2J53A

Solution structure of gb1 domain protein g and low and high pressure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G-BINDING PROTEIN G
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j53A00
1FD6A 1YMHE 2OEDA 2KACA 1EM7A 2PTLA 3FILB 1GB4A 1MVKA 2IGDA 1XCTL 4KGRA 1UWXA 2K0PA 2JU6X 4HJGE 1K51A 1MPEA 2GB1A 2JXTA 4GLSC 3UI3A 5BMIA 1YNTE 2I38A 2LGIA 1GB1A 2IGGA 2KDMA 1KH0A 2QMTA 1HZ5A 4KGSA 1PGXA 2ONQA 1IBXB 1K50A 4MACA 1QKZA 5HFYA 2I2YA 4IKGA 1XF5L 1FCCC 2ZW0A 2N9LA 2JSVX 1MI0A 4D2KA 2J53A 3GB1A 1HEZE 1FCLA 1IGDA 5BMHA 2EELA 1F2RC 2J52A 1MHXA 1JMLA 2LHDA 2RPVA 1IGCA 1XCQL 2ON8A 2KWDA 1C9FA 5HI1A 1D4BA 1Q10A 1IBXA 2LUMA 2PW9A 4OZAA 1PGAA 4OZCA 1K53A 4KGTA 5HG2A 2KQ4X 2IGHA 1ZXHA 5JXVA 2N7JA 2JWUA 2LHEA 4WH4A 2PLPA 2RMMA 1HZ6A 1P7FA 1PGBA 4OZBA 2GI9A 2KN4A 5BMGA 2NMQA 1P7EA 3V3XA 2ZW1A 1K52A 2QSDA 3MP9A 4IOIE 2JZPA 1F2RI 4HKZE 5HHDG 3FILA 1MHHE 2N9KA
chains in the Genus database with same CATH superfamily
4YTPB 2FE8A 1EM7A 4NQKE 2KYWA 4WJNA 2BB5A 2FUG1 3EGRA 2EKIA 2L52A 2X8XX 1ZW7A 4JLCA 3H9DA 4GLSC 1P9DU 4ZYSA 1C4PA 1R7SA 1V5TA 3P4QB 1PGXA 3VAWA 5CTRC 2C7MB 1FFUA 1WGKA 2N9LA 3FAHA 2W82A 3MJWA 1CQVA 1WXSA 4D2KA 3NVYA 3RYTA 1R4MB 1ROEA 3H7PB 2QJLA 3DVGY 2KJHB 2ZNVB 4RM8A 4WAAA 1SIFA 4WWMA 5JHBA 4WAFA 2M4NA 2EELA 2L83A 3Q8CA 2QHOA 3VUXA 4X57B 1WFYA 5H92C 1C4CA 1WRIA 2ON8A 4JWUC 1C9FA 1EU3A 3UINB 4DHZE 3V05A 4P16A 3IAS1 2LMCA 2L32A 2HD5B 4BOZB 3MTNB 4PS7A 2NBUA 4HPPA 1JCKB 5IN7A 1LO5D 2LFIA 1ZGUB 1TGZB 4C4VA 3DBLI 3EUB2 1WXVA 1XO3A 2I1JA 2MH7A 2Q5WD 3AEAB 3C0RB 5EE0A 3AE9B 2LUEA 2KHWB 1A70A 2CHXA 3DDCB 3VXWA 5AUKA 3MP9A 4XWWA 2BT6A 4IOIE 4II2B 2REXA 3Q3MC 4XZ4A 3H1UA 4ZRKA 3ZTCA 1MHHE 4RFBA 3ZNHB 4ICVA 4TMAB 3LXFA 1Y8RC 4E74A 3FILB 1I4RA 2BW2A 4JX1C 2WDVB 1CJEA 2V3PA 1SE2A 1WJNA 1WI0A 1E5WA 2CJOA 3DOWA 3ZRFA 2QILA 4FJZA 2MJDA 3B9JA 3HM6X 4TUUA 3A4RA 4ANWA 4GOCA 2MLBA 3CSFA 3NVVA 2KDEB 2WDTB 3V62A 2BF8B 3IG3A 2EMSA 2AYOB 3NY5A 3IT4B 2BQQA 3IXSA 2VH2A 3RULA 1QOFA 2ZNVC 1OEYA 3HIZA 4ZOHC 4W9CA 4W9KA 1GPXA 2N9XA 2MCNB 4F7ZA 3R2TA 2DX5B 3R2IA 5E6OA 3B0AA 1HA5A 1IGCA 3NUHB 5CX3A 3BK2A 3ZUNA 4RF0A 4WWOA 1VZ7A 1YQ4B 1YX6B 1RAXA 3AM9A 2KFJA 4OZCA 1K53A 1T5XD 1G6JA 3VR9B 4EEWA 3A33B 4FULA 2K9XA 3ZXRA 4WJPA 1HZ6A 1SB3C 4EKUA 3QX1A 2GI9A 4XE0A 4AJWA 2BS2B 1F0ZA 3M63B 4GN1A 3MJ5A 1UUPA 1K52A 2FAZA 2G9HD 3PVLA 2BKRB 1E10A 4GDKB 3IFWB 4BKTA 2WXPA 1NBFC 1QLBB 3QARA 1B1ZA 3EFUA 5IP4D 4I6LB 3WAOA 4L1BA 3BYTB 1ZUD2 1T0SC 1ZXIA 3B1LX 4A8XC 2GBNA 2A5UA 3APCA 4DWFA 2W3RA 3PTFC 5DPRA 4BVUC 2LJ5A 4KIKB 4HKQA 3K9PB 3ZXVA 3MFGA 1P0RA 4DDID 1K50A 1T3QA 1WGDA 2V3SA 5HFYA 3JW0X 2I2YA 3ZKJC 2D3GA 1S1QB 1QT9A 4JQWC 3NZ3A 3VUYA 3PZDA 1JRPA 4ZRJA 1FRDA 3N20C 3ZNGC 3I57A 4JL9A 3SFEB 3WA0A 4OVUA 2RSUA 2VRRB 2FIDA 3DBLB 5IO9A 1Z5SB 2WNMA 1OQRA 1UWMA 3M3JA 3NS8A 4M0WA 4FADA 4C80A 4IC7B 4C00A 1F77A 3L08A 2KNBA 4CYEA 2KQSA 4MH0E 2HJ1A 4DHJD 4A9AA 3PO0A 4REZA 3Q14C 1ZDVA 1XQQA 3E9SA 3KUCB 1D5MC 4PS8A 2RGFA 4F1SA 5E6JA 1TT5B 2BWES 3BIID 1SBBB 2V0GA 4KKJA 3QWZB 1PGBA 1HTQA 1D5XC 3RZFA 4P6VF 2TSSA 4ANXA 4BZAA 3KW5B 3NS1A 3VH4B 2O6VA 2XK5B 4MM3A 2B3AA 3VTVA 1LQBA 3RPFC 2YLMA 2KFKA 3Q8AA 1PYWD 2WXJA 2JQRB 2W54A 1CZPA 3OWEB 4JPSA 1VR9A 1UWXA 5LXIB 3P2BA 5LNK1 2LGIA 4RGMA 4ICUA 3Q8BA 5FKAC 2JF5A 4IKGA 1TKGA 2D07B 3M62B 3AXCA 1WX7A 3V6CB 4NJ6A 4J3OD 4YSYB 1YD8U 3GB1A 1XLOA 1KJTA 3ZNID 4CQNA 3APDA 3P63A 3Q3OC 4A3OA 4LNNA 5KHQA 3GE3C 2KD0A 1JMLA 4NPNA 2KWDA 1TS5A 2YEPF 1T0RC 5D6JB 2JXXA 4GSWA 1P98A 4LDTB 1WXQA 3VH3B 1FM0D 2R61A 1JWSD 1P7FA 1BT0A 2GBMA 3KWLA 4ANVA 5IKCM 2DYMA 1GUAB 2MEKA 1YJIA 4W9JA 2QSDA 2WX1A 3ZLZA 4N9F4 1C77A 2KVRA 3PRZA 3AB5A 5DCNA 3LYYA 4USAA 3ZGZA 4B6WA 1VRAB 1OFFA 2ICIA 3MC8A 1UH6A 2RDHA 5HKHA 4YSZB 2KDMA 5KHOA 4EFOA 1HZ5A 2IJ0A 3PV1A 3NVZA 2WXMA 4URKA 3ZDTA 2NCNA 4XC2A 5BYQA 5FK9C 1NI2A 2DAFA 4BAXA 4YTMB 2KWCA 3W5VB 2QDFA 5FR3A 2FBWB 1AN8A 5EE9A 3BK1A 3QA8A 4W9FA 3H8HA 1FXAA 5AZGA 2DHZA 1F2RC 3VRAB 1EF5A 1XCQL 3AV8A 2E6XA 4KVGB 4GDLA 2LGDA 4OVZA 3L4PA 1J7AA 1J0GA 2WXFA 3WALA 1X1MA 1VDVA 3P42A 1FXTB 2PW9A 4WJQA 1WR1A 1JWUD 3BYYB 4P7IA 4BBNC 2WWZA 3RT3B 4RGTA 3ZJUA 1TZ1A 3ZJVA 3KVFB 1FNUA 1XEEA 2CHZA 1NYRA 1RLFA 4WH4A 3BVMA 3V61A 2BYFA 1QOGA 5C3JB 3IAM1 4EZKA 2PE6B 2W9NA 1V1OA 1H8CA 1FIQA 4A3PA 3URYA 1E90A 3Q69A 1EF1A 1VZ6A 5G5GA 2KDBA 3JSVA 1C78A 1AARA 2CS4A 2J7QB 2HE7A 2QIEB 3GE8C 3ZDMC 2KACA 2PTLA 2R2OA 3WAPA 4NJ7A 2BYTA 4IWOA 4KDIC 1XCTL 2XK5A 3L54A 3Q2AC 1WR6E 1YNTE 4HXDA 3DBHB 1GB1A 3AEBB 1KH0A 4AJYB 4AQ7A 4BBNF 5C2TB 1FNWA 1TY0A 3AH7A 2KTRB 1OTRB 2ZW0A 1GG3A 2INDC 1YJJA 1JWAD 2KLGA 3N9YC 4TSSA 1MG8A 1U4AA 3PHXB 3Q3JA 4C7YA 2C5LC 5IAAC 3T3OA 1E7VA 1E8WA 2Z0EB 3KWVA 2ZCBA 3I5JC 3GP7A 1K8RB 2AQ3B 2D5GA 4DXGA 1V5OA 2JUOA 2WXNA 2ZJDA 5HG2A 1MG4A 1VZ8A 5AEKB 3DWGC 3SD5A 4XYCA 2G3QB 4DHZB 4FN2A 3VTUA 3AE5B 2CU3A 3UGBB 4OZBA 2K6DB 2XEWA 2WLBA 3ZNZB 2LXCA 3V3XA 1DOIA 2JYEA 1QOBA 2JX5A 1N63A 4BFRA 2IO2B 3ZO5B 5G2NA 2CU1A 4GXBA 1P3QU 1YMHE 2MSED 1EUVB 2FCQA 1C76A 2RDBC 3DPDA 4RGOS 1E0ZA 2KC2A 4RCOA 4HCNB 1HQRD 3KH0A 2K0PA 2EMTA 3PZ8A 2KDIA 3T3NA 3MC0B 1MPEA 3AECB 3N1ZC 1ISNA 1I4XA 2D2QA 3R66C 2J0MA 2KXJA 1V9JA 5MPOA 2WXIA 1KLGD 2M8SA 4KGSA 3A1QB 1WGYA 5BYRA 3TEYA 5IA7A 4M02A 