A 4XDCA 1WRDB 2MRPA 3PREA 4RGNA 4NY0A 3AN1A 3ZTDA 2IDYA 2K6QA 3NOBA 4HPLB 2IO3B 2QHOA 1EM7A 2D07B 1DGJA 1V97A 3ML8A 4MACA 1V9JA 3DHIC 4ARCA 2INDC 3BVZA 4FN2A 3T3NA 1ZXHA 2KFKB 1KTKA 3IFWB 3ZVVA 2JZZA 1ZW7A 3U30A 5IO9A 4WAAA 1ET9A 1H8CA 2J7QB 3TBLD 2Q5WD 1HE8A 2KQ7A 2KMMA 2INCC 1N6ZA 1WSPA 3I5JC 4I6PA 2L1AA 2N7EA 3NG0A 4AUQC 2RDBC 3L08A 5D3DA 1JWBD 4M8NA 3SU8X 2INNE 3NRZA 4IC7B 4K1RB 2IO0B 4M00A 4MJSA 2N7JA 1L6VA 1WIAA 4AQ7A 4A3OA 2I38A 2G1EA 2KX0A 3AE8B 1L0VB 1E7PB 2X8XX 3RULA 4ZRIA 1NYRA 4DHJD 2A5UA 1L4DB 2LGDA 3ZIMA 1E7VA 2ZVNA 5L95C 3IBEA 4GB9A 4TV3A 1Q1OA 5FK9C 3S2AA 1FO4A 1RRBA 4ZRQA 2W3SA 4DXAB 2CKHB 2K9XA 3VVWB 3AEFB 1P3QU 2KO3A 1SIFA 4S17A 1WI0A 1E8ZA 2HJ8A 2CHZA 2NVUI 1IUEA 1A5RA 3KWLA 4GU2A 1TT5B 2WP9B 3B9JA 3EA6A 4ITKA 2JX5A 1JWMD 2EMSA 2AL3A 1TKYA 3A9KB 1F0ZA 2ZEQA 2GB1A 3N30A 1YJ1A 1MJDA 1L7YA 4WH4A 4O1NA 4AWJA 2INPE 3JW0X 1JALA 5D3IB 4W9EA 5HG2A 2W55A 4KIKA 3AV8A 3W1YA 3TCAA 4EUTA 4J3OD 2EMTA 1S1QB 3DBSA 3X23A 2N7DA 1Y8RC 3R7QA 2N9EB 1I4PA 2JUOA 2PPHA 4Q2JA 2AEHA 5IP4D 3JSVA 1ZDXA 2HDEA 5G2NA 1EU4A 2DBYA 3OJ4B 4IWOA 4N6EB 2MBBB 1WWTA 3J9CA 2JY6A 1YIWA 1QILA 1WXQA 1KLUD 2N9KA 3Q3JA 3AE3B 2BKRB 3RZFA 4C00A 2PEAA 4LNNA 2MP2B 3SDLC 4ACFA 2KANA 5H8YE 2JVCA 3W2DA 3AU5A 3P4RB 3AE2B 4ASWC 4RF0A 2WXGA 4WJNA 3V60A 2KMAA 1UUPA 3H7PA 1UWXA 2RR9A 4P1BC 1WGGA 3QAQA 1V1OA 2J42A 4C56C 4CYEA 2Z8LA 2VH2A 4A90A 2IO2B 3MP9A 3KUZA 1XLQA 2KD0A 1N63A 1WFYA 4IWQA 5IAAC 3IT6B 2LUMA 2KKCA 4M0WA 1L0XB 4XGAB 4OZAA 4TUUA 1WZ0A 1DYQA 3BWUD
chains in the Genus database with same CATH topology
1JMLA 1OQRA 2LHDA 5JXVA 1HA5A 2WXHA 4JWUC 3Q69A 4KGRA 3KWVA 3AECB 3WCQA 1F2RC 1I4RA 3AE9B 4ZHOA 1B1ZA 1FRRA 2PVOD 1KFYB 4WIPA 3ZQ4A 5C3JB 1P7EA 4XWTA 1EU3A 1SXTA 2WU2B 4YSXB 3BIID 3T3OA 2AQ1B 2NTSA 2KDMA 3IAS1 2JWUA 3P4SB 3C8YA 3DWMA 2ZW0A 2M0AA 3SFEB 3Q8CA 2BYTA 5LNK1 4ZHPA 3TUOA 2Y5CA 1FRDA 2L32A 5BYRA 4A8XC 2JYEA 4PT5A 2YEPF 4YT0B 3AB5A 2QILA 1ENFA 4KKIA 2J52A 1VRAB 4DXGA 5C2TB 1CZPA 1FXIA 1EWCA 2IPKD 3IXSA 3HUIA 3IAM1 2JXTA 1QOAA 1D4BA 5AUIA 1XCQL 5HHDG 1D5ZC 1TS2A 1A70A 1XLPA 4OW0A 2H88B 2PKOA 3W5UB 1FNVA 4RH6A 1TS4A 1GAQB 1SSNA 2MEKA 1FCCC 3NVWA 5EE9A 1C4PA 1SE4A 2WXJA 1QOFA 3KQ4A 4YWGG 2AQ3B 3NUHB 4KX6B 1ACCA 2WXPA 2BW2A 3AE5B 3NS1A 4KKJA 2WXMA 1E0ZA 3Q8BA 4WURA 1QQRA 1L5PA 2J4XA 1VR9A 1T3QA 3BZDB 2FE8A 1V8CA 2HTME 2BS4B 1I4XA 2XN9C 1L6UA 1ZPSA 2L83A 1K52A 3ABVB 1I4GA 2JSVX 1C78A 1C4AA 3MFGA 3NVVA 2L52A 1KLGD 4C7ZA 4YSYB 1B9RA 2W82A 4B0MA 3GS2A 2LEKA 2LJIA 5TSSA 1K50A 4H2AA 4IDIA 2WXIA 3NZ3A 1JQ4A 1D5MC 2MJEA 1UGJA 2GRIA 2K5PA 2OEDA 1ESFA 1JRPA 1SEBD 2SEBD 3VR9B 1J7BA 3U2SC 2V0GA 1K53A 3LB8C 2E3TA 1N61A 1VJKA 5I4DA 1WRIA 3O13A 2N0SB 1TKGA 1JROA 4MM3B 2NMQA 1XO3A 4HEA1 1YJJA 3UI3A 1FCLA 2WQYB 4P16A 2JYTA 4NAWB 3OWEB 4A55A 2TSSA 4L2YA 1I4QA 1HQRD 3TEXA 1QKZA 1PDXA 2K3UA 4DQOC 4HRSA 2AQ2B 1IBXB 2XNAC 1TYGB 2RMMA 1QLBB 1VZ8A 2W54A 1E10A 1JWUD 4XWWA 1VDVA 3LXFA 3VRBB 2N9LA 1C79A 3HRDD 2BTEA 1LO5D 2V3PA 4LTUA 1GB4A 2OHFA 2PIAA 1N62A 3BYYB 1ZXIA 3B2FA 1CQVA 1Q10A 1TY2A 4YTMB 1JWSD 2WNMA 1ZE3D 2KAJA 2MH7A 1AYFA 1D6EC 2ZW1A 3W1SA 4RNAA 1HZ5A 3P63A 4WAFA 1PUTA 1K51A 2E6XA 4YTPB 1E6EB 5D7GA 1F2RI 4A9AA 1TKEA 4RCOA 1RFKA 1N60A 1DOYA 1HZ6A 2J53A 2PLPA 4YXDB 3FILB 1AWDA 2CJOA 1YMHE 1YQ3B 1DOIA 3AEDB 3TEYA 3AEGB 2WDVB 3B2GA 1I4HA 1YN3A 1YNTE 2Y5PA 4XE0A 1TZOA 4ZRPA 1D5XC 1E9MA 3BYTB 1J7CA 1T5XD 1C77A 4JE3B 1ZP0B 2M56B 2WDQB 1RWSA 4IKGA 3PZ8A 1TS3A 3Q8EA 1C9FA 2X38A 2PVGC 1J7AA 3TSSA 4A6QA 2R61A 3ZJUA 2GI9A 4EE2A 3W9CB 3AE6B 5BMHA 1SF0A 1GPXA 3AH7A 4WQMA 3LYYA 4JWSC 4R3DA 2MJDA 2DLBA 1NI3A 1C4CA 5HI1A 4HKQA 4HKZE 3DWGC 2AX5A 3TEZA 4TMAB 2LMCA 5H92C 1TS5A 2WXLA 3CIRB 4UDUC 2LGIA 1GB1A 2QIEB 2BS2B 1XLOA 2PTLA 3Q8FA 3P1MA 3ZGZA 1IBXA 1SB3C 2QMTA 3MJ5A 5T8IA 1SJED 1I7HA 4AS1A 2DWQA 1ROEA 1QOBA 1T6BX 1VZ7A 1FEHA 3AM9A 4XDCA 3V3XA 3L4PA 4RGNA 3I9V1 1XF5L 3AN1A 5EE0A 2IDYA 