2J57K

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AMICYANIN
total genus 32
structure length 124
sequence length 125
chains with identical sequence L, M, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j57K00
2MTAL 4O1QC 3PXTC 4FANC 2HXCD 2GC7B 2OK6D 2HJBD 4FA1C 2BBKL 2AGWD 2GC4B 3SJLC 1MAEL 1MAFL 2AGLD 2OK4D 3PXWC 2IAAB 4FAVC 4FA4C 2HJ4D 3ORVC 3SXTC 1MG2B 4Y5RC 2IURD 2J57K 3SVWC 4L1QC 3RLMC 2IUQD 2I0TD 2H3XB 2HKRD 3RN0C 4FA5C 4FB1C 2J56L 2OJYD 1MG3B 3PXSC 2J55L 3C75L 4K3IC 2HKMD 2AGXD 4L3HC 3RN1C 1MDAL 2IUVD 4FA9C 2Q7QD 3RMZC 2MADL 2OIZD 2H47B 3SWSC 2AGZD 2AH1D 2IUPD 3SLEC 2AGYD 2I0SD 3L4OC 3L4MC 2I0RD 4L3GC 2AH0D
chains in the Genus database with same CATH superfamily
2MTAL 4O1QC 3PXTC 4FANC 2HXCD 2GC7B 2OK6D 2HJBD 4FA1C 2BBKL 2AGWD 2GC4B 3SJLC 1MAEL 1MAFL 2AGLD 2OK4D 3PXWC 2IAAB 4FAVC 4FA4C 2HJ4D 3ORVC 3SXTC 1MG2B 4Y5RC 2IURD 2J57K 3SVWC 4L1QC 3RLMC 2IUQD 2I0TD 2H3XB 2HKRD 3RN0C 4FA5C 4FB1C 2J56L 2OJYD 1MG3B 3PXSC 2J55L 3C75L 4K3IC 2HKMD 2AGXD 4L3HC 3RN1C 1MDAL 2IUVD 4FA9C 2Q7QD 3RMZC 2MADL 2OIZD 2H47B 3SWSC 2AGZD 2AH1D 2IUPD 3SLEC 2AGYD 2I0SD 3L4OC 3L4MC 2I0RD 4L3GC 2AH0D
chains in the Genus database with same CATH topology
2MTAL 4O1QC 3PXTC 4FANC 2HXCD 2GC7B 2OK6D 2HJBD 4FA1C 2BBKL 2AGWD 2GC4B 3SJLC 1MAEL 1MAFL 2AGLD 2OK4D 3PXWC 2IAAB 4FAVC 4FA4C 2HJ4D 3ORVC 3SXTC 1MG2B 4Y5RC 2IURD 2J57K 3SVWC 4L1QC 3RLMC 2IUQD 2I0TD 2H3XB 2HKRD 3RN0C 4FA5C 4FB1C 2J56L 2OJYD 1MG3B 3PXSC 2J55L 3C75L 4K3IC 2HKMD 2AGXD 4L3HC 3RN1C 1MDAL 2IUVD 4FA9C 2Q7QD 3RMZC 2MADL 2OIZD 2H47B 3SWSC 2AGZD 2AH1D 2IUPD 3SLEC 2AGYD 2I0SD 3L4OC 3L4MC 2I0RD 4L3GC 2AH0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTA L;  4O1Q C;  3PXT C;  4FAN C;  2HXC D;  2GC7 B;  2OK6 D;  2HJB D;  4FA1 C;  2BBK L;  2AGW D;  2GC4 B;  3SJL C;  1MAE L;  1MAF L;  2AGL D;  2OK4 D;  3PXW C;  2IAA B;  4FAV C;  4FA4 C;  2HJ4 D;  3ORV C;  3SXT C;  1MG2 B;  4Y5R C;  2IUR D;  2J57 K;  3SVW C;  4L1Q C;  3RLM C;  2IUQ D;  2I0T D;  2H3X B;  2HKR D;  3RN0 C;  4FA5 C;  4FB1 C;  2J56 L;  2OJY D;  1MG3 B;  3PXS C;  2J55 L;  3C75 L;  4K3I C;  2HKM D;  2AGX D;  4L3H C;  3RN1 C;  1MDA L;  2IUV D;  4FA9 C;  2Q7Q D;  3RMZ C;  2MAD L;  2OIZ D;  2H47 B;  3SWS C;  2AGZ D;  2AH1 D;  2IUP D;  3SLE C;  2AGY D;  2I0S D;  3L4O C;  3L4M C;  2I0R D;  4L3G C;  2AH0 D; 
#chains in the Genus database with same CATH topology
 2MTA L;  4O1Q C;  3PXT C;  4FAN C;  2HXC D;  2GC7 B;  2OK6 D;  2HJB D;  4FA1 C;  2BBK L;  2AGW D;  2GC4 B;  3SJL C;  1MAE L;  1MAF L;  2AGL D;  2OK4 D;  3PXW C;  2IAA B;  4FAV C;  4FA4 C;  2HJ4 D;  3ORV C;  3SXT C;  1MG2 B;  4Y5R C;  2IUR D;  2J57 K;  3SVW C;  4L1Q C;  3RLM C;  2IUQ D;  2I0T D;  2H3X B;  2HKR D;  3RN0 C;  4FA5 C;  4FB1 C;  2J56 L;  2OJY D;  1MG3 B;  3PXS C;  2J55 L;  3C75 L;  4K3I C;  2HKM D;  2AGX D;  4L3H C;  3RN1 C;  1MDA L;  2IUV D;  4FA9 C;  2Q7Q D;  3RMZ C;  2MAD L;  2OIZ D;  2H47 B;  3SWS C;  2AGZ D;  2AH1 D;  2IUP D;  3SLE C;  2AGY D;  2I0S D;  3L4O C;  3L4M C;  2I0R D;  4L3G C;  2AH0 D; 
#chains in the Genus database with same CATH homology
 2MTA L;  4O1Q C;  3PXT C;  4FAN C;  2HXC D;  2GC7 B;  2OK6 D;  2HJB D;  4FA1 C;  2BBK L;  2AGW D;  2GC4 B;  3SJL C;  1MAE L;  1MAF L;  2AGL D;  2OK4 D;  3PXW C;  2IAA B;  4FAV C;  4FA4 C;  2HJ4 D;  3ORV C;  3SXT C;  1MG2 B;  4Y5R C;  2IUR D;  2J57 K;  3SVW C;  4L1Q C;  3RLM C;  2IUQ D;  2I0T D;  2H3X B;  2HKR D;  3RN0 C;  4FA5 C;  4FB1 C;  2J56 L;  2OJY D;  1MG3 B;  3PXS C;  2J55 L;  3C75 L;  4K3I C;  2HKM D;  2AGX D;  4L3H C;  3RN1 C;  1MDA L;  2IUV D;  4FA9 C;  2Q7Q D;  3RMZ C;  2MAD L;  2OIZ D;  2H47 B;  3SWS C;  2AGZ D;  2AH1 D;  2IUP D;  3SLE C;  2AGY D;  2I0S D;  3L4O C;  3L4M C;  2I0R D;  4L3G C;  2AH0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...