4ANUA 2NPTA 4MEMA 4AOFA 2FUHB 2WXOA 1SGHA 2UYZB 1TTNA 2NTSA 4TKNA 2W3SA 1WYGA 4TQ0A 2WP9B 2LGYA 3QCAA 1V1PA 3WAMA 1UGMA 4LNOA 3W9CB 4A55A 1UBIA 3ML8A 5E6NA 4FXCA 2B76B 3TL5A 2MP2B 3B2FA 3RI7C 1XLQA 4FHJA 4PK1A 2MHJA 2AL6A 2BBCA 4WQOB 1OQYA 1C4AA 4GDLB 5D7GA 1TKYA 4LLGM 3I3TB 1DGJA 3U30A 5IOIA 2RMMA 1J8CA 2MX2A 3AEEB 4IM2A 2J0KA 2V1YA 3AE8B 3ZW3A 2N7DA 2NMQA 3GOEA 4PYUA 1Q5WB 5TR5A 2DZMA 2NPTB 1F1HA 3DVGX 3IHPC 4M01A 2G45B 3ALBA 1JWMD 1QZEA 5AZHA 3AU5A 2Y5CA 2KOXA 4AUQC 1IUEA 2VZKD 3C19A 2G4DB 2DAJA 1XXGA 3H7PA 1OQQA 1WXMA 2WDQB 3AE1B 2WXGA 4HROA 4CHKA 3RNAC 4L2YA 4GDKA 1NEKB 2UU7A 4N58A 2IBIB 2LXAA 3QAQA 3HK0A 1HEZE 4KSLC 3P4SB 2V4LA 1IGDA 3Q8EA 3L10B 3I9V1 2GBRA 2ZCCA 2OOBB 3R7QA 1WE6A 3MC9A 3U8ZA 3O65B 4H2AA 3NZSA 4OW0A 1D4BA 3SDLC 2KQ7A 4M8NA 3AEGB 1WZ3A 2LWPA 3AE6B 4BKGA 2AX5A 3MHZA 3IT6B 4RNAA 3SFDB 1IP9A 2NBWB 1GJZA 1TBEA 5C23A 4O1NA 1RFKA 5JHAA 2KT7A 4US9A 3PHWB 1FMAD 2N1WA 3WCQA 4LCDE 3L17A 3KYCD 4HVBA 2M19A 2WS3B 5BMGA 3UQBA 4NJCA 4MSQB 3WANA 3LDZE 1PDXA 2L0FA 4MH8A 2MBBB 2WXHA 2DZKA 4IM3A 2LRUA 3ML9A 3PRMB 4TQ1A 2OEDA 2HJ8A 4IWPA 5H8YE 2AWTA 3K9OB 3AULA 1JW9D 1QILA 4LJOB 4XGAB 3FC4A 3V6EB 2G4SA 1KFYB 4C56C 1Q0WB 3AU4A 1XLNA 3EHVA 2DYBA 4FHKA 1C1YB 1BMLC 1WGGA 2DNFA 1SE3A 4MACA 3N3KB 2RR9A 3A4SC 3PRPB 1I42A 3KYDD 2LJIA 2JSVX 2V9HA 2WXRA 4ACFA 4TV3A 1I4GA 2DZJA 3O13A 2ZVOA 2LRWA 5JH5C 1WGHA 5BMHA 2L0TA 3Q3NC 4BKSD 1ZPSA 5AZFA 2KMCA 3JYUA 4KZCA 1N5WA 4L23A 4K3BA 4XDDA 1PFDA 4NAWA 2FIFA 1LFDA 2O6VD 1V8CA 1WMHA 1MFWA 2D3CA 1Z2MA 4YWGG 5GMVA 2PVGC 1TS3A 3N1YC 2PKOA 2JRHA 2ZPYA 3EC8A 1WYWB 3DHHC 1GAQB 1TYGB 2D3BA 2CJNA 1VD2A 4KDLB 3SEBA 1DYQA 3RN9C 4XWTA 4JE3B 3CIRB 4WQMA 2JWZA 1AWDA 5FR6A 1TJEA 4OHJA 1V97A 2ZW1A 4FJVB 5DPSA 4KZ0A 2JZPA 1TS4A 2J0JA 4I6PA 1I4QA 2Z59B 5G55A 5C1ZA 4KX6B 2BYEA 1FEHA 2GLSA 2C7NB 2MRPA 2PJHA 2WXLA 4YSXB 2Y3AA 3W1YA 3ETRA 4KGRA 2DENB 2INNE 4BOSC 1SSNA 3ZJTA 2I38A 1T0YA 3DBRB 1LM8B 3TEXA 2INCC 4ZHPA 4LDTD 3N1XC 1XF5L 3PGEA 1V6EA 4HDOA 1TZOA 2DZIA 3RNBC 3L13A 2KWUB 3QK0A 4HPMB 3VQIA 4ITKA 1L0VB 1YQBA 4LNKA 3W1SA 1EWCA 3EECA 3RMKC 3U7ZA 3ENEA 4M8MA 4LJPB 4HJKA 2VH1A 1R4NB 3Q3FA 2FCSA 2ACZB 2LHDA 3TCAA 2W55A 2NVUI 4WIPA 5HI1A 1IPGA 1LXDA 2LUMA 2WYQA 4LNFA 1S3SG 3DBSA 4NQLB 4HK2A 1ZE3D 3OG5A 3RZWC 3A9JB 3P4PB 2LASA 4K7WA 4S17A 4JIOU 4HPLB 2J4XA 3R3MA 4MSMB 3QIJA 2DWQA 2K1FA 1JALA 1HXYD 1JROA 3LB8C 3EFCA 3CSTA 1NENB 3ECIA 2N0SB 1WXAA 1SEBD 4US8A 2KFKB 1N5XA 5CHVC 2K25A 2PE9A 1UZXB 2WX0A 1C3TA 2C9WB 4FBJB 2KC1A 2JYTA 2L8JA 3FILA 2KMAA 2YEPB 2L00B 4C4VB 1Y56A 2JT4B 1L2NA 2K39A 3PLUA 1AYFA 1R4MI 1SJED 4DBGA 1V86A 5J18A 1WIAA 2DYOA 2KO3A 3VHTC 2JU6X 2O2VB 5BMIA 4PYZA 1XT9B 3U7DA 2MBHA 3IBEA 4NAMA 4RF1A 4YTNB 3N32A 4AWJA 4W9IA 1KF6B 1F52A 2XBBC 1SE4A 3PT2B 5L95C 1EWYC 2H88B 4PT5A 2JVCA 2MQJA 1L5PA 1IYFA 2RPVA 4N6EB 2C60A 2M17A 2K8BA 4KSKC 1V81A 5GXGB 1WE7A 4OZAA 5LXHA 2FCMA 4G3XB 2I1KA 4J6IA 1VCBA 2RD0A 3AE3B 2D10A 4MT5A 3DCGA 4DQOC 1WX8A 1CK1A 1NVID 3NVWA 3VUWA 1A5RA 2KQ4X 2IGHA 2M56B 1WMHB 4WWPA 2WXQA 3TSSA 4FJYA 1WSPA 2R2QA 5DPTA 2KAJA 1V1PB 4RM9A 4W9GA 1QQRA 3JSVB 1I7HA 1L6UA 1L4ZB 1QOAA 2LGXA 3DBRI 2BPSA 2K8HA 1KOTA 3S2AA 3DVNV 2NS5A 3E56A 3UIPB 1OGWA 2KZRA 4MGYE 4HKZE 4GGQA 2IY1B 2BVCA 2IZVB 3W2DA 5LLIA 2WXKA 4YL8A 2CR5A 1AW7A 4EZLA 1WZ0A 4FA6A 1J7CA 3ZRCA 3PS6A 3UQAA 2PVOD 3PREA 1WY8A 4HWIB 1K51A 2HTHA 2IDYA 2JXTA 3BWUD 3VDZA 2V4IB 1T6BX 2QMTA 3IVFA 5T8IA 4HLEA 3ZIMA 2M1MA 2AL3A 3WIMA 3NRZA 4EUTA 2K3UA 1ZP0B 2K6QA 1I35A 1FCCC 4MGZE 1UBQA 4RH6A 2XN9C 1JRUA 1YIWA 4I6NB 1DOYA 1E8ZA 3AE7B 2RDGA 3QHTA 2A4ZA 5I4DA 2KDFB 3AE4B 2HDEA 3BVGA 2J52A 4S0RA 3TUOA 3FKYA 4B0MA 1KLUD 5J17A 3VVWB 3ABVB 1NYQA 2Y5PA 3DHGC 1DOXA 3ZTDA 4HEA1 4W9EA 4NY0A 1YQ3B 2N1VA 2GRIA 2NTTA 3A9KB 4KGTA 5CHWA 1M4VA 2MWSB 2KJRA 3ZVVA 3NHEB 1JQ4A 2BKFA 2ZVNA 4C7ZA 1SJHD 3RNFC 4DDGD 4XX5A 1YJ1A 2BS3B 1M94A 3GS2A 4XDCA 1CMXB 3LJ3A 2MBEA 4P1BC 3CF6E 2UWQA 1FPYA 1MJDA 1P7EA 2BS4B 5BYSA 2E3TA 2KWVB 4M00A 3RUIB 1H4RA 4K1RB 1E9MA 3OJ4B 1WJUA 1N62A 4ASWC 4GB9A 3RNEC 3RD2A 3OJ3A 1P1AA 4IDIA 1XLPA 4Q2JA 1WJ6A 3UIOB 2IGDA 2VZKB 1SIJA 4HCPB 4RGNA 1WGRA 2L7RA 2BTEA 3MHSD 4DK5A 2M0XA 4P1CC 4NZLB 4PS3A 2GBJA 2J42A 2ONQA 5D3IB 2KX3A 4MGIE 4WJOA 3J9CA 5BO4B 1MI0A 2KTRA 4GIVA 2J53A 2D11A 3PZ7A 1L6VA 4WURA 3KUZA 2G1EA 5D3DA 3U4EG 1J7BA 4CO7A 4IM0A 2JZZA 2KKCA 3UF8A 3DHIC 2MJEA 2MA9B 3U2SC 5CHFA 3T9LA 4GMVA 1V49A 2WU2B 4AP4C 4DHJB 2LD9A 3RCZA 3V60A 4ZYNA 4B0EA 4G11A 2YVCA 3B2GA 2JRIB 2WGSA 1I4PA 3HHMA 1YN3A 1EO6A 1WH3A 3W1SC 1ZXHA 5JXVA 2OJWA 1KTKA 2V3NA 2N7JA 1JWBD 4FLHA 4II3B 3DQVA 3P1MA 1PQSA 3BY4B 2MBQA 4F8CB 2FNJB 3CWIA 2LVPA 2LGSA 3VRBB 2KN4A 3L0WB 1ENFA 4IWQA 1T0QC 1NI3A 1R4NI 1V2YA 2K5PA 2N4FA 1L7YA 5G5HA 4K81A 2WDRB 5D94A 4ZRIA 1FXIA 1YN4A 2WU5B 1FD6A 1V80A 3A1QA 3BZDB 4B9KA 3QQ8B 1ZDXA 3HVZA 2PMVA 2ZZPB 1GNUA 1BUIC 1YX5B 3AE2B 2SAKA 1E7UA 3BVZA 4W9DA 2O6VB 2ASQA 3UI3A 3NG0A 4YXDB 2KANA 1E8XA 4K3CA 1TKEA 1KLVA 4G0NB 1QKZA 4M0WB 2CHWA 4W9HA 3TJPA 2IYDB 1N60A 1WM3A 2INPE 3QJZA 1WM2A 4MM3B 1WWTA 4ARIA 1GOZA 2IO3B 3D32A 2KVZA 4LK0M 2LZ6A 4KV2A 1C79A 2NBVB 5AUIA 1FNVA 3ONSA 1E8YA 2D3AA 5J2RA 2L1AA 1L0XB 4WWNA 4OVVA 2LVOA 2NR2A 4G50A 2KJ6A 2BWFA 2L76A 5D2MB 3VTWA 5DPWA 2K8CA 2MP2A 3RNGC 