3PZ7A 1PFDA 3NVZA 3RPFC 1L0YB 2IGGA 3U52E 2RDGA 1NYQA 1STEA 1YN4A 1L4ZB 3AMZA 1FD6A 3FC4A 1EM7A 1DGJA 1FM0D 2IGHA 1JCKB 1V97A 2ON8A 4MACA 4ARCA 1XLNA 2G9HD 3BVZA 2V4IB 3T3NA 1BMLC 1FXAA 1Y56A 1BXTA 1SE3A 1ZXHA 2FUG1 1KTKA 3P4QB 2ONQA 4RGOS 3GP7A 2JU6X 3BK1A 1N5XA 1DOXA 1NENB 1KRHA 2K0PA 2WXQA 5MPOA 4YSZB 4XDDA 1C76A 4JPSA 1ET9A 5FKAC 3EGRA 3MC0B 4WWMA 2WXFA 2RPVA 2Q5WD 4LLGM 2YEPB 2MJ3A 1YN5A 2KMMA 1WSPA 2L1AA 2SAKA 1P7FA 4MH8A 2ACZB 4GDLB 2DYOA 3R2TA 5D3DA 2BS3B 5FR3A 1JWBD 1QOGA 2INNE 3NRZA 4GLSC 4P6VF 3U4EG 1FFVA 3R8BA 2KQ4X 2N7JA 2WS3B 2BBCA 4N58A 1L6VA 1AN8A 1M4VA 4OZBA 5G5HA 1CJEA 4NAMA 4AQ7A 2QEJC 1EWYC 2I38A 3AEEB 2G1EA 1R7SA 1QF6A 1PGAA 3AE8B 1MHXA 2EELA 1IGCA 1L0VB 2VZKB 1UWMA 2KN4A 1E7PB 2NTTA 4RF1A 3VR8B 1NYRA 1ZUD2 5BMIA 1L4DB 3KLSX 2JQRB 3R2IA 3SEBA 3AEBB 3AEAB 4C7YA 1NEKB 1N5WA 2WXKA 5BMGA 3VQIA 1XCTL 5FK9C 1FO4A 4NJCA 4ZRQA 2W3SA 1MPEA 3HVZA 2K9XA 4USAA 3ZYYX 1XXGA 2WXOA 4LK0M 3AEFB 1FIQA 5GXGB 1KH0A 1SJHD 4B0EA 1FNUA 1VZ6A 3E9SA 3N9YC 1NVID 3ETRA 4RGTA 1IUEA 1RYJA 1IGDA 3KWLA 4YTNB 1SBBB 2WP9B 2QJLA 3B9JA 1CK1A 2D5GA 5HFYA 3EA6A 3SFDB 2H89B 4ITKA 1OFFA 1JWMD 2JX5A 3VRAB 1TKYA 2KACA 1F0ZA 3MHZA 1FFUA 2JZPA 2GB1A 1HEZE 1ET6A 4MT5A 1ZOYB 2BB5A 5BYSA 3GB1A 1PGXA 4O1NA 4WH4A 3TEWA 3NVYA 2INPE 1JALA 1V1PA 4TQ0A 5D3IB 5G5GA 1MI0A 2WLBA 5HG2A 3IT4B 2KWDA 2CJNA 2V3NA 2W55A 3HVDA 2WXRA 3E56A 4L23A 1KF6B 4TQ1A 5E6JA 3ZJVA 3AV8A 4RGMA 2B76B 1PYWD 1ZDVA 3FILA 4L1BA 4J3OD 1OQQA 2BB6A 4HJGE 3SR6A 2LHEA 3BK2A 1MVKA 1XEEA 3W5VB 2BT6A 2K22A 1I4PA 4ZYSA 4OHJA 4Q2JA 4OZCA 1ZDXA 2RDHA 2HDEA 1EU4A 2DYMA 4N59A 4RFBA 4IOIE 2DBYA 2IGDA 1RM6C 1VLBA 4N6EB 1SIJA 3J9CA 1JW9D 1WWTA 3P4PB 1QILA 1WXQA 5EE1A 1KLUD 2N9KA 3BVMA 3P42A 2I2YA 1FNWA 4ZOHC 4C80A 4REZA 4JX1C 1F77A 3CWIA 1WGKA 1YJIA 1V1PB 2M19A 3AE3B 3RFZB 1TY0A 2CU3A 2Y3AA 5AUKA 4NZLB 1QT9A 1TJEA 3EUB2 5BYQA 5H8YE 3U7ZA 2IJ0A 2QSDA 3W2DA 3URYA 4D2KA 1GOZA 3P4RB 3AE2B 3AE4B 2WXGA 4RF0A 1UUPA 1BUIC 1UWXA 1AW7A 2LFIA 4FXCA 1V1OA 3I57A 3V05A 4GDKB 4DXFA 1HXYD 2J42A 2PW9A 4US9A 4OVZA 4C56C 2FBWB 2VZKD 2Z8LA 4KGSA 4A90A 5EE3A 1YQ4B 4US8A 1SE2A 3MP9A 3AE7B 1XLQA 2WDRB 1MHHE 1WYGA 1FMAD 1N63A 2ICIA 3BVGA 2WXNA 3FAHA 2WU5B 2PMVA 1UNSA 2EKIA 3H8HA 1PGBA 4CQNA 3IT6B 4ARIA 2LUMA 3AE1B 3Q8AA 4M0WA 1JWAD 4TSSA 1L0XB 4OZAA 3ZJTA 4HROA 2W3RA 3PO0A 1DYQA 3BWUD 4KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JML A;  2LHD A;  5JXV A;  2IGG A;  4KGR A;  2NMQ A;  5HFY A;  3UI3 A;  1FCL A;  1F2R C;  1FD6 A;  2KAC A;  1P7E A;  2JZP A;  2GB1 A;  1EM7 A;  1HEZ E;  2IGH A;  2ON8 A;  1QKZ A;  4MAC A;  1IBX B;  3GB1 A;  2KDM A;  2JWU A;  2RMM A;  1PGX A;  2ZW0 A;  4WH4 A;  1ZXH A;  1MI0 A;  2ONQ A;  5HG2 A;  2KWD A;  2N9L A;  2JU6 X;  2K0P A;  1GB4 A;  3FIL A;  2J52 A;  4HJG E;  2LHE A;  1Q10 A;  2RPV A;  1MVK A;  2ZW1 A;  2JXT A;  1D4B A;  1HZ5 A;  1XCQ L;  4OZC A;  5HHD G;  1K51 A;  1P7F A;  1F2R I;  4IOI E;  2IGD A;  1HZ6 A;  2J53 A;  2PLP A;  3FIL B;  4GLS C;  1YMH E;  2I2Y A;  2N9K A;  1FCC C;  1YNT E;  2KQ4 X;  2N7J A;  4OZB A;  2I38 A;  4IKG A;  2QSD A;  1PGA A;  1MHX A;  4D2K A;  2EEL A;  1IGC A;  1C9F A;  2KN4 A;  2GI9 A;  1UWX A;  5BMI A;  5BMH A;  1K52 A;  2PW9 A;  2JSV X;  4KGS A;  5HI1 A;  5BMG A;  4HKZ E;  3MP9 A;  1XCT L;  2LGI A;  1GB1 A;  1MPE A;  2PTL A;  1MHH E;  1K50 A;  1IBX A;  1KH0 A;  2QMT A;  1PGB A;  2OED A;  2LUM A;  3V3X A;  4OZA A;  1K53 A;  1IGD A;  1XF5 L;  4KGT A; 
#chains in the Genus database with same CATH topology