1FO4A 3ZQ4A 3HUIA 3M95A 3H7SA 1BXTA 4MGKE 3C8YA 1RYJA 4NAWB 3NJTA 4LNIA 4BKSA 3NZUA 1ZOYB 3Q6BA 4KIKA 1KRHA 4LTUA 3TEZA 3ZYYX 2SEBD 2LVQA 2JY6A 4MELA 4ZHOA 1D6EC 1ESFA 5JZEB 3KQ4A 1SXTA 3PSEB 2C7HA 2Y5BB 1GB4A 2QEJC 1FRRA 3RNCC 4EZJA 2GB1A 2CKHB 3RFZB 3OAWA 3TBLD 3GZNI 3T8MA 1WJ4A 3SR6A 2AEHA 1UF0A 1RRBA 2X38A 5EDSA 1N61A 2MW5A 4B95A 1D5ZC 1J19A 2IO1B 2QC8A 4A6QA 2PIAA 3TMPB 1GC6A 4ZRQA 2K22A 4EE2A 1TS2A 1FCLA 3DVNU 4MJSB 3EA6A 2M0AA 1UNSA 1ZKHA 5EE3A 2JPHA 3AMZA 3R8BA 4A20A 4UDUC 4A90A 1L0YB 1MHXA 3OLMD 4GU2A 4NNJB 1I4HA 1UGJA 3PLVA 1Q10A 4MDKE 1XD3B 1IBXA 1PUTA 2WQYB 1YOVB 1ET6A 5E6PA 1UD7A 2GOWA 2KN5A 2H89B 2L05A 1VLBA 2XNAC 3AN1A 1N6ZA 4RMAA 3R7RA 3HVDA 4EOYA 2DBYA 3SHQA 3X23A 2JWUA 3DWMA 2LHEA 3PPAA 4HDQA 3BINA 1ET9A 2IO0B 2MBOA 1SF0A 1WX9A 1SE9A 2EKEC 3X0WA 2ZPNA 1L4DB 3TEWA 2FCNA 4K7UA 5TSSA 2IPKD 1Q1OA 3P4RB 2BGFA 1F2RI 3JVZX 4E3CA 3I63C 4YT0B 4N59A 4KKIA 3KLSX 3AEDB 1OEYJ 1QF6A 1MVKA 1VJKA 4MJSA 3HRDD 3L16A 1WRDB 5EE1A 4HJGE 1EU4A 4IUMB 2OHFA 2IGGA 2KLCA 2N7EA 1ACCA 1HTOA 2AQ2B 1IBXB 3KUDB 3DBHI 2WHIA 2Z0DB 4ZDVA 2AQ1B 1RM6C 4R3DA 1NDDA 4IW0A 1YN5A 2GBKA 2QCZA 2RPQA 1E7PB 2HTME 3APFA 2PEAA 3A9JA 1E6EB 3VR8B 1TY2A 2BB6A 2MJ3A 3CMMB 4JWSC 5L83A 2L3ZA 2LI5A 2Z8LA 3U52E 1B9RA 3H6NA 4JGHB 3W5UB 4W9LA 3SU8X 2N9EB 4DXFA 1PGAA 4K7SA 2LEKA 2GMIC 1GC7A 2KK8A 2OJRA 1F9JA 1FFVA 3Q8FA 2KX0A 1KM7A 1TIFA 1STEA 3AEFB 4HRSA 2IY0B 3B08A 1LGRA 4E71A 2PLPA 4AS1A 3TIXA 2DLBA 3VFKA 4IG7B 1RFAA 4ZRPA 3AI5A 1RWSA 2ZEQA 2KMMA 3GZNB 3HM3A 1HE8A 4ARCA 1UELA 3N30A 1WF9A 3A9KA 2N9PC 2PPHA 3NOBA 4DXAB 2O2VA 1D3ZA 2BYVE 2JZ3B 5HHDG 2KTFA 3QC8B 2N9KA 4QAYA
chains in the Genus database with same CATH topology
1N62A 3LYYA 4TQ1A 2OEDA 4USAA 4YTPB 2FE8A 1EM7A 5H8YE 3ZGZA 2BB5A 4IDIA 2FUG1 3EGRA 1JW9D 1XLPA 1QILA 2EKIA 4Q2JA 1VRAB 2L52A 3FC4A 1OFFA 2ICIA 2IGDA 2VZKB 1SIJA 1KFYB 4RGNA 4GLSC 4C56C 2RDHA 4ZYSA 1XLNA 2BTEA 1C4PA 4NZLB 4YSZB 2KDMA 1R7SA 3P4QB 1HZ5A 1BMLC 2IJ0A 3NVZA 2WXMA 1PGXA 2ONQA 2J42A 1SE3A 5D3IB 4MACA 3J9CA 5BYQA 5FK9C 1FFUA 1WGKA 2N9LA 2LJIA 4YTMB 2JSVX 1MI0A 2W82A 3FAHA 1CQVA 2WXRA 3W5VB 1I4GA 5FR3A 3O13A 4D2KA 3NVYA 2J53A 1ROEA 2QJLA 2FBWB 4WWMA 3PZ7A 1AN8A 1L6VA 5EE9A 3BK1A 4WAFA 5BMHA 2EELA 4WURA 2L83A 1ZPSA 2G1EA 3H8HA 3Q8CA 1J7BA 1FXAA 5D3DA 3U4EG 1F2RC 3VRAB 1N5WA 4L23A 2MJEA 5H92C 4XDDA 1PFDA 1C4CA 1WRIA 1XCQL 2ON8A 4JWUC 1C9FA 3U2SC 3AV8A 2E6XA 1V8CA 1EU3A 4OVZA 3L4PA 1J7AA 2WU2B 2WXFA 3V05A 4P16A 3IAS1 1VDVA 3P42A 2PW9A 2LMCA 2L32A 1JWUD 3BYYB 4YWGG 2PVGC 4B0EA 1TS3A 2PKOA 3B2GA 4RGTA 3ZJUA 1I4PA 3ZJVA 1YN3A 1FNUA 1JCKB 1GAQB 1XEEA 1ZXHA 5JXVA 1TYGB 1KTKA 2CJNA 2V3NA 2N7JA 1NYRA 1JWBD 1LO5D 4WH4A 3BVMA 1DYQA 3SEBA 3P1MA 2LFIA 4XWTA 4JE3B 3CIRB 3EUB2 4WQMA 1QOGA 3CWIA 5C3JB 3IAM1 1XO3A 2MH7A 2Q5WD 3AEAB 1AWDA 3VRBB 5EE0A 1TJEA 2KN4A 4OHJA 3AE9B 1V1OA 1ENFA 1FIQA 1V97A 1A70A 2ZW1A 3URYA 5AUKA 3MP9A 4XWWA 2BT6A 4IOIE 3Q69A 2JZPA 1NI3A 1TS4A 2K5PA 1MHHE 1VZ6A 4RFBA 5G5GA 5G5HA 1I4QA 2WDRB 1FXIA 3LXFA 1C78A 4TMAB 1YN4A 2QIEB 2WU5B 4KX6B 1FD6A 1FEHA 3BZDB 2KACA 1ZDXA 2PTLA 3HVZA 3FILB 2PMVA 1I4RA 2BW2A 2WDVB 1BUIC 2WXLA 4JX1C 3AE2B 2BYTA 4YSXB 2SAKA 1CJEA 2Y3AA 2V3PA 1SE2A 1XCTL 3BVZA 3ETRA 4KGRA 2INNE 1SSNA 2CJOA 3UI3A 4YXDB 3ZJTA 1YNTE 2I38A 2QILA 1GB1A 3AEBB 1KH0A 1TKEA 2MJDA 3B9JA 4AQ7A 5C2TB 1FNWA 1TY0A 3TEXA 3AH7A 4ZHPA 1QKZA 1XF5L 1N60A 3NVVA 2ZW0A 2INPE 1TZOA 1YJJA 3IT4B 3VQIA 1JWAD 1L0VB 3IXSA 4ITKA 4MM3B 1WWTA 4ARIA 1GOZA 3W1SA 1EWCA 1QOFA 4LK0M 3N9YC 4TSSA 1C79A 3U7ZA 4ZOHC 5AUIA 1FNVA 1GPXA 4C7YA 3R2TA 2ACZB 2L1AA 3R2IA 2LHDA 1HA5A 1IGCA 1L0XB 3T3OA 3NUHB 2W55A 4WIPA 5HI1A 3BK2A 3KWVA 2LUMA 4RF0A 1VZ7A 3GP7A 1YQ4B 2AQ3B 2D5GA 4DXGA 1ZE3D 3AM9A 4OZCA 1K53A 3P4PB 1T5XD 2WXNA 5HG2A 2J4XA 3VR9B 1VZ8A 1FO4A 3ZQ4A 3DWGC 2DWQA 3HUIA 1JALA 1HXYD 2K9XA 1JROA 3LB8C 1BXTA 1NENB 3AE5B 1HZ6A 1SB3C 2N0SB 3C8YA 1RYJA 1SEBD 2CU3A 4NAWB 4US8A 1N5XA 4OZBA 2GI9A 4XE0A 1ZOYB 2BS2B 2WLBA 1F0ZA 3MJ5A 1UUPA 1KRHA 3V3XA 1DOIA 1K52A 4LTUA 3TEZA 2JYEA 3ZYYX 2JYTA 2G9HD 2SEBD 1QOBA 4ZHOA 2JX5A 1D6EC 1N63A 1E10A 3FILA 1ESFA 2YEPB 4GDKB 3KQ4A 1SXTA 2WXPA 1QLBB 1Y56A 1YMHE 1B1ZA 1C76A 1AYFA 1SJED 4L1BA 4RGOS 3BYTB 1E0ZA 1ZUD2 1GB4A 4RCOA 1ZXIA 2QEJC 4A8XC 1HQRD 1FRRA 2DYOA 2K0PA 2W3RA 3PZ8A 2JU6X 3T3NA 3MC0B 1MPEA 2GB1A 3AECB 5BMIA 1I4XA 3RFZB 5MPOA 4HKQA 2WXIA 1KLGD 3SR6A 3MFGA 4KGSA 1K50A 1T3QA 2X38A 5BYRA 3TEYA 5HFYA 1N61A 2I2YA 4NAMA 4RF1A 1D5ZC 4YTNB 1QT9A 4A6QA 3NZ3A 2PIAA 1KF6B 4ZRQA 4EE2A 2K22A 1JRPA 2WXOA 1TS2A 1FRDA 1SE4A 1FCLA 3I57A 3EA6A 3SFEB 2NTSA 2M0AA 1EWYC 1UNSA 2W3SA 5EE3A 1WYGA 2H88B 4PT5A 4TQ0A 2WP9B 3AMZA 3R8BA 1V1PA 4UDUC 4A90A 1L0YB 1L5PA 1MHXA 2WNMA 3W9CB 2RPVA 4N6EB 1I4HA 1OQRA 4A55A 1UWMA 1UGJA 4FXCA 4M0WA 1Q10A 2B76B 4C80A 5GXGB 1IBXA 1F77A 1PUTA 2WQYB 3B2FA 4OZAA 1ET6A 1XLQA 3AE3B 4MT5A 4A9AA 2H89B 3PO0A 4DQOC 1VLBA 1CK1A 1NVID 2BBCA 3NVWA 4REZA 2KQ4X 2XNAC 3AN1A 1ZDVA 2IGHA 3E9SA 3HVDA 1C4AA 2M56B 2DBYA 1D5MC 4GDLB 5D7GA 2JWUA 2WXQA 1TKYA 3TSSA 3DWMA 4LLGM 1WSPA 2LHEA 1DGJA 5E6JA 2KAJA 2RMMA 1V1PB 3BIID 3AEEB 1SBBB 1ET9A 2V0GA 1QQRA 4KKJA 1PGBA 1SF0A 1D5XC 1I7HA 1L6UA 3AE8B 1L4ZB 1QOAA 4P6VF 2TSSA 1L4DB 2NMQA 3TEWA 5TSSA 3NS1A 2IPKD 3P4RB 3E56A 1F2RI 4HKZE 3W2DA 2WXKA 4YT0B 3RPFC 4N59A 4KKIA 1AW7A 1JWMD 3Q8AA 3KLSX 1PYWD 2WXJA 2Y5CA 3AEDB 1QF6A 1IUEA 1MVKA 2JQRB 1CZPA 1J7CA 1VJKA 2W54A 3OWEB 4JPSA 2VZKD 1VR9A 3HRDD 2PVOD 1UWXA 1XXGA 5EE1A 4HJGE 1K51A 2IDYA 2JXTA 1EU4A 3BWUD 5LNK1 2LGIA 1OQQA 2OHFA 2V4IB 2IGGA 2WDQB 1T6BX 3AE1B 2WXGA 2QMTA 1ACCA 4HROA 4RGMA 5T8IA 2AQ2B 1IBXB 3Q8BA 4L2YA 3NRZA 5FKAC 2K3UA 1ZP0B 4IKGA 1TKGA 1FCCC 1NEKB 2AQ1B 4N58A 1RM6C 4R3DA 4RH6A 2XN9C 1YN5A 4J3OD 4YSYB 3GB1A 1XLOA 1DOYA 1HEZE 4CQNA 1E7PB 2HTME 3AE7B 3P4SB 1IGDA 3Q8EA 2RDGA 5I4DA 1E6EB 3VR8B 3AE4B 3P63A 2HDEA 1TY2A 3I9V1 3BVGA 2BB6A 2J52A 2MJ3A 3TUOA 4B0MA 1KLUD 1JMLA 3ABVB 1NYQA 2Y5PA 4JWSC 2KWDA 1TS5A 4H2AA 4OW0A 1D4BA 3U52E 2Z8LA 1DOXA 1B9RA 2YEPF 3AEGB 3W5UB 4HEA1 1YQ3B 2GRIA 4DXFA 1PGAA 2NTTA 3AE6B 4KGTA 2LEKA 1M4VA 2AX5A 3MHZA 1WXQA 1FFVA 3IT6B 3Q8FA 1JQ4A 4RNAA 3SFDB 4C7ZA 1STEA 3AEFB 4O1NA 1FM0D 1RFKA 4HRSA 4US9A 1SJHD 2R61A 1JWSD 2PLPA 1FMAD 3WCQA 4AS1A 2BS3B 1P7FA 2DLBA 3GS2A 4XDCA 4ZRPA 2M19A 1RWSA 3KWLA 2KMMA 2WS3B 5BMGA 2DYMA 4NJCA 2MEKA 1PDXA 1P7EA 1YJIA 2BS4B 4ARCA 5BYSA 2E3TA 2QSDA 4MH8A 5HHDG 1C77A 1E9MA 2N9KA 2WXHA 3AB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD6 A;  1YMH E;  2OED A;  2KAC A;  1EM7 A;  2PTL A;  3FIL B;  1GB4 A;  1MVK A;  2IGD A;  1XCT L;  4KGR A;  1UWX A;  2K0P A;  2JU6 X;  4HJG E;  1K51 A;  1MPE A;  2GB1 A;  2JXT A;  4GLS C;  3UI3 A;  5BMI A;  1YNT E;  2I38 A;  2LGI A;  1GB1 A;  2IGG A;  2KDM A;  1KH0 A;  2QMT A;  1HZ5 A;  4KGS A;  1PGX A;  2ONQ A;  1IBX B;  1K50 A;  4MAC A;  1QKZ A;  5HFY A;  2I2Y A;  4IKG A;  1XF5 L;  1FCC C;  2ZW0 A;  2N9L A;  2JSV X;  1MI0 A;  4D2K A;  2J53 A;  3GB1 A;  1HEZ E;  1FCL A;  1IGD A;  5BMH A;  2EEL A;  1F2R C;  2J52 A;  1MHX A;  1JML A;  2LHD A;  2RPV A;  1IGC A;  1XCQ L;  2ON8 A;  2KWD A;  1C9F A;  5HI1 A;  1D4B A;  1Q10 A;  1IBX A;  2LUM A;  2PW9 A;  4OZA A;  1PGA A;  4OZC A;  1K53 A;  4KGT A;  5HG2 A;  2KQ4 X;  2IGH A;  1ZXH A;  5JXV A;  2N7J A;  2JWU A;  2LHE A;  4WH4 A;  2PLP A;  2RMM A;  1HZ6 A;  1P7F A;  1PGB A;  4OZB A;  2GI9 A;  2KN4 A;  5BMG A;  2NMQ A;  1P7E A;  3V3X A;  2ZW1 A;  1K52 A;  2QSD A;  3MP9 A;  4IOI E;  2JZP A;  1F2R I;  4HKZ E;  5HHD G;  3FIL A;  1MHH E;  2N9K A; 
#chains in the Genus database with same CATH topology
 4YTP B;  2FE8 A;  1EM7 A;  4NQK E;  2KYW A;  4WJN A;  2BB5 A;  2FUG 1;  3EGR A;  2EKI A;  2L52 A;  2X8X X;  1ZW7 A;  4JLC A;  3H9D A;  4GLS C;  1P9D U;  4ZYS A;  1C4P A;  1R7S A;  1V5T A;  3P4Q B;  1PGX A;  3VAW A;  5CTR C;  2C7M B;  1FFU A;  1WGK A;  2N9L A;  3FAH A;  2W82 A;  3MJW A;  1CQV A;  1WXS A;  4D2K A;  3NVY A;  3RYT A;  1R4M B;  1ROE A;  3H7P B;  2QJL A;  3DVG Y;  2KJH B;  2ZNV B;  4RM8 A;  4WAA A;  1SIF A;  4WWM A;  5JHB A;  4WAF A;  2M4N A;  2EEL A;  2L83 A;  3Q8C A;  2QHO A;  3VUX A;  4X57 B;  1WFY A;  5H92 C;  1C4C A;  1WRI A;  2ON8 A;  4JWU C;  1C9F A;  1EU3 A;  3UIN B;  4DHZ E;  3V05 A;  4P16 A;  3IAS 1;  2LMC A;  2L32 A;  2HD5 B;  4BOZ B;  3MTN B;  4PS7 A;  2NBU A;  4HPP A;  1JCK B;  5IN7 A;  1LO5 D;  2LFI A;  1ZGU B;  1TGZ B;  4C4V A;  3DBL I;  3EUB 2;  1WXV A;  1XO3 A;  2I1J A;  2MH7 A;  2Q5W D;  3AEA B;  3C0R B;  5EE0 A;  3AE9 B;  2LUE A;  2KHW B;  1A70 A;  2CHX A;  3DDC B;  3VXW A;  5AUK A;  3MP9 A;  4XWW A;  2BT6 A;  4IOI E;  4II2 B;  2REX A;  3Q3M C;  4XZ4 A;  3H1U A;  4ZRK A;  3ZTC A;  1MHH E;  4RFB A;  3ZNH B;  4ICV A;  4TMA B;  3LXF A;  1Y8R C;  4E74 A;  3FIL B;  1I4R A;  2BW2 A;  4JX1 C;  2WDV B;  1CJE A;  2V3P A;  1SE2 A;  1WJN A;  1WI0 A;  1E5W A;  2CJO A;  3DOW A;  3ZRF A;  2QIL A;  4FJZ A;  2MJD A;  3B9J A;  3HM6 X;  4TUU A;  3A4R A;  4ANW A;  4GOC A;  2MLB A;  3CSF A;  3NVV A;  2KDE B;  2WDT B;  3V62 A;  2BF8 B;  3IG3 A;  2EMS A;  2AYO B;  3NY5 A;  3IT4 B;  2BQQ A;  3IXS A;  2VH2 A;  3RUL A;  1QOF A;  2ZNV C;  1OEY A;  3HIZ A;  4ZOH C;  4W9C A;  4W9K A;  1GPX A;  2N9X A;  2MCN B;  4F7Z A;  3R2T A;  2DX5 B;  3R2I A;  5E6O A;  3B0A A;  1HA5 A;  1IGC A;  3NUH B;  5CX3 A;  3BK2 A;  3ZUN A;  4RF0 A;  4WWO A;  1VZ7 A;  1YQ4 B;  1YX6 B;  1RAX A;  3AM9 A;  2KFJ A;  4OZC A;  1K53 A;  1T5X D;  1G6J A;  3VR9 B;  4EEW A;  3A33 B;  4FUL A;  2K9X A;  3ZXR A;  4WJP A;  1HZ6 A;  1SB3 C;  4EKU A;  3QX1 A;  2GI9 A;  4XE0 A;  4AJW A;  2BS2 B;  1F0Z A;  3M63 B;  4GN1 A;  3MJ5 A;  1UUP A;  1K52 A;  2FAZ A;  2G9H D;  3PVL A;  2BKR B;  1E10 A;  4GDK B;  3IFW B;  4BKT A;  2WXP A;  1NBF C;  1QLB B;  3QAR A;  1B1Z A;  3EFU A;  5IP4 D;  4I6L B;  3WAO A;  4L1B A;  3BYT B;  1ZUD 2;  1T0S C;  1ZXI A;  3B1L X;  4A8X C;  2GBN A;  2A5U A;  3APC A;  4DWF A;  2W3R A;  3PTF C;  5DPR A;  4BVU C;  2LJ5 A;  4KIK B;  4HKQ A;  3K9P B;  3ZXV A;  3MFG A;  1P0R A;  4DDI D;  1K50 A;  1T3Q A;  1WGD A;  2V3S A;  5HFY A;  3JW0 X;  2I2Y A;  3ZKJ C;  2D3G A;  1S1Q B;  1QT9 A;  4JQW C;  3NZ3 A;  3VUY A;  3PZD A;  1JRP A;  4ZRJ A;  1FRD A;  3N20 C;  3ZNG C;  3I57 A;  4JL9 A;  3SFE B;  3WA0 A;  4OVU A;  2RSU A;  2VRR B;  2FID A;  3DBL B;  5IO9 A;  1Z5S B;  2WNM A;  1OQR A;  1UWM A;  3M3J A;  3NS8 A;  4M0W A;  4FAD A;  4C80 A;  4IC7 B;  4C00 A;  1F77 A;  3L08 A;  2KNB A;  4CYE A;  2KQS A;  4MH0 E;  2HJ1 A;  4DHJ D;  4A9A