 1OQR A;  2LHD A;  2WXH A;  4G0N B;  2UWQ A;  4KGR A;  3Q3F A;  1WF9 A;  2KLG A;  3VTV A;  1YX5 B;  1B1Z A;  1FRR A;  2CS4 A;  1J0G A;  1P7E A;  2KC2 A;  2NTS A;  4F7Z A;  2WX0 A;  3C8Y A;  3Q8C A;  5LNK 1;  2KN5 A;  1FRD A;  2L32 A;  4PT5 A;  4YT0 B;  3DBL I;  4YL8 A;  2ZNV C;  1QZE A;  5C2T B;  2LWP A;  3IXS A;  3IAM 1;  1D4B A;  5AUI A;  1XCQ L;  3EHV A;  2G4D B;  1D5Z C;  1GG3 A;  1XLP A;  4OW0 A;  5AEK B;  2H88 B;  3W5U B;  3T8M A;  2MEK A;  4IG7 B;  3VXW A;  3KQ4 A;  4XYC A;  1LXD A;  4EZJ A;  2A4Z A;  3B0A A;  2M0X A;  3AE5 B;  2LXC A;  2WXM A;  1L5P A;  3RNG C;  2IY0 B;  4ANV A;  4B9K A;  3UIN B;  3BZD B;  2FE8 A;  2KWV B;  3WA0 A;  4LDT D;  1I4X A;  1ZPS A;  1C78 A;  3MFG A;  1KLG D;  4YSY B;  1UF0 A;  1RFA A;  3JYU A;  3CST A;  4AJY B;  2LJI A;  2LUE A;  1ESF A;  4BKG A;  2SEB D;  2ZJD A;  1K53 A;  5I4D A;  1WRI A;  3O13 A;  2N0S B;  4MM3 B;  2KXJ A;  1FCL A;  3LJ3 A;  2TSS A;  1BT0 A;  3WAO A;  2K3U A;  3UQB A;  2AQ2 B;  2RMM A;  1QLB B;  2K1F A;  4J6I A;  4XWW A;  1VDV A;  2I1K A;  1R4M I;  2KDB A;  3ZNH B;  3HRD D;  4LTU A;  4ZDV A;  1N62 A;  2KX3 A;  1CQV A;  1Q10 A;  1JWS D;  2KAJ A;  1D6E C;  2WHI A;  4DHZ B;  2L0F A;  4W9I A;  3W1S A;  3ZDT A;  4RNA A;  1K51 A;  2E6X A;  2KZR A;  1WGY A;  1F2R I;  1TKE A;  5LXI B;  4RCO A;  1RFK A;  2D3A A;  3FIL B;  1DOI A;  3DHH C;  3TEY A;  3AI5 A;  1I4H A;  1V2Y A;  3RN9 C;  4ZRP A;  2KK8 A;  4W9H A;  1SE9 A;  1LGR A;  1C77 A;  4MGY E;  4BBN F;  5E6N A;  3CMM B;  5JZE B;  1F1H A;  3SHQ A;  1P1A A;  2PVG C;  4LNF A;  2R61 A;  2PE6 B;  2GI9 A;  3W9C B;  1M94 A;  5BMH A;  4WJP A;  3N20 C;  3LYY A;  4EKU A;  4JWS C;  4R3D A;  4ICV A;  1NI3 A;  3DWG C;  2AX5 A;  4W9F A;  4LDT B;  1TS5 A;  2QIE B;  4NQK E;  3ZGZ A;  1SB3 C;  2K8B A;  3H1U A;  1PQS A;  4CO7 A;  1SJE D;  3CSF A;  1I7H A;  2DWQ A;  2WGS A;  1QOB A;  1ZGU B;  3DHG C;  2JRI B;  1FEH A;  3V3X A;  3L4P A;  1XF5 L;  3NVZ A;  4E3C A;  3QC8 B;  2K6D B;  2LVP A;  2NCN A;  1YN4 A;  3WAL A;  3PGE A;  5J18 A;  4DWF A;  4HXD A;  4G11 A;  3JVZ X;  1UBI A;  3A4S C;  2J0M A;  1FXA A;  1Y56 A;  1BXT A;  3RT3 B;  2FUG 1;  3BK1 A;  2C5L C;  4PYZ A;  1N5X A;  2OOB B;  5MPO A;  5AZG A;  4XDD A;  5L83 A;  5DPT A;  2PJH A;  3MC0 B;  4NAW A;  2YEP B;  2MJ3 A;  4FHJ A;  4WJO A;  4WJQ A;  2NBV B;  2SAK A;  3GE3 C;  1P7F A;  2D2Q A;  2AYO B;  4MH8 A;  1JRU A;  4GDL B;  1TGZ B;  2BS3 B;  4ZYN A;  3PVL A;  2BYF A;  1FXT B;  1QOG A;  4M0W B;  3U4E G;  3HM3 A;  2LGX A;  1UD7 A;  4NJ6 A;  1EUV B;  2KQ4 X;  3APF A;  1R4N B;  3N1Z C;  1GC7 A;  4OZB A;  3ENE A;  1MG4 A;  4NAM A;  4RM9 A;  3KH0 A;  3PRM B;  1T0R C;  3VH4 B;  3HK0 A;  1ISN A;  3DVN V;  2VZK B;  2I1J A;  3IHP C;  3M3J A;  5BMI A;  5IN7 A;  3R2I A;  2GBR A;  3AEA B;  4C7Y A;  3PRZ A;  3N32 A;  2W9N A;  3GOE A;  5CX3 A;  1XXG A;  5HKH A;  1FIQ A;  3VUW A;  2QCZ A;  3RMK C;  1VZ6 A;  2RPQ A;  1H4R A;  3RYT A;  3ETR A;  4RGT A;  1RYJ A;  2XEW A;  2MBQ A;  1CK1 A;  2Y5B B;  4IM2 A;  3L54 A;  3VRA B;  3MHZ A;  1TIF A;  1FFU A;  4MT5 A;  4OVV A;  2NS5 A;  4BBN C;  1PGX A;  3TEW A;  3NVY A;  1ZKH A;  2MX2 A;  2FIF A;  1MI0 A;  4FBJ B;  2BPS A;  2V3N A;  2CHW A;  1KF6 B;  2NPT B;  4WWO A;  4L1B A;  4DDI D;  2LHE A;  3BK2 A;  4GIV A;  1XEE A;  2DZK A;  2Z59 B;  2K22 A;  2JWZ A;  4MGI E;  1XQQ A;  4GSW A;  2RDH A;  3Q3O C;  4N9F 4;  1OQY A;  1VLB A;  3KUC B;  3PHX B;  3ONS A;  2D3G A;  2GLS A;  2I2Y A;  5EE1 A;  4ZOH C;  3V6C B;  2O6V B;  3CWI A;  1WGK A;  3RFZ B;  2N9P C;  4ANX A;  1WXV A;  4QAY A;  4ZRK A;  3U7Z A;  2KDE B;  3URY A;  1GOZ A;  5IOI A;  4K81 A;  4FJV B;  1AW7 A;  2LFI A;  4FXC A;  3I57 A;  4I6L B;  4GDK B;  4DBG A;  4DXF A;  4NJ7 A;  4OVZ A;  2V3S A;  2VZK D;  4KGS A;  4RM8 A;  2DAF A;  5D94 A;  2DNF A;  2FUH B;  4BAX A;  2KFK A;  2C60 A;  1MHH E;  3LDZ E;  2ICI A;  1V6E A;  3FAH A;  4A3P A;  2KWC A;  4CQN A;  1PGB A;  3TJP A;  3Q8A A;  4BKT A;  4TSS A;  4LNO A;  3ZNZ B;  3ZJT A;  2KDI A;  4MH0 E;  2W3R A;  5JXV A;  3Q69 A;  1Z2M A;  2O2V A;  4GDL A;  1F2R C;  4HK2 A;  1I4R A;  3WCQ A;  3AE9 B;  5C3J B;  4XWT A;  2BGF A;  4WWP A;  3T3O A;  2DZJ A;  3QK0 A;  2BYT A;  3TUO A;  2DZI A;  4IW0 A;  4XZ4 A;  3EC8 A;  2CU1 A;  5BYR A;  2C7M B;  3Q14 C;  1HTQ A;  3AB5 A;  3QIJ A;  2J52 A;  4DXG A;  4B6W A;  1EWC A;  2IPK D;  2CHX A;  5LXH A;  1K8R B;  2JXT A;  2MCN B;  1QOA A;  1WGD A;  1T0S C;  4LNI A;  3PHW B;  1TS2 A;  1A70 A;  3KYC D;  3DVG Y;  3N1Y C;  1T0Y A;  3OAW A;  1UEL A;  1FNV A;  4K7U A;  1WJN A;  5FR6 A;  5EE9 A;  4BOS C;  2WXJ A;  4ZRJ A;  3ZDM C;  3NUH B;  2ZCB A;  4KX6 B;  3DDC B;  1ACC A;  3DPD A;  3DBR B;  3NS1 A;  1AAR A;  2G3Q B;  1E0Z A;  4AP4 C;  2J0K A;  3Q8B A;  2N9X A;  2J4X A;  1T3Q A;  1WJ4 A;  4HDQ A;  2HTM E;  2BS4 B;  1R4N I;  3MC8 A;  1L6U A;  4E74 A;  4PYU A;  2V1Y A;  1WJ6 A;  4G3X B;  3NVV A;  4WQO B;  1OEY A;  4XC2 A;  2EKE C;  2LEK A;  1K50 A;  2ZPN A;  1JQ4 A;  3IVF A;  1UGJ A;  2K5P A;  2OED A;  3VR9 B;  2KTR A;  4W9L A;  3PV1 A;  2V0G A;  3V61 A;  1TKG A;  3M95 A;  2NMQ A;  1Q0W B;  4KSL C;  4FA6 A;  2FCS A;  2WQY B;  1Z5S B;  4P16 A;  2JPH A;  3OWE B;  1G6J A;  1I4Q A;  2M1M A;  1PDX A;  3H7P B;  2DZM A;  4DDG D;  1WXM A;  2BWF A;  2MQJ A;  3VH3 B;  2FNJ B;  3DQV A;  4C4V A;  1WY8 A;  1TTN A;  2N9L A;  3T9L A;  5C23 A;  3TIX A;  4URK A;  3NZU A;  2V3P A;  2OHF A;  2PIA A;  4FJY A;  3H9D A;  4YTM B;  1WM3 A;  3PZD A;  2ZZP B;  3K9P B;  1PUT A;  1E6E B;  3A9K A;  4A9A A;  2MP2 A;  4K7W A;  5D2M B;  1N60 A;  2J53 A;  2PLP A;  2BF8 B;  3NZS A;  1WJU A;  1YQ3 B;  3QHT A;  4W9J A;  2WDV B;  1VD2 A;  1YN3 A;  2Y5P A;  3I63 C;  4XE0 A;  1C1Y B;  3BYT B;  1J7C A;  1T5X D;  4JE3 B;  1ZP0 B;  1RWS A;  3BIN A;  2C7H A;  1TS3 A;  1C9F A;  2LGY A;  2X38 A;  4A6Q A;  3ZJU A;  3RCZ A;  4EE2 A;  2KHW B;  3AE6 B;  1GPX A;  3AH7 A;  4K3C A;  3ZXV A;  3P2B A;  2DLB A;  4HKZ E;  3TEZ A;  4TMA B;  3WAM A;  5H92 C;  3CIR B;  2BVC A;  2LGI A;  2PTL A;  3P1M A;  2KTF A;  2M17 A;  3ZNI D;  1T6B X;  1OTR B;  5E6P A;  3RI7 C;  3QAR A;  3D32 A;  4XX5 A;  4M01 A;  3PZ7 A;  5DPR A;  3RPF C;  4EFO A;  2IGG A;  3U52 E;  2KOX A;  2RDG A;  1OGW A;  1NYQ A;  3BY4 B;  1L4Z B;  3VHT C;  1FD6 A;  4GMV A;  1WXS A;  3CF6 E;  1WE7 A;  3GE8 C;  3M63 B;  1FM0 D;  2IGH A;  1JCK B;  5JHB A;  2UYZ B;  2G9H D;  4MJS B;  2ZCC A;  1BML C;  1SE3 A;  2KWU B;  2ONQ A;  2JU6 X;  3Q3M C;  1DOX A;  1NEN B;  1KRH A;  2RSU A;  1LQB A;  4WWM A;  1J19 A;  2RPV A;  2WXF A;  3MC9 A;  4LLG M;  1YN5 A;  2HTH A;  1GJZ A;  1I35 A;  2DYO A;  2KLC A;  3HIZ A;  2LRU A;  3ZKJ C;  1V5T A;  2Z0E B;  1KOT A;  4IM3 A;  3R8B A;  2WS3 B;  3PSE B;  2LVO A;  3AEE B;  1R7S A;  4KSK C;  1QF6 A;  1PGA A;  1MHX A;  1UWM A;  2KN4 A;  3UQA A;  1ZUD 2;  1SGH A;  2D3B A;  3KLS X;  4K3B A;  2UU7 A;  3SEB A;  2DYB A;  5BMG A;  4GXB A;  1EO6 A;  3VQI A;  4II2 B;  4NJC A;  3HVZ A;  2WXO A;  3QA8 A;  5GXG B;  1KH0 A;  2G45 B;  4HCN B;  3KVF B;  2XK5 A;  4B0E A;  1FNU A;  3E9S A;  3N9Y C;  1NVI D;  2ZNV B;  4HVB A;  3ECI A;  3C0R B;  1SBB B;  4PS3 A;  2L00 B;  2LAS A;  1V86 A;  3SFD B;  1Q5W B;  2KAC A;  3L13 A;  1ET6 A;  2GMI C;  1ZOY B;  2D10 A;  2KDF B;  1CMX B;  1V1P A;  4W9G A;  2WLB A;  3IT4 B;  2KWD A;  4GOC A;  4EZK A;  2WXR A;  3VUX A;  4TQ1 A;  2JT4 B;  4RGM A;  1PYW D;  2KNB A;  2BB6 A;  2KT7 A;  3SR6 A;  4ZYS A;  3UIP B;  2D11 A;  2KFJ A;  4RFB A;  4EZL A;  4II3 B;  4IOI E;  1E90 A;  2IGD A;  1SIJ A;  3P42 A;  3BVM A;  3AXC A;  2LGS A;  4REZ A;  4JX1 C;  1V1P B;  2M19 A;  1TY0 A;  2CU3 A;  2Y3A A;  3N3K B;  5AUK A;  1TJE A;  4HPM B;  2AL6 A;  2Z0D B;  5BYQ A;  2QSD A;  4D2K A;  4HJK A;  3AE4 B;  4MGZ E;  4DK5 A;  3APC A;  1GNU A;  4HCP B;  3V05 A;  5IKC M;  2PW9 A;  1WX7 A;  3NS8 A;  5EE3 A;  4EEW A;  2M4N A;  3PRP B;  1SE2 A;  2LVQ A;  4DHJ B;  2WDR B;  2CR5 A;  3HM6 X;  3BVG A;  3RD2 A;  2WXN A;  2WU5 B;  2O2V B;  1UNS A;  2PE9 A;  2EKI A;  5E6O A;  2MWS B;  3AE1 B;  3RNA C;  4RMA A;  2L05 A;  2DHZ A;  1JML A;  1HA5 A;  4JWU C;  3KWV A;  1XT9 B;  3HHM A;  4ZHO A;  4WIP A;  3ZQ4 A;  3DBR I;  4W9K A;  