A;  3PO0 A;  4REZ A;  3Q14 C;  1ZDV A;  1XQQ A;  3E9S A;  3KUC B;  1D5M C;  4PS8 A;  2RGF A;  4F1S A;  5E6J A;  1TT5 B;  2BWE S;  3BII D;  1SBB B;  2V0G A;  4KKJ A;  3QWZ B;  1PGB A;  1HTQ A;  1D5X C;  3RZF A;  4P6V F;  2TSS A;  4ANX A;  4BZA A;  3KW5 B;  3NS1 A;  3VH4 B;  2O6V A;  2XK5 B;  4MM3 A;  2B3A A;  3VTV A;  1LQB A;  3RPF C;  2YLM A;  2KFK A;  3Q8A A;  1PYW D;  2WXJ A;  2JQR B;  2W54 A;  1CZP A;  3OWE B;  4JPS A;  1VR9 A;  1UWX A;  5LXI B;  3P2B A;  5LNK 1;  2LGI A;  4RGM A;  4ICU A;  3Q8B A;  5FKA C;  2JF5 A;  4IKG A;  1TKG A;  2D07 B;  3M62 B;  3AXC A;  1WX7 A;  3V6C B;  4NJ6 A;  4J3O D;  4YSY B;  1YD8 U;  3GB1 A;  1XLO A;  1KJT A;  3ZNI D;  4CQN A;  3APD A;  3P63 A;  3Q3O C;  4A3O A;  4LNN A;  5KHQ A;  3GE3 C;  2KD0 A;  1JML A;  4NPN A;  2KWD A;  1TS5 A;  2YEP F;  1T0R C;  5D6J B;  2JXX A;  4GSW A;  1P98 A;  4LDT B;  1WXQ A;  3VH3 B;  1FM0 D;  2R61 A;  1JWS D;  1P7F A;  1BT0 A;  2GBM A;  3KWL A;  4ANV A;  5IKC M;  2DYM A;  1GUA B;  2MEK A;  1YJI A;  4W9J A;  2QSD A;  2WX1 A;  3ZLZ A;  4N9F 4;  1C77 A;  2KVR A;  3PRZ A;  3AB5 A;  5DCN A;  3LYY A;  4USA A;  3ZGZ A;  4B6W A;  1VRA B;  1OFF A;  2ICI A;  3MC8 A;  1UH6 A;  2RDH A;  5HKH A;  4YSZ B;  2KDM A;  5KHO A;  4EFO A;  1HZ5 A;  2IJ0 A;  3PV1 A;  3NVZ A;  2WXM A;  4URK A;  3ZDT A;  2NCN A;  4XC2 A;  5BYQ A;  5FK9 C;  1NI2 A;  2DAF A;  4BAX A;  4YTM B;  2KWC A;  3W5V B;  2QDF A;  5FR3 A;  2FBW B;  1AN8 A;  5EE9 A;  3BK1 A;  3QA8 A;  4W9F A;  3H8H A;  1FXA A;  5AZG A;  2DHZ A;  1F2R C;  3VRA B;  1EF5 A;  1XCQ L;  3AV8 A;  2E6X A;  4KVG B;  4GDL A;  2LGD A;  4OVZ A;  3L4P A;  1J7A A;  1J0G A;  2WXF A;  3WAL A;  1X1M A;  1VDV A;  3P42 A;  1FXT B;  2PW9 A;  4WJQ A;  1WR1 A;  1JWU D;  3BYY B;  4P7I A;  4BBN C;  2WWZ A;  3RT3 B;  4RGT A;  3ZJU A;  1TZ1 A;  3ZJV A;  3KVF B;  1FNU A;  1XEE A;  2CHZ A;  1NYR A;  1RLF A;  4WH4 A;  3BVM A;  3V61 A;  2BYF A;  1QOG A;  5C3J B;  3IAM 1;  4EZK A;  2PE6 B;  2W9N A;  1V1O A;  1H8C A;  1FIQ A;  4A3P A;  3URY A;  1E90 A;  3Q69 A;  1EF1 A;  1VZ6 A;  5G5G A;  2KDB A;  3JSV A;  1C78 A;  1AAR A;  2CS4 A;  2J7Q B;  2HE7 A;  2QIE B;  3GE8 C;  3ZDM C;  2KAC A;  2PTL A;  2R2O A;  3WAP A;  4NJ7 A;  2BYT A;  4IWO A;  4KDI C;  1XCT L;  2XK5 A;  3L54 A;  3Q2A C;  1WR6 E;  1YNT E;  4HXD A;  3DBH B;  1GB1 A;  3AEB B;  1KH0 A;  4AJY B;  4AQ7 A;  4BBN F;  5C2T B;  1FNW A;  1TY0 A;  3AH7 A;  2KTR B;  1OTR B;  2ZW0 A;  1GG3 A;  2IND C;  1YJJ A;  1JWA D;  2KLG A;  3N9Y C;  4TSS A;  1MG8 A;  1U4A A;  3PHX B;  3Q3J A;  4C7Y A;  2C5L C;  5IAA C;  3T3O A;  1E7V A;  1E8W A;  2Z0E B;  3KWV A;  2ZCB A;  3I5J C;  3GP7 A;  1K8R B;  2AQ3 B;  2D5G A;  4DXG A;  1V5O A;  2JUO A;  2WXN A;  2ZJD A;  5HG2 A;  1MG4 A;  1VZ8 A;  5AEK B;  3DWG C;  3SD5 A;  4XYC A;  2G3Q B;  4DHZ B;  4FN2 A;  3VTU A;  3AE5 B;  2CU3 A;  3UGB B;  4OZB A;  2K6D B;  2XEW A;  2WLB A;  3ZNZ B;  2LXC A;  3V3X A;  1DOI A;  2JYE A;  1QOB A;  2JX5 A;  1N63 A;  4BFR A;  2IO2 B;  3ZO5 B;  5G2N A;  2CU1 A;  4GXB A;  1P3Q U;  1YMH E;  2MSE D;  1EUV B;  2FCQ A;  1C76 A;  2RDB C;  3DPD A;  4RGO S;  1E0Z A;  2KC2 A;  4RCO A;  4HCN B;  1HQR D;  3KH0 A;  2K0P A;  2EMT A;  3PZ8 A;  2KDI A;  3T3N A;  3MC0 B;  1MPE A;  3AEC B;  3N1Z C;  1ISN A;  1I4X A;  2D2Q A;  3R66 C;  2J0M A;  2KXJ A;  1V9J A;  5MPO A;  2WXI A;  1KLG D;  2M8S A;  4KGS A;  3A1Q B;  1WGY A;  5BYR A;  3TEY A;  5IA7 A;  4M02 A;  4ANU A;  2NPT A;  4MEM A;  4AOF A;  2FUH B;  2WXO A;  1SGH A;  2UYZ B;  1TTN A;  2NTS A;  4TKN A;  2W3S A;  1WYG A;  4TQ0 A;  2WP9 B;  2LGY A;  3QCA A;  1V1P A;  3WAM A;  1UGM A;  4LNO A;  3W9C B;  4A55 A;  1UBI A;  3ML8 A;  5E6N A;  4FXC A;  2B76 B;  3TL5 A;  2MP2 B;  3B2F A;  3RI7 C;  1XLQ A;  4FHJ A;  4PK1 A;  2MHJ A;  2AL6 A;  2BBC A;  4WQO B;  1OQY A;  1C4A A;  4GDL B;  5D7G A;  1TKY A;  4LLG M;  3I3T B;  1DGJ A;  3U30 A;  5IOI A;  2RMM A;  1J8C A;  2MX2 A;  3AEE B;  4IM2 A;  2J0K A;  2V1Y A;  3AE8 B;  3ZW3 A;  2N7D A;  2NMQ A;  3GOE A;  4PYU A;  1Q5W B;  5TR5 A;  2DZM A;  2NPT B;  1F1H A;  3DVG X;  3IHP C;  4M01 A;  2G45 B;  3ALB A;  1JWM D;  1QZE A;  5AZH A;  3AU5 A;  2Y5C A;  2KOX A;  4AUQ C;  1IUE A;  2VZK D;  3C19 A;  2G4D B;  2DAJ A;  1XXG A;  3H7P A;  1OQQ A;  1WXM A;  2WDQ B;  3AE1 B;  2WXG A;  4HRO A;  4CHK A;  3RNA C;  4L2Y A;  4GDK A;  1NEK B;  2UU7 A;  4N58 A;  2IBI B;  2LXA A;  3QAQ A;  3HK0 A;  1HEZ E;  4KSL C;  3P4S B;  2V4L A;  1IGD A;  3Q8E A;  3L10 B;  3I9V 1;  2GBR A;  2ZCC A;  2OOB B;  3R7Q A;  1WE6 A;  3MC9 A;  3U8Z A;  3O65 B;  4H2A A;  3NZS A;  4OW0 A;  1D4B A;  3SDL C;  2KQ7 A;  4M8N A;  3AEG B;  1WZ3 A;  2LWP A;  3AE6 B;  4BKG A;  2AX5 A;  3MHZ A;  3IT6 B;  4RNA A;  3SFD B;  1IP9 A;  2NBW B;  1GJZ A;  1TBE A;  5C23 A;  4O1N A;  1RFK A;  5JHA A;  2KT7 A;  4US9 A;  3PHW B;  1FMA D;  2N1W A;  3WCQ A;  4LCD E;  3L17 A;  3KYC D;  4HVB A;  2M19 A;  2WS3 B;  5BMG A;  3UQB A;  4NJC A;  4MSQ B;  3WAN A;  3LDZ E;  1PDX A;  2L0F A;  4MH8 A;  2MBB B;  2WXH A;  2DZK A;  4IM3 A;  2LRU A;  3ML9 A;  3PRM B;  4TQ1 A;  2OED A;  2HJ8 A;  4IWP A;  5H8Y E;  2AWT A;  3K9O B;  3AUL A;  1JW9 D;  1QIL A;  4LJO B;  4XGA B;  3FC4 A;  3V6E B;  