1SXT A;  3U8Z A;  3L10 B;  2WU2 B;  3BII D;  2WDT B;  1WE6 A;  2KDM A;  1WH3 A;  4JQW C;  3SFE B;  2FAZ A;  3V6E B;  3EFC A;  2JYE A;  4OVU A;  4MSQ B;  2YEP F;  2JF5 A;  2QIL A;  1ENF A;  1FXI A;  3ZTC A;  2BQQ A;  3QX1 A;  3HUI A;  1D3Z A;  4KZ0 A;  4HLE A;  2BWE S;  2L7R A;  2HE7 A;  4GDK A;  4RH6 A;  4I6N B;  2KYW A;  3NVW A;  1SE4 A;  2AQ3 B;  1WR6 E;  2LXA A;  2MW5 A;  2WXP A;  1F52 A;  2J0J A;  4KKJ A;  3ZRF A;  4WUR A;  1QQR A;  2IBI B;  1V8C A;  2G4S A;  4ANU A;  4C4V B;  2KQS A;  3A9J A;  1E5W A;  3TMP B;  2XN9 C;  2L83 A;  1K52 A;  3ABV B;  1I4G A;  2JSV X;  2L52 A;  3RNB C;  4C7Z A;  1KM7 A;  2BKF A;  3QJZ A;  1B9R A;  1WXA A;  3QWZ B;  5TSS A;  1F9J A;  2WXI A;  3A33 B;  1D5M C;  3VTU A;  2GRI A;  3Q2A C;  4JGH B;  3QQ8 B;  5D6J B;  1J7B A;  2NR2 A;  2E3T A;  4FHK A;  1N61 A;  3WAN A;  1R4M B;  1JRO A;  1E8Y A;  1XO3 A;  2DX5 B;  5GMV A;  4HEA 1;  1YJJ A;  4KVG B;  4W9D A;  3UI3 A;  1V49 A;  3ALB A;  4A55 A;  3KW5 B;  3TEX A;  1QKZ A;  2MBH A;  4HRS A;  1V81 A;  5JH5 C;  4F1S A;  2VRR B;  3VUY A;  1WGR A;  2W54 A;  5C1Z A;  4FJZ A;  5CHW A;  3PLU A;  2V4L A;  1C79 A;  3ZLZ A;  3WAP A;  3BYY B;  3O65 B;  2D3C A;  1UZX B;  1IPG A;  2KVR A;  5KHQ A;  2WNM A;  3UF8 A;  1AYF A;  2KC1 A;  3RNE C;  1HZ5 A;  3P63 A;  4WAF A;  2L0T A;  2NBW B;  5D7G A;  1NI2 A;  5TR5 A;  4YXD B;  3AU4 A;  4AOF A;  1AWD A;  2CJO A;  2IY1 B;  3AED B;  2AWT A;  3AEG B;  1YNT E;  2RD0 A;  2ZVO A;  2JRH A;  4MM3 A;  2KMC A;  2WDQ B;  2LD9 A;  2K8H A;  3Q8E A;  5BO4 B;  3RUI B;  4WQM A;  1IYF A;  2MJD A;  5DPS A;  5HI1 A;  4X57 B;  5J2R A;  3UGB B;  1P0R A;  4UDU C;  1GB1 A;  2BS2 B;  1XLO A;  2NBU A;  2N4F A;  3Q8F A;  4JIO U;  1UGM A;  2C7N B;  1IBX A;  4LJO B;  3MJ5 A;  5T8I A;  2KJ6 A;  2LRW A;  1VZ7 A;  3VDZ A;  4TKN A;  1YX6 B;  3L17 A;  3I9V 1;  5EE0 A;  1PFD A;  3RNC C;  1RAX A;  1L0Y B;  1STE A;  1WX9 A;  4BFR A;  3AMZ A;  1EF5 A;  4K7S A;  3KUD B;  3FC4 A;  1OEY J;  3IG3 A;  2ON8 A;  4HWI B;  4NPN A;  1XLN A;  1YD8 U;  3VAW A;  2V4I B;  3DCG A;  3P4Q B;  2M8S A;  1V80 A;  2FCN A;  4RGO S;  3GP7 A;  1NDD A;  2O6V A;  2K0P A;  2WXQ A;  1UH6 A;  4YSZ B;  1C76 A;  4MGK E;  4JPS A;  3V62 A;  2GBK A;  5FKA C;  3EGR A;  3ML9 A;  1GUA B;  3VFK A;  3R3M A;  1L2N A;  1UBQ A;  1X1M A;  3MTN B;  3MHS D;  2ACZ B;  3R2T A;  5FR3 A;  5DCN A;  3Q6B A;  4DHZ E;  4GLS C;  4EOY A;  1P9D U;  4P6V F;  4F8C B;  2YVC A;  4P1C C;  1FFV A;  3K9O B;  2BBC A;  4N58 A;  3U7D A;  1AN8 A;  1M4V A;  5G5H A;  4MEM A;  1CJE A;  2IZV B;  2QEJ C;  5CHV C;  1EWY C;  1WMH A;  4WWN A;  3ZO5 B;  4G50 A;  3VTW A;  2EEL A;  1IGC A;  3PPA A;  2NTT A;  4RF1 A;  3VR8 B;  3EEC A;  2GBN A;  4HPP A;  5AZH A;  2JQR B;  3AEB B;  3OLM D;  3ZW3 A;  1NEK B;  1N5W A;  2C9W B;  2WXK A;  4FAD A;  2L8J A;  1XCT L;  1VCB A;  1MPE A;  2MA9 B;  4IWP A;  3B08 A;  4USA A;  3ZYY X;  4LK0 M;  1WZ3 A;  3DBL B;  1SJH D;  4JL9 A;  2R2Q A;  4BOZ B;  4MEL A;  3M62 B;  2ZPY A;  1IGD A;  2IYD B;  4E71 A;  4M02 A;  1J8C A;  3UIO B;  4YTN B;  4W9C A;  4BKS A;  2QJL A;  2D5G A;  5HFY A;  1WM2 A;  4LJP B;  2H89 B;  1OFF A;  5LLI A;  2JZP A;  1HEZ E;  1E8W A;  1MFW A;  4KV2 A;  2BB5 A;  5BYS A;  3GB1 A;  1I42 A;  4TQ0 A;  1WX8 A;  3GZN I;  3B1L X;  3JSV B;  5G5G A;  2CJN A;  3HVD A;  3E56 A;  4L23 A;  1WR1 A;  5E6J A;  3ZJV A;  2B76 B;  1ZDV A;  3FIL A;  1V5O A;  1OQQ A;  4HJG E;  1MVK A;  3W5V B;  4GGQ A;  2BT6 A;  1TBE A;  3NHE B;  4OHJ A;  3OJ3 A;  4OZC A;  4FUL A;  4N59 A;  2DYM A;  2QDF A;  4PK1 A;  1RM6 C;  3A1Q B;  1JW9 D;  2XK5 B;  3N1X C;  3P4P B;  2WX1 A;  4MSM B;  1FNW A;  4C80 A;  1F77 A;  1GC6 A;  1YJI A;  1EF1 A;  2K25 A;  4KDL B;  4NZL B;  1MG8 A;  1QT9 A;  2DEN B;  3EUB 2;  5AZF A;  3X0W A;  2IJ0 A;  1HTO A;  2LJ5 A;  3QCA A;  3ZXR A;  1BUI C;  2GOW A;  2QC8 A;  1T0Q C;  4S0R A;  2LI5 A;  3DBH B;  1HXY D;  4US9 A;  4P7I A;  2BYV E;  2FBW B;  1YQ4 B;  4US8 A;  2K39 A;  2JXX A;  2N1W A;  3AE7 B;  2REX A;  2L76 A;  4IM0 A;  4A20 A;  2MLB A;  3NY5 A;  1WYG A;  1FMA D;  1LFD A;  4BZA A;  2PMV A;  3H8H A;  1C3T A;  3DOW A;  4ARI A;  2GBM A;  1WYW B;  1JWA D;  4HRO A;  3FKY A;  4KGT A;  3PO0 A;  3W1S C;  3GZN B;  4JLC A;  2N1V A;  3AEC B;  1U4A A;  2PVO D;  1KFY B;  3L0W B;  5EDS A;  5IA7 A;  1EU3 A;  1TZ1 A;  4YSX B;  2OJR A;  4KZC A;  3PLV A;  2AQ1 B;  2MBO A;  3IAS 1;  3A9J B;  2JWU A;  3P4S B;  3DWM A;  2ZW0 A;  2M0A A;  1YOV B;  1KJT A;  3PTF C;  4ZHP A;  2MHJ A;  2Y5C A;  2YLM A;  4A8X C;  3H6N A;  3C19 A;  2VH1 A;  4KKI A;  1VRA B;  1CZP A;  2R2O A;  3H7S A;  2KVZ A;  5HHD G;  1S3S G;  2FID A;  3SD5 A;  5G55 A;  1NBF C;  2PKO A;  1TS4 A;  1GAQ B;  1SSN A;  4KIK B;  1FCC C;  1C4P A;  4YWG G;  1QOF A;  4AJW A;  3L16 A;  2OJW A;  2BW2 A;  3EFU A;  4M8M A;  3I3T B;  1VR9 A;  2O6V D;  2FCM A;  2L3Z A;  1KLV A;  5CTR C;  5DPW A;  4MDK E;  3RZW C;  3A1Q A;  1FPY A;  3APD A;  1C4A A;  2W82 A;  4B0M A;  2FCQ A;  3GS2 A;  4H2A A;  4IDI A;  2IO1 B;  2KJR A;  3R7R A;  3NZ3 A;  2MJE A;  1JRP A;  1SEB D;  3U2S C;  2HD5 B;  5JHA A;  4FLH A;  3LB8 C;  1VJK A;  4CHK A;  3OG5 A;  1E8X A;  4ANW A;  3ZUN A;  4NQL B;  2JYT A;  4NAW B;  4KDI C;  4NNJ B;  4PS7 A;  4L2Y A;  2KTR B;  2MSE D;  2RGF A;  4LCD E;  3ZNG C;  1HQR D;  4LNK A;  1IBX B;  4DQO C;  3PS6 A;  3R66 C;  2XNA C;  1TYG B;  1VZ8 A;  1E10 A;  3NJT A;  1JWU D;  3LXF A;  3VRB B;  4ICU A;  4PS8 A;  3WIM A;  2BTE A;  1LO5 D;  5J17 A;  1P98 A;  1GB4 A;  1YQB A;  3Q3N C;  1ZXI A;  3B2F A;  2ASQ A;  1TY2 A;  1ZE3 D;  1WMH B;  2MH7 A;  2ZW1 A;  3A4R A;  3ZRC A;  1XD3 B;  2K8C A;  5CHF A;  2LZ6 A;  2WYQ A;  3RNF C;  3AUL A;  4YTP B;  3TL5 A;  2HJ1 A;  1RLF A;  1DOY A;  1HZ6 A;  2GBJ A;  1YMH E;  3DVG X;  5KHO A;  2B3A A;  3B2G A;  1TZO A;  1D5X C;  1WGH A;  4IUM B;  1E9M A;  2KJH B;  3PT2 B;  4BKS D;  2M56 B;  4IKG A;  2JZ3 B;  3PZ8 A;  1IP9 A;  2NPT A;  2V9H A;  2WWZ A;  3DVN U;  3KYD D;  1J7A A;  3TSS A;  2XBB C;  3MJW A;  1SF0 A;  4GN1 A;  1C4C A;  2MBE A;  4HKQ A;  2LMC A;  2WXL A;  2DAJ A;  1LM8 B;  1E7U A;  2QMT A;  4HDO A;  4B95 A;  4AS1 A;  1ROE A;  4BVU C;  3DBH I;  2BYE A;  3AM9 A;  4XDC A;  1WRD B;  2MRP A;  3PRE A;  4RGN A;  4NY0 A;  3AN1 A;  3ZTD A;  2IDY A;  2K6Q A;  3NOB A;  4HPL B;  2IO3 B;  2QHO A;  1EM7 A;  2D07 B;  1DGJ A;  1V97 A;  3ML8 A;  4MAC A;  1V9J A;  3DHI C;  4ARC A;  2IND C;  3BVZ A;  4FN2 A;  3T3N A;  1ZXH A;  2KFK B;  1KTK A;  3IFW B;  3ZVV A;  2JZZ A;  1ZW7 A;  3U30 A;  5IO9 A;  4WAA A;  1ET9 A;  1H8C A;  2J7Q B;  3TBL D;  2Q5W D;  1HE8 A;  2KQ7 A;  2KMM A;  2INC C;  1N6Z A;  1WSP A;  3I5J C;  4I6P A;  2L1A A;  2N7E A;  3NG0 A;  4AUQ C;  2RDB C;  3L08 A;  5D3D A;  1JWB D;  4M8N A;  3SU8 X;  2INN E;  3NRZ A;  4IC7 B;  4K1R B;  2IO0 B;  4M00 A;  4MJS A;  2N7J A;  1L6V A;  1WIA A;  4AQ7 A;  4A3O A;  2I38 A;  2G1E A;  2KX0 A;  3AE8 B;  1L0V B;  1E7P B;  2X8X X;  3RUL A;  4ZRI A;  1NYR A;  4DHJ D;  2A5U A;  1L4D B;  2LGD A;  3ZIM A;  1E7V A;  2ZVN A;  5L95 C;  3IBE A;  4GB9 A;  4TV3 A;  1Q1O A;  5FK9 C;  3S2A A;  1FO4 A;  1RRB A;  4ZRQ A;  2W3S A;  4DXA B;  2CKH B;  2K9X A;  3VVW B;  3AEF B;  1P3Q U;  2KO3 A;  1SIF A;  4S17 A;  1WI0 A;  1E8Z A;  2HJ8 A;  2CHZ A;  2NVU I;  1IUE A;  1A5R A;  3KWL A;  4GU2 A;  1TT5 B;  2WP9 B;  3B9J A;  3EA6 A;  4ITK A;  2JX5 A;  1JWM D;  2EMS A;  2AL3 A;  1TKY A;  3A9K B;  1F0Z A;  2ZEQ A;  2GB1 A;  3N30 A;  1YJ1 A;  1MJD A;  1L7Y A;  4WH4 A;  4O1N A;  4AWJ A;  2INP E;  3JW0 X;  1JAL A;  5D3I B;  4W9E A;  5HG2 A;  2W55 A;  4KIK A;  3AV8 A;  3W1Y A;  3TCA A;  4EUT A;  4J3O D;  2EMT A;  1S1Q B;  3DBS A;  3X23 A;  2N7D A;  1Y8R C;  3R7Q A;  2N9E B;  1I4P A;  2JUO A;  2PPH A;  4Q2J A;  2AEH A;  5IP4 D;  3JSV A;  1ZDX A;  2HDE A;  5G2N