2G4S A;  1KFY B;  4C56 C;  1Q0W B;  3AU4 A;  1XLN A;  3EHV A;  2DYB A;  4FHK A;  1C1Y B;  1BML C;  1WGG A;  2DNF A;  1SE3 A;  4MAC A;  3N3K B;  2RR9 A;  3A4S C;  3PRP B;  1I42 A;  3KYD D;  2LJI A;  2JSV X;  2V9H A;  2WXR A;  4ACF A;  4TV3 A;  1I4G A;  2DZJ A;  3O13 A;  2ZVO A;  2LRW A;  5JH5 C;  1WGH A;  5BMH A;  2L0T A;  3Q3N C;  4BKS D;  1ZPS A;  5AZF A;  2KMC A;  3JYU A;  4KZC A;  1N5W A;  4L23 A;  4K3B A;  4XDD A;  1PFD A;  4NAW A;  2FIF A;  1LFD A;  2O6V D;  1V8C A;  1WMH A;  1MFW A;  2D3C A;  1Z2M A;  4YWG G;  5GMV A;  2PVG C;  1TS3 A;  3N1Y C;  2PKO A;  2JRH A;  2ZPY A;  3EC8 A;  1WYW B;  3DHH C;  1GAQ B;  1TYG B;  2D3B A;  2CJN A;  1VD2 A;  4KDL B;  3SEB A;  1DYQ A;  3RN9 C;  4XWT A;  4JE3 B;  3CIR B;  4WQM A;  2JWZ A;  1AWD A;  5FR6 A;  1TJE A;  4OHJ A;  1V97 A;  2ZW1 A;  4FJV B;  5DPS A;  4KZ0 A;  2JZP A;  1TS4 A;  2J0J A;  4I6P A;  1I4Q A;  2Z59 B;  5G55 A;  5C1Z A;  4KX6 B;  2BYE A;  1FEH A;  2GLS A;  2C7N B;  2MRP A;  2PJH A;  2WXL A;  4YSX B;  2Y3A A;  3W1Y A;  3ETR A;  4KGR A;  2DEN B;  2INN E;  4BOS C;  1SSN A;  3ZJT A;  2I38 A;  1T0Y A;  3DBR B;  1LM8 B;  3TEX A;  2INC C;  4ZHP A;  4LDT D;  3N1X C;  1XF5 L;  3PGE A;  1V6E A;  4HDO A;  1TZO A;  2DZI A;  3RNB C;  3L13 A;  2KWU B;  3QK0 A;  4HPM B;  3VQI A;  4ITK A;  1L0V B;  1YQB A;  4LNK A;  3W1S A;  1EWC A;  3EEC A;  3RMK C;  3U7Z A;  3ENE A;  4M8M A;  4LJP B;  4HJK A;  2VH1 A;  1R4N B;  3Q3F A;  2FCS A;  2ACZ B;  2LHD A;  3TCA A;  2W55 A;  2NVU I;  4WIP A;  5HI1 A;  1IPG A;  1LXD A;  2LUM A;  2WYQ A;  4LNF A;  1S3S G;  3DBS A;  4NQL B;  4HK2 A;  1ZE3 D;  3OG5 A;  3RZW C;  3A9J B;  3P4P B;  2LAS A;  4K7W A;  4S17 A;  4JIO U;  4HPL B;  2J4X A;  3R3M A;  4MSM B;  3QIJ A;  2DWQ A;  2K1F A;  1JAL A;  1HXY D;  1JRO A;  3LB8 C;  3EFC A;  3CST A;  1NEN B;  3ECI A;  2N0S B;  1WXA A;  1SEB D;  4US8 A;  2KFK B;  1N5X A;  5CHV C;  2K25 A;  2PE9 A;  1UZX B;  2WX0 A;  1C3T A;  2C9W B;  4FBJ B;  2KC1 A;  2JYT A;  2L8J A;  3FIL A;  2KMA A;  2YEP B;  2L00 B;  4C4V B;  1Y56 A;  2JT4 B;  1L2N A;  2K39 A;  3PLU A;  1AYF A;  1R4M I;  1SJE D;  4DBG A;  1V86 A;  5J18 A;  1WIA A;  2DYO A;  2KO3 A;  3VHT C;  2JU6 X;  2O2V B;  5BMI A;  4PYZ A;  1XT9 B;  3U7D A;  2MBH A;  3IBE A;  4NAM A;  4RF1 A;  4YTN B;  3N32 A;  4AWJ A;  4W9I A;  1KF6 B;  1F52 A;  2XBB C;  1SE4 A;  3PT2 B;  5L95 C;  1EWY C;  2H88 B;  4PT5 A;  2JVC A;  2MQJ A;  1L5P A;  1IYF A;  2RPV A;  4N6E B;  2C60 A;  2M17 A;  2K8B A;  4KSK C;  1V81 A;  5GXG B;  1WE7 A;  4OZA A;  5LXH A;  2FCM A;  4G3X B;  2I1K A;  4J6I A;  1VCB A;  2RD0 A;  3AE3 B;  2D10 A;  4MT5 A;  3DCG A;  4DQO C;  1WX8 A;  1CK1 A;  1NVI D;  3NVW A;  3VUW A;  1A5R A;  2KQ4 X;  2IGH A;  2M56 B;  1WMH B;  4WWP A;  2WXQ A;  3TSS A;  4FJY A;  1WSP A;  2R2Q A;  5DPT A;  2KAJ A;  1V1P B;  4RM9 A;  4W9G A;  1QQR A;  3JSV B;  1I7H A;  1L6U A;  1L4Z B;  1QOA A;  2LGX A;  3DBR I;  2BPS A;  2K8H A;  1KOT A;  3S2A A;  3DVN V;  2NS5 A;  3E56 A;  3UIP B;  1OGW A;  2KZR A;  4MGY E;  4HKZ E;  4GGQ A;  2IY1 B;  2BVC A;  2IZV B;  3W2D A;  5LLI A;  2WXK A;  4YL8 A;  2CR5 A;  1AW7 A;  4EZL A;  1WZ0 A;  4FA6 A;  1J7C A;  3ZRC A;  3PS6 A;  3UQA A;  2PVO D;  3PRE A;  1WY8 A;  4HWI B;  1K51 A;  2HTH A;  2IDY A;  2JXT A;  3BWU D;  3VDZ A;  2V4I B;  1T6B X;  2QMT A;  3IVF A;  5T8I A;  4HLE A;  3ZIM A;  2M1M A;  2AL3 A;  3WIM A;  3NRZ A;  4EUT A;  2K3U A;  1ZP0 B;  2K6Q A;  1I35 A;  1FCC C;  4MGZ E;  1UBQ A;  4RH6 A;  2XN9 C;  1JRU A;  1YIW A;  4I6N B;  1DOY A;  1E8Z A;  3AE7 B;  2RDG A;  3QHT A;  2A4Z A;  5I4D A;  2KDF B;  3AE4 B;  2HDE A;  3BVG A;  2J52 A;  4S0R A;  3TUO A;  3FKY A;  4B0M A;  1KLU D;  5J17 A;  3VVW B;  3ABV B;  1NYQ A;  2Y5P A;  3DHG C;  1DOX A;  3ZTD A;  4HEA 1;  4W9E A;  4NY0 A;  1YQ3 B;  2N1V A;  2GRI A;  2NTT A;  3A9K B;  4KGT A;  5CHW A;  1M4V A;  2MWS B;  2KJR A;  3ZVV A;  3NHE B;  1JQ4 A;  2BKF A;  2ZVN A;  4C7Z A;  1SJH D;  3RNF C;  4DDG D;  4XX5 A;  1YJ1 A;  2BS3 B;  1M94 A;  3GS2 A;  4XDC A;  1CMX B;  3LJ3 A;  2MBE A;  4P1B C;  3CF6 E;  2UWQ A;  1FPY A;  1MJD A;  1P7E A;  2BS4 B;  5BYS A;  2E3T A;  2KWV B;  4M00 A;  3RUI B;  1H4R A;  4K1R B;  1E9M A;  3OJ4 B;  1WJU A;  1N62 A;  4ASW C;  4GB9 A;  3RNE C;  3RD2 A;  3OJ3 A;  1P1A A;  4IDI A;  1XLP A;  4Q2J A;  1WJ6 A;  3UIO B;  2IGD A;  2VZK B;  1SIJ A;  4HCP B;  4RGN A;  1WGR A;  2L7R A;  2BTE A;  3MHS D;  4DK5 A;  2M0X A;  4P1C C;  4NZL B;  4PS3 A;  2GBJ A;  2J42 A;  2ONQ A;  5D3I B;  2KX3 A;  4MGI E;  4WJO A;  3J9C A;  5BO4 B;  1MI0 A;  2KTR A;  4GIV A;  2J53 A;  2D11 A;  3PZ7 A;  1L6V A;  4WUR A;  3KUZ A;  2G1E A;  5D3D A;  3U4E G;  1J7B A;  4CO7 A;  4IM0 A;  2JZZ A;  2KKC A;  3UF8 A;  3DHI C;  2MJE A;  2MA9 B;  3U2S C;  5CHF A;  3T9L A;  4GMV A;  1V49 A;  2WU2 B;  4AP4 C;  4DHJ B;  2LD9 A;  3RCZ A;  3V60 A;  4ZYN A;  4B0E A;  4G11 A;  2YVC A;  3B2G A;  2JRI B;  2WGS A;  1I4P A;  3HHM A;  1YN3 A;  1EO6 A;  1WH3 A;  3W1S C;  1ZXH A;  5JXV A;  2OJW A;  1KTK A;  2V3N A;  2N7J A;  1JWB D;  4FLH A;  4II3 B;  3DQV A;  3P1M A;  1PQS A;  3BY4 B;  2MBQ A;  4F8C B;  2FNJ B;  3CWI A;  2LVP A;  2LGS A;  3VRB B;  2KN4 A;  3L0W B;  1ENF A;  4IWQ A;  1T0Q C;  1NI3 A;  1R4N I;  1V2Y A;  2K5P A;  2N4F A;  1L7Y A;  5G5H A;  4K81 A;  2WDR B;  5D94 A;  4ZRI A;  1FXI A;  1YN4 A;  2WU5 B;  1FD6 A;  1V80 A;  3A1Q A;  3BZD B;  4B9K A;  3QQ8 B;  1ZDX A;  3HVZ A;  2PMV A;  2ZZP B;  1GNU A;  1BUI C;  1YX5 B;  3AE2 B;  2SAK A;  1E7U A;  3BVZ A;  4W9D A;  2O6V B;  2ASQ A;  3UI3 A;  3NG0 A;  4YXD B;  2KAN A;  1E8X A;  4K3C A;  1TKE A;  1KLV A;  4G0N B;  1QKZ A;  4M0W B;  2CHW A;  4W9H A;  3TJP A;  2IYD B;  1N60 A;  1WM3 A;  2INP E;  3QJZ A;  1WM2 A;  4MM3 B;  1WWT A;  4ARI A;  1GOZ A;  2IO3 B;  3D32 A;  2KVZ A;  4LK0 M;  2LZ6 A;  4KV2 A;  1C79 A;  2NBV B;  5AUI A;  1FNV A;  3ONS A;  1E8Y A;  2D3A A;  5J2R A;  2L1A A;  1L0X B;  4WWN A;  4OVV A;  2LVO A;  2NR2 A;  4G50 A;  2KJ6 A;  2BWF A;  2L76 A;  5D2M B;  3VTW A;  5DPW A;  2K8C A;  2MP2 A;  3RNG C;  1FO4 A;  3ZQ4 A;  3HUI A;  3M95 A;  3H7S A;  1BXT A;  4MGK E;  3C8Y A;  1RYJ A;  4NAW B;  3NJT A;  4LNI A;  4BKS A;  3NZU A;  1ZOY B;  3Q6B A;  4KIK A;  1KRH A;  4LTU A;  3TEZ A;  3ZYY X;  2SEB D;  2LVQ A;  2JY6 A;  4MEL A;  4ZHO A;  1D6E C;  1ESF A;  5JZE B;  3KQ4 A;  1SXT A;  3PSE B;  2C7H A;  2Y5B B;  1GB4 A;  2QEJ C;  1FRR A;  3RNC C;  4EZJ A;  2GB1 A;  2CKH B;  3RFZ B;  3OAW A;  3TBL D;  3GZN I;  3T8M A;  1WJ4 A;  3SR6 A;  2AEH A;  1UF0 A;  1RRB A;  2X38 A;  5EDS A;  1N61 A;  2MW5 A;  4B95 A;  1D5Z C;  1J19 A;  2IO1 B;  2QC8 A;  4A6Q A;  2PIA A;  3TMP B;  1GC6 A;  4ZRQ A;  2K22 A;  4EE2 A;  1TS2 A;  1FCL A;  3DVN U;  4MJS B;  3EA6 A;  2M0A A;  1UNS A;  1ZKH A;  5EE3 A;  2JPH A;  3AMZ A;  3R8B A;  4A20 A;  4UDU C;  4A90 A;  1L0Y B;  1MHX A;  3OLM D;  4GU2 A;  4NNJ B;  1I4H A;  1UGJ A;  3PLV A;  1Q10 A;  4MDK E;  1XD3 B;  1IBX A;  1PUT A;  2WQY B;  1YOV B;  1ET6 A;  5E6P A;  1UD7 A;  2GOW A;  2KN5 A;  2H89 B;  2L05 A;  1VLB A;  2XNA C;  3AN1 A;  1N6Z A;  4RMA A;  3R7R A;  3HVD A;  4EOY A;  2DBY A;  3SHQ A;  3X23 A;  2JWU A;  3DWM A;  2LHE A;  3PPA A;  4HDQ A;  3BIN A;  1ET9 A;  2IO0 B;  2MBO A;  1SF0 A;  1WX9 A;  1SE9 A;  2EKE C;  3X0W A;  2ZPN A;  1L4D B;  3TEW A;  2FCN A;  4K7U A;  5TSS A;  2IPK D;  1Q1O A;  3P4R B;  2BGF A;  1F2R I;  3JVZ X;  4E3C A;  3I63 C;  4YT0 B;  4N59 A;  4KKI A;  3KLS X;  3AED B;  1OEY J;  1QF6 A;  1MVK A;  1VJK A;  4MJS A;  3HRD D;  3L16 A;  1WRD B;  5EE1 A;  4HJG E;  1EU4 A;  4IUM B;  2OHF A;  2IGG A;  2KLC A;  2N7E A;  1ACC A;  1HTO A;  2AQ2 B;  1IBX B;  3KUD B;  3DBH I;  2WHI A;  2Z0D B;  4ZDV A;  2AQ1 B;  1RM6 C;  4R3D A;  1NDD A;  4IW0 A;  1YN5 A;  2GBK A;  2QCZ A;  2RPQ A;  1E7P B;  2HTM E;  3APF A;  2PEA A;  3A9J A;  1E6E B;  3VR8 B;  1TY2 A;  2BB6 A;  2MJ3 A;  3CMM B;  4JWS C;  5L83 A;  2L3Z A;  2LI5 A;  2Z8L A;  3U52 E;  1B9R A;  3H6N A;  4JGH B;  3W5U B;  4W9L A;  3SU8 X;  2N9E B;  4DXF A;  1PGA A;  4K7S A;  2LEK A;  2GMI C;  1GC7 A;  2KK8 A;  2OJR A;  1F9J A;  1FFV A;  3Q8F A;  2KX0 A;  1KM7 A;  1TIF A;  1STE A;  3AEF B;  4HRS A;  2IY0 B;  3B08 A;  1LGR A;  4E71 A;  2PLP A;  4AS1 A;  3TIX A;  2DLB A;  3VFK A;  4IG7 B;  1RFA A;  4ZRP A;  3AI5 A;  1RWS A;  2ZEQ A;  2KMM A;  3GZN B;  3HM3 A;  1HE8 A;  4ARC A;  1UEL A;  3N30 A;  1WF9 A;  3A9K A;  2N9P C;  2PPH A;  3NOB A;  4DXA B;  2O2V A;  1D3Z A;  2BYV E;  2JZ3 B;  5HHD G;  2KTF A;  3QC8 B;  2N9K A;  4QAY A; 
#chains in the Genus database with same CATH homology
 1N62 A;  3LYY A;  4TQ1 A;  2OED A;  4USA A;  4YTP B;  2FE8 A;  1EM7 A;  5H8Y E;  3ZGZ A;  2BB5 A;  4IDI A;  2FUG 1;  3EGR A;  1JW9 D;  1XLP A;  1QIL A;  2EKI A;  4Q2J A;  1VRA B;  2L52 A;  3FC4 A;  1OFF A;  2ICI A;  2IGD A;  2VZK B;  1SIJ A;  1KFY B;  4RGN A;  4GLS C;  4C56 C;  2RDH A;  4ZYS A;  1XLN A;  2BTE A;  1C4P A;  4NZL B;  4YSZ B;  2KDM A;  1R7S A;  3P4Q B;  1HZ5 A;  1BML C;  2IJ0 A;  3NVZ A;  2WXM A;  1PGX A;  2ONQ A;  2J42 A;  1SE3 A;  5D3I B;  4MAC A;  3J9C A;  5BYQ A;  5FK9 C;  1FFU A;  1WGK A;  2N9L A;  2LJI A;  4YTM B;  2JSV X;  1MI0 A;  2W82 A;  3FAH A;  1CQV A;  2WXR A;  3W5V B;  1I4G A;  5FR3 A;  3O13 A;  4D2K A;  3NVY A;  2J53 A;  1ROE A;  2QJL A;  2FBW B;  4WWM A;  3PZ7 A;  1AN8 A;  1L6V A;  5EE9 A;  3BK1 A;  4WAF A;  5BMH A;  2EEL A;  4WUR A;  2L83 A;  1ZPS A;  2G1E A;  3H8H A;  3Q8C A;  1J7B A;  1FXA A;  5D3D A;  3U4E G;  1F2R C;  3VRA B;  1N5W A;  4L23 A;  2MJE A;  5H92 C;  4XDD A;  1PFD A;  1C4C A;  1WRI A;  1XCQ L;  2ON8 A;  4JWU C;  1C9F A;  3U2S C;  3AV8 A;  2E6X A;  1V8C A;  1EU3 A;  4OVZ A;  3L4P A;  1J7A A;  2WU2 B;  2WXF A;  3V05 A;  4P16 A;  3IAS 1;  1VDV A;  3P42 A;  2PW9 A;  2LMC A;  2L32 A;  1JWU D;  3BYY B;  4YWG G;  2PVG C;  4B0E A;  1TS3 A;  2PKO A;  3B2G A;  4RGT A;  3ZJU A;  1I4P A;  3ZJV A;  1YN3 A;  1FNU A;  1JCK B;  1GAQ B;  1XEE A;  1ZXH A;  5JXV A;  1TYG B;  1KTK A;  2CJN A;  2V3N A;  2N7J A;  1NYR A;  1JWB D;  1LO5 D;  4WH4 A;  3BVM A;  1DYQ A;  3SEB A;  3P1M A;  2LFI A;  4XWT A;  4JE3 B;  3CIR B;  3EUB 2;  4WQM A;  1QOG A;  3CWI A;  5C3J B;  3IAM 1;  1XO3 A;  2MH7 A;  2Q5W D;  3AEA B;  1AWD A;  3VRB B;  5EE0 A;  1TJE A;  2KN4 A;  4OHJ A;  3AE9 B;  1V1O A;  1ENF A;  1FIQ A;  1V97 A;  1A70 A;  2ZW1 A;  3URY A;  5AUK A;  3MP9 A;  4XWW A;  2BT6 A;  4IOI E;  3Q69 A;  2JZP A;  