A;  1EU4 A;  2DBY A;  3OJ4 B;  4IWO A;  4N6E B;  2MBB B;  1WWT A;  3J9C A;  2JY6 A;  1YIW A;  1QIL A;  1WXQ A;  1KLU D;  2N9K A;  3Q3J A;  3AE3 B;  2BKR B;  3RZF A;  4C00 A;  2PEA A;  4LNN A;  2MP2 B;  3SDL C;  4ACF A;  2KAN A;  5H8Y E;  2JVC A;  3W2D A;  3AU5 A;  3P4R B;  3AE2 B;  4ASW C;  4RF0 A;  2WXG A;  4WJN A;  3V60 A;  2KMA A;  1UUP A;  3H7P A;  1UWX A;  2RR9 A;  4P1B C;  1WGG A;  3QAQ A;  1V1O A;  2J42 A;  4C56 C;  4CYE A;  2Z8L A;  2VH2 A;  4A90 A;  2IO2 B;  3MP9 A;  3KUZ A;  1XLQ A;  2KD0 A;  1N63 A;  1WFY A;  4IWQ A;  5IAA C;  3IT6 B;  2LUM A;  2KKC A;  4M0W A;  1L0X B;  4XGA B;  4OZA A;  4TUU A;  1WZ0 A;  1DYQ A;  3BWU D; 
#chains in the Genus database with same CATH homology
 1JML A;  1OQR A;  2LHD A;  5JXV A;  1HA5 A;  2WXH A;  4JWU C;  3Q69 A;  4KGR A;  3KWV A;  3AEC B;  3WCQ A;  1F2R C;  1I4R A;  3AE9 B;  4ZHO A;  1B1Z A;  1FRR A;  2PVO D;  1KFY B;  4WIP A;  3ZQ4 A;  5C3J B;  1P7E A;  4XWT A;  1EU3 A;  1SXT A;  2WU2 B;  4YSX B;  3BII D;  3T3O A;  2AQ1 B;  2NTS A;  2KDM A;  3IAS 1;  2JWU A;  3P4S B;  3C8Y A;  3DWM A;  2ZW0 A;  2M0A A;  3SFE B;  3Q8C A;  2BYT A;  5LNK 1;  4ZHP A;  3TUO A;  2Y5C A;  1FRD A;  2L32 A;  5BYR A;  4A8X C;  2JYE A;  4PT5 A;  2YEP F;  4YT0 B;  3AB5 A;  2QIL A;  1ENF A;  4KKI A;  2J52 A;  1VRA B;  4DXG A;  5C2T B;  1CZP A;  1FXI A;  1EWC A;  2IPK D;  3IXS A;  3HUI A;  3IAM 1;  2JXT A;  1QOA A;  1D4B A;  5AUI A;  1XCQ L;  5HHD G;  1D5Z C;  1TS2 A;  1A70 A;  1XLP A;  4OW0 A;  2H88 B;  2PKO A;  3W5U B;  1FNV A;  4RH6 A;  1TS4 A;  1GAQ B;  1SSN A;  2MEK A;  1FCC C;  3NVW A;  5EE9 A;  1C4P A;  1SE4 A;  2WXJ A;  1QOF A;  3KQ4 A;  4YWG G;  2AQ3 B;  3NUH B;  4KX6 B;  1ACC A;  2WXP A;  2BW2 A;  3AE5 B;  3NS1 A;  4KKJ A;  2WXM A;  1E0Z A;  3Q8B A;  4WUR A;  1QQR A;  1L5P A;  2J4X A;  1VR9 A;  1T3Q A;  3BZD B;  2FE8 A;  1V8C A;  2HTM E;  2BS4 B;  1I4X A;  2XN9 C;  1L6U A;  1ZPS A;  2L83 A;  1K52 A;  3ABV B;  1I4G A;  2JSV X;  1C78 A;  1C4A A;  3MFG A;  3NVV A;  2L52 A;  1KLG D;  4C7Z A;  4YSY B;  1B9R A;  2W82 A;  4B0M A;  3GS2 A;  2LEK A;  2LJI A;  5TSS A;  1K50 A;  4H2A A;  4IDI A;  2WXI A;  3NZ3 A;  1JQ4 A;  1D5M C;  2MJE A;  1UGJ A;  2GRI A;  2K5P A;  2OED A;  1ESF A;  1JRP A;  1SEB D;  2SEB D;  3VR9 B;  1J7B A;  3U2S C;  2V0G A;  1K53 A;  3LB8 C;  2E3T A;  1N61 A;  1VJK A;  5I4D A;  1WRI A;  3O13 A;  2N0S B;  1TKG A;  1JRO A;  4MM3 B;  2NMQ A;  1XO3 A;  4HEA 1;  1YJJ A;  3UI3 A;  1FCL A;  2WQY B;  4P16 A;  2JYT A;  4NAW B;  3OWE B;  4A55 A;  2TSS A;  4L2Y A;  1I4Q A;  1HQR D;  3TEX A;  1QKZ A;  1PDX A;  2K3U A;  4DQO C;  4HRS A;  2AQ2 B;  1IBX B;  2XNA C;  1TYG B;  2RMM A;  1QLB B;  1VZ8 A;  2W54 A;  1E10 A;  1JWU D;  4XWW A;  1VDV A;  3LXF A;  3VRB B;  2N9L A;  1C79 A;  3HRD D;  2BTE A;  1LO5 D;  2V3P A;  4LTU A;  1GB4 A;  2OHF A;  2PIA A;  1N62 A;  3BYY B;  1ZXI A;  3B2F A;  1CQV A;  1Q10 A;  1TY2 A;  4YTM B;  1JWS D;  2WNM A;  1ZE3 D;  2KAJ A;  2MH7 A;  1AYF A;  1D6E C;  2ZW1 A;  3W1S A;  4RNA A;  1HZ5 A;  3P63 A;  4WAF A;  1PUT A;  1K51 A;  2E6X A;  4YTP B;  1E6E B;  5D7G A;  1F2R I;  4A9A A;  1TKE A;  4RCO A;  1RFK A;  1N60 A;  1DOY A;  1HZ6 A;  2J53 A;  2PLP A;  4YXD B;  3FIL B;  1AWD A;  2CJO A;  1YMH E;  1YQ3 B;  1DOI A;  3AED B;  3TEY A;  3AEG B;  2WDV B;  3B2G A;  1I4H A;  1YN3 A;  1YNT E;  2Y5P A;  4XE0 A;  1TZO A;  4ZRP A;  1D5X C;  1E9M A;  3BYT B;  1J7C A;  1T5X D;  1C77 A;  4JE3 B;  1ZP0 B;  2M56 B;  2WDQ B;  1RWS A;  4IKG A;  3PZ8 A;  1TS3 A;  3Q8E A;  1C9F A;  2X38 A;  2PVG C;  1J7A A;  3TSS A;  4A6Q A;  2R61 A;  3ZJU A;  2GI9 A;  4EE2 A;  3W9C B;  3AE6 B;  5BMH A;  1SF0 A;  1GPX A;  3AH7 A;  4WQM A;  3LYY A;  4JWS C;  4R3D A;  2MJD A;  2DLB A;  1NI3 A;  1C4C A;  5HI1 A;  4HKQ A;  4HKZ E;  3DWG C;  2AX5 A;  3TEZ A;  4TMA B;  2LMC A;  5H92 C;  1TS5 A;  2WXL A;  3CIR B;  4UDU C;  