1NI3 A;  1TS4 A;  2K5P A;  1MHH E;  1VZ6 A;  4RFB A;  5G5G A;  5G5H A;  1I4Q A;  2WDR B;  1FXI A;  3LXF A;  1C78 A;  4TMA B;  1YN4 A;  2QIE B;  2WU5 B;  4KX6 B;  1FD6 A;  1FEH A;  3BZD B;  2KAC A;  1ZDX A;  2PTL A;  3HVZ A;  3FIL B;  2PMV A;  1I4R A;  2BW2 A;  2WDV B;  1BUI C;  2WXL A;  4JX1 C;  3AE2 B;  2BYT A;  4YSX B;  2SAK A;  1CJE A;  2Y3A A;  2V3P A;  1SE2 A;  1XCT L;  3BVZ A;  3ETR A;  4KGR A;  2INN E;  1SSN A;  2CJO A;  3UI3 A;  4YXD B;  3ZJT A;  1YNT E;  2I38 A;  2QIL A;  1GB1 A;  3AEB B;  1KH0 A;  1TKE A;  2MJD A;  3B9J A;  4AQ7 A;  5C2T B;  1FNW A;  1TY0 A;  3TEX A;  3AH7 A;  4ZHP A;  1QKZ A;  1XF5 L;  1N60 A;  3NVV A;  2ZW0 A;  2INP E;  1TZO A;  1YJJ A;  3IT4 B;  3VQI A;  1JWA D;  1L0V B;  3IXS A;  4ITK A;  4MM3 B;  1WWT A;  4ARI A;  1GOZ A;  3W1S A;  1EWC A;  1QOF A;  4LK0 M;  3N9Y C;  4TSS A;  1C79 A;  3U7Z A;  4ZOH C;  5AUI A;  1FNV A;  1GPX A;  4C7Y A;  3R2T A;  2ACZ B;  2L1A A;  3R2I A;  2LHD A;  1HA5 A;  1IGC A;  1L0X B;  3T3O A;  3NUH B;  2W55 A;  4WIP A;  5HI1 A;  3BK2 A;  3KWV A;  2LUM A;  4RF0 A;  1VZ7 A;  3GP7 A;  1YQ4 B;  2AQ3 B;  2D5G A;  4DXG A;  1ZE3 D;  3AM9 A;  4OZC A;  1K53 A;  3P4P B;  1T5X D;  2WXN A;  5HG2 A;  2J4X A;  3VR9 B;  1VZ8 A;  1FO4 A;  3ZQ4 A;  3DWG C;  2DWQ A;  3HUI A;  1JAL A;  1HXY D;  2K9X A;  1JRO A;  3LB8 C;  1BXT A;  1NEN B;  3AE5 B;  1HZ6 A;  1SB3 C;  2N0S B;  3C8Y A;  1RYJ A;  1SEB D;  2CU3 A;  4NAW B;  4US8 A;  1N5X A;  4OZB A;  2GI9 A;  4XE0 A;  1ZOY B;  2BS2 B;  2WLB A;  1F0Z A;  3MJ5 A;  1UUP A;  1KRH A;  3V3X A;  1DOI A;  1K52 A;  4LTU A;  3TEZ A;  2JYE A;  3ZYY X;  2JYT A;  2G9H D;  2SEB D;  1QOB A;  4ZHO A;  2JX5 A;  1D6E C;  1N63 A;  1E10 A;  3FIL A;  1ESF A;  2YEP B;  4GDK B;  3KQ4 A;  1SXT A;  2WXP A;  1QLB B;  1Y56 A;  1YMH E;  1B1Z A;  1C76 A;  1AYF A;  1SJE D;  4L1B A;  4RGO S;  3BYT B;  1E0Z A;  1ZUD 2;  1GB4 A;  4RCO A;  1ZXI A;  2QEJ C;  4A8X C;  1HQR D;  1FRR A;  2DYO A;  2K0P A;  2W3R A;  3PZ8 A;  2JU6 X;  3T3N A;  3MC0 B;  1MPE A;  2GB1 A;  3AEC B;  5BMI A;  1I4X A;  3RFZ B;  5MPO A;  4HKQ A;  2WXI A;  1KLG D;  3SR6 A;  3MFG A;  4KGS A;  1K50 A;  1T3Q A;  2X38 A;  5BYR A;  3TEY A;  5HFY A;  1N61 A;  2I2Y A;  4NAM A;  4RF1 A;  1D5Z C;  4YTN B;  1QT9 A;  4A6Q A;  3NZ3 A;  2PIA A;  1KF6 B;  4ZRQ A;  4EE2 A;  2K22 A;  1JRP A;  2WXO A;  1TS2 A;  1FRD A;  1SE4 A;  1FCL A;  3I57 A;  3EA6 A;  3SFE B;  2NTS A;  2M0A A;  1EWY C;  1UNS A;  2W3S A;  5EE3 A;  1WYG A;  2H88 B;  4PT5 A;  4TQ0 A;  2WP9 B;  3AMZ A;  3R8B A;  1V1P A;  4UDU C;  4A90 A;  1L0Y B;  1L5P A;  1MHX A;  2WNM A;  3W9C B;  2RPV A;  4N6E B;  1I4H A;  1OQR A;  4A55 A;  1UWM A;  1UGJ A;  4FXC A;  4M0W A;  1Q10 A;  2B76 B;  4C80 A;  5GXG B;  1IBX A;  1F77 A;  1PUT A;  2WQY B;  3B2F A;  4OZA A;  1ET6 A;  1XLQ A;  3AE3 B;  4MT5 A;  4A9A A;  2H89 B;  3PO0 A;  4DQO C;  1VLB A;  1CK1 A;  1NVI D;  2BBC A;  3NVW A;  4REZ A;  2KQ4 X;  2XNA C;  3AN1 A;  1ZDV A;  2IGH A;  3E9S A;  3HVD A;  1C4A A;  2M56 B;  2DBY A;  1D5M C;  4GDL B;  5D7G A;  2JWU A;  2WXQ A;  1TKY A;  3TSS A;  3DWM A;  4LLG M;  1WSP A;  2LHE A;  1DGJ A;  5E6J A;  2KAJ A;  2RMM A;  1V1P B;  3BII D;  3AEE B;  1SBB B;  1ET9 A;  2V0G A;  1QQR A;  4KKJ A;  1PGB A;  1SF0 A;  1D5X C;  1I7H A;  1L6U A;  3AE8 B;  1L4Z B;  1QOA A;  4P6V F;  2TSS A;  1L4D B;  2NMQ A;  3TEW A;  5TSS A;  3NS1 A;  2IPK D;  3P4R B;  3E56 A;  1F2R I;  4HKZ E;  3W2D A;  2WXK A;  4YT0 B;  3RPF C;  4N59 A;  4KKI A;  1AW7 A;  1JWM D;  3Q8A A;  3KLS X;  1PYW D;  2WXJ A;  2Y5C A;  3AED B;  1QF6 A;  1IUE A;  1MVK A;  2JQR B;  1CZP A;  1J7C A;  1VJK A;  2W54 A;  3OWE B;  4JPS A;  2VZK D;  1VR9 A;  3HRD D;  2PVO D;  1UWX A;  1XXG A;  5EE1 A;  4HJG E;  1K51 A;  2IDY A;  2JXT A;  1EU4 A;  3BWU D;  5LNK 1;  2LGI A;  1OQQ A;  2OHF A;  2V4I B;  2IGG A;  2WDQ B;  1T6B X;  3AE1 B;  2WXG A;  2QMT A;  1ACC A;  4HRO A;  4RGM A;  5T8I A;  2AQ2 B;  1IBX B;  3Q8B A;  4L2Y A;  3NRZ A;  5FKA C;  2K3U A;  1ZP0 B;  4IKG A;  1TKG A;  1FCC C;  1NEK B;  2AQ1 B;  4N58 A;  1RM6 C;  4R3D A;  4RH6 A;  2XN9 C;  1YN5 A;  4J3O D;  4YSY B;  3GB1 A;  1XLO A;  1DOY A;  1HEZ E;  4CQN A;  1E7P B;  2HTM E;  3AE7 B;  3P4S B;  1IGD A;  3Q8E A;  2RDG A;  5I4D A;  1E6E B;  3VR8 B;  3AE4 B;  3P63 A;  2HDE A;  1TY2 A;  3I9V 1;  3BVG A;  2BB6 A;  2J52 A;  2MJ3 A;  3TUO A;  4B0M A;  1KLU D;  1JML A;  3ABV B;  1NYQ A;  2Y5P A;  4JWS C;  2KWD A;  1TS5 A;  4H2A A;  4OW0 A;  1D4B A;  3U52 E;  2Z8L A;  1DOX A;  1B9R A;  2YEP F;  3AEG B;  3W5U B;  4HEA 1;  1YQ3 B;  2GRI A;  4DXF A;  1PGA A;  2NTT A;  3AE6 B;  4KGT A;  2LEK A;  1M4V A;  2AX5 A;  3MHZ A;  1WXQ A;  1FFV A;  3IT6 B;  3Q8F A;  1JQ4 A;  4RNA A;  3SFD B;  4C7Z A;  1STE A;  3AEF B;  4O1N A;  1FM0 D;  1RFK A;  4HRS A;  4US9 A;  1SJH D;  2R61 A;  1JWS D;  2PLP A;  1FMA D;  3WCQ A;  4AS1 A;  2BS3 B;  1P7F A;  2DLB A;  3GS2 A;  4XDC A;  4ZRP A;  2M19 A;  1RWS A;  3KWL A;  2KMM A;  2WS3 B;  5BMG A;  2DYM A;  4NJC A;  2MEK A;  1PDX A;  1P7E A;  1YJI A;  2BS4 B;  4ARC A;  5BYS A;  2E3T A;  2QSD A;  4MH8 A;  5HHD G;  1C77 A;  1E9M A;  2N9K A;  2WXH A;  3AB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...