2LGI A;  1GB1 A;  2QIE B;  2BS2 B;  1XLO A;  2PTL A;  3Q8F A;  3P1M A;  3ZGZ A;  1IBX A;  1SB3 C;  2QMT A;  3MJ5 A;  5T8I A;  1SJE D;  1I7H A;  4AS1 A;  2DWQ A;  1ROE A;  1QOB A;  1T6B X;  1VZ7 A;  1FEH A;  3AM9 A;  4XDC A;  3V3X A;  3L4P A;  4RGN A;  3I9V 1;  1XF5 L;  3AN1 A;  5EE0 A;  2IDY A;  3PZ7 A;  1PFD A;  3NVZ A;  3RPF C;  1L0Y B;  2IGG A;  3U52 E;  2RDG A;  1NYQ A;  1STE A;  1YN4 A;  1L4Z B;  3AMZ A;  1FD6 A;  3FC4 A;  1EM7 A;  1DGJ A;  1FM0 D;  2IGH A;  1JCK B;  1V97 A;  2ON8 A;  4MAC A;  4ARC A;  1XLN A;  2G9H D;  3BVZ A;  2V4I B;  3T3N A;  1BML C;  1FXA A;  1Y56 A;  1BXT A;  1SE3 A;  1ZXH A;  2FUG 1;  1KTK A;  3P4Q B;  2ONQ A;  4RGO S;  3GP7 A;  2JU6 X;  3BK1 A;  1N5X A;  1DOX A;  1NEN B;  1KRH A;  2K0P A;  2WXQ A;  5MPO A;  4YSZ B;  4XDD A;  1C76 A;  4JPS A;  1ET9 A;  5FKA C;  3EGR A;  3MC0 B;  4WWM A;  2WXF A;  2RPV A;  2Q5W D;  4LLG M;  2YEP B;  2MJ3 A;  1YN5 A;  2KMM A;  1WSP A;  2L1A A;  2SAK A;  1P7F A;  4MH8 A;  2ACZ B;  4GDL B;  2DYO A;  3R2T A;  5D3D A;  2BS3 B;  5FR3 A;  1JWB D;  1QOG A;  2INN E;  3NRZ A;  4GLS C;  4P6V F;  3U4E G;  1FFV A;  3R8B A;  2KQ4 X;  2N7J A;  2WS3 B;  2BBC A;  4N58 A;  1L6V A;  1AN8 A;  1M4V A;  4OZB A;  5G5H A;  1CJE A;  4NAM A;  4AQ7 A;  2QEJ C;  1EWY C;  2I38 A;  3AEE B;  2G1E A;  1R7S A;  1QF6 A;  1PGA A;  3AE8 B;  1MHX A;  2EEL A;  1IGC A;  1L0V B;  2VZK B;  1UWM A;  2KN4 A;  1E7P B;  2NTT A;  4RF1 A;  3VR8 B;  1NYR A;  1ZUD 2;  5BMI A;  1L4D B;  3KLS X;  2JQR B;  3R2I A;  3SEB A;  3AEB B;  3AEA B;  4C7Y A;  1NEK B;  1N5W A;  2WXK A;  5BMG A;  3VQI A;  1XCT L;  5FK9 C;  1FO4 A;  4NJC A;  4ZRQ A;  2W3S A;  1MPE A;  3HVZ A;  2K9X A;  4USA A;  3ZYY X;  1XXG A;  2WXO A;  4LK0 M;  3AEF B;  1FIQ A;  5GXG B;  1KH0 A;  1SJH D;  4B0E A;  1FNU A;  1VZ6 A;  3E9S A;  3N9Y C;  1NVI D;  3ETR A;  4RGT A;  1IUE A;  1RYJ A;  1IGD A;  3KWL A;  4YTN B;  1SBB B;  2WP9 B;  2QJL A;  3B9J A;  1CK1 A;  2D5G A;  5HFY A;  3EA6 A;  3SFD B;  2H89 B;  4ITK A;  1OFF A;  1JWM D;  2JX5 A;  3VRA B;  1TKY A;  2KAC A;  1F0Z A;  3MHZ A;  1FFU A;  2JZP A;  2GB1 A;  1HEZ E;  1ET6 A;  4MT5 A;  1ZOY B;  2BB5 A;  5BYS A;  3GB1 A;  1PGX A;  4O1N A;  4WH4 A;  3TEW A;  3NVY A;  2INP E;  1JAL A;  1V1P A;  4TQ0 A;  5D3I B;  5G5G A;  1MI0 A;  2WLB A;  5HG2 A;  3IT4 B;  2KWD A;  2CJN A;  2V3N A;  2W55 A;  3HVD A;  2WXR A;  3E56 A;  4L23 A;  1KF6 B;  4TQ1 A;  5E6J A;  3ZJV A;  3AV8 A;  4RGM A;  2B76 B;  1PYW D;  1ZDV A;  3FIL A;  4L1B A;  4J3O D;  1OQQ A;  2BB6 A;  4HJG E;  3SR6 A;  2LHE A;  3BK2 A;  1MVK A;  1XEE A;  3W5V B;  2BT6 A;  2K22 A;  1I4P A;  4ZYS A;  4OHJ A;  4Q2J A;  4OZC A;  1ZDX A;  2RDH A;  2HDE A;  1EU4 A;  2DYM A;  4N59 A;  4RFB A;  4IOI E;  2DBY A;  2IGD A;  1RM6 C;  1VLB A;  4N6E B;  1SIJ A;  3J9C A;  1JW9 D;  1WWT A;  3P4P B;  1QIL A;  1WXQ A;  5EE1 A;  1KLU D;  2N9K A;  3BVM A;  3P42 A;  2I2Y A;  1FNW A;  4ZOH C;  4C80 A;  4REZ A;  4JX1 C;  1F77 A;  3CWI A;  1WGK A;  1YJI A;  1V1P B;  2M19 A;  3AE3 B;  3RFZ B;  1TY0 A;  2CU3 A;  2Y3A A;  5AUK A;  4NZL B;  1QT9 A;  1TJE A;  3EUB 2;  5BYQ A;  5H8Y E;  3U7Z A;  2IJ0 A;  2QSD A;  3W2D A;  3URY A;  4D2K A;  1GOZ A;  3P4R B;  3AE2 B;  3AE4 B;  2WXG A;  4RF0 A;  1UUP A;  1BUI C;  1UWX A;  1AW7 A;  2LFI A;  4FXC A;  1V1O A;  3I57 A;  3V05 A;  4GDK B;  4DXF A;  1HXY D;  2J42 A;  2PW9 A;  4US9 A;  4OVZ A;  4C56 C;  2FBW B;  2VZK D;  2Z8L A;  4KGS A;  4A90 A;  5EE3 A;  1YQ4 B;  4US8 A;  1SE2 A;  3MP9 A;  3AE7 B;  1XLQ A;  2WDR B;  1MHH E;  1WYG A;  1FMA D;  1N63 A;  2ICI A;  3BVG A;  2WXN A;  3FAH A;  2WU5 B;  2PMV A;  1UNS A;  2EKI A;  3H8H A;  1PGB A;  4CQN A;  3IT6 B;  4ARI A;  2LUM A;  3AE1 B;  3Q8A A;  4M0W A;  1JWA D;  4TSS A;  1L0X B;  4OZA A;  3ZJT A;  4HRO A;  2W3R A;  3PO0 A;  1DYQ A;  3BWU D;  4KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...