2J60A

H-ficolin complexed to d-fucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
b'CQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 63
structure length 214
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j60A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j60A02
1FZBC 2J5ZA 4JYOX 2OYHB 2D39A 1FZGC 1JC9A 1FZBB 2J3UA 1FICA 1FZAC 1Z3UA 2JHLF 2J61B 4M7HA 1FZAB 2JHKF 2Q9IC 2JHMF 1FZFC 1N86C 2J0HA 2J64A 2Z4EC 3BVHB 2J3FA 2Q9IB 1LT9C 2FIBA 3FIBA 1M1JC 2Z4EB 4ZFGA 2J0GA 1LT9B 1RF0B 1RE3B 1M1JB 2HODC 1FIDA 2J1GA 2JHHC 2JHIF 2HODB 3HUSB 1FZDA 3BVHC 1FIBA 1Z3SA 2GY7A 1FZEB 1RF0C 1RE3C 4JZCA 3H32B 2FFDB 2HPCC 2HLOB 2J3GA 1N73B 2HPCB 1LTJC 3HUSC 1LTJB 2J3OA 2H43B 1FZEC 1LWUB 3H32C 4M7FA 2FFDC 1RF1C 2XNXC 2HLOC 2J3FD 2OYIB 3E1IB 1RF1B 1N73C 2XNXB 1FZCC 4EPUA 2J0YA 1FZCB 4R9TA 1FZGB 2WNPF 2J60A 2H43C 1LWUC 3GHGC 4R9JA 1RE4C 1FZFB 1N86B 2J2PA 2OYIC 1RE4B 3E1IC 2OYHC 4NYTA 2J61A
chains in the Genus database with same CATH superfamily
1FZBC 2J5ZA 4JYOX 2OYHB 2D39A 1FZGC 1JC9A 1FZBB 2J3UA 1FICA 1FZAC 1Z3UA 2JHLF 2J61B 4M7HA 1FZAB 2JHKF 2Q9IC 2JHMF 1FZFC 1N86C 2J0HA 2J64A 2Z4EC 3BVHB 2J3FA 2Q9IB 1LT9C 2FIBA 3FIBA 1M1JC 2Z4EB 4ZFGA 2J0GA 1LT9B 1RF0B 1RE3B 1M1JB 2HODC 1FIDA 2J1GA 2JHHC 2JHIF 2HODB 3HUSB 1FZDA 3BVHC 1FIBA 1Z3SA 2GY7A 1FZEB 1RF0C 1RE3C 4JZCA 3H32B 2FFDB 2HLOB 2HPCC 2J3GA 1N73B 2HPCB 1LTJC 3HUSC 1LTJB 2J3OA 2H43B 1FZEC 1LWUB 3H32C 4M7FA 2FFDC 1RF1C 2XNXC 2HLOC 2J3FD 2OYIB 3E1IB 1RF1B 1N73C 2XNXB 1FZCC 4EPUA 2J0YA 1FZCB 4R9TA 1FZGB 2WNPF 2J60A 2H43C 1LWUC 3GHGC 4R9JA 1RE4C 3GHGB 1FZFB 1N86B 2J2PA 2OYIC 1RE4B 3E1IC 2OYHC 4NYTA 2J61A
chains in the Genus database with same CATH topology
1FZBC 2J5ZA 4JYOX 2OYHB 2D39A 1FZGC 1JC9A 1FZBB 2J3UA 1FICA 1FZAC 1Z3UA 2JHLF 2J61B 4M7HA 1FZAB 2JHKF 2Q9IC 2JHMF 1FZFC 1N86C 2J0HA 2J64A 2Z4EC 3BVHB 2J3FA 2Q9IB 1LT9C 2FIBA 3FIBA 1M1JC 2Z4EB 4ZFGA 2J0GA 1LT9B 1RF0B 1RE3B 1M1JB 2HODC 1FIDA 2J1GA 2JHHC 2JHIF 2HODB 3HUSB 1FZDA 3BVHC 1FIBA 1Z3SA 2GY7A 1FZEB 1RF0C 1RE3C 4JZCA 3H32B 2FFDB 2HPCC 2HLOB 2J3GA 1N73B 2HPCB 1LTJC 3HUSC 1LTJB 2J3OA 2H43B 1FZEC 1LWUB 3H32C 4M7FA 2FFDC 1RF1C 2XNXC 2HLOC 2J3FD 2OYIB 3E1IB 1RF1B 1N73C 2XNXB 1FZCC 4EPUA 2J0YA 1FZCB 4R9TA 1FZGB 2WNPF 2J60A 2H43C 1LWUC 3GHGC 4R9JA 1RE4C 1FZFB 1N86B 2J2PA 2OYIC 1RE4B 3E1IC 2OYHC 4NYTA 2J61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB C;  2J5Z A;  4JYO X;  2OYH B;  2D39 A;  1FZG C;  1JC9 A;  1FZB B;  2J3U A;  1FIC A;  1FZA C;  1Z3U A;  2JHL F;  2J61 B;  4M7H A;  1FZA B;  2JHK F;  2Q9I C;  2JHM F;  1FZF C;  1N86 C;  2J0H A;  2J64 A;  2Z4E C;  3BVH B;  2J3F A;  2Q9I B;  1LT9 C;  2FIB A;  3FIB A;  1M1J C;  2Z4E B;  4ZFG A;  2J0G A;  1LT9 B;  1RF0 B;  1RE3 B;  1M1J B;  2HOD C;  1FID A;  2J1G A;  2JHH C;  2JHI F;  2HOD B;  3HUS B;  1FZD A;  3BVH C;  1FIB A;  1Z3S A;  2GY7 A;  1FZE B;  1RF0 C;  1RE3 C;  4JZC A;  3H32 B;  2FFD B;  2HPC C;  2HLO B;  2J3G A;  1N73 B;  2HPC B;  1LTJ C;  3HUS C;  1LTJ B;  2J3O A;  2H43 B;  1FZE C;  1LWU B;  3H32 C;  4M7F A;  2FFD C;  1RF1 C;  2XNX C;  2HLO C;  2J3F D;  2OYI B;  3E1I B;  1RF1 B;  1N73 C;  2XNX B;  1FZC C;  4EPU A;  2J0Y A;  1FZC B;  4R9T A;  1FZG B;  2WNP F;  2J60 A;  2H43 C;  1LWU C;  3GHG C;  4R9J A;  1RE4 C;  1FZF B;  1N86 B;  2J2P A;  2OYI C;  1RE4 B;  3E1I C;  2OYH C;  4NYT A;  2J61 A; 
#chains in the Genus database with same CATH topology
 1FZB C;  2J5Z A;  4JYO X;  2OYH B;  2D39 A;  1FZG C;  1JC9 A;  1FZB B;  2J3U A;  1FIC A;  1FZA C;  1Z3U A;  2JHL F;  2J61 B;  4M7H A;  1FZA B;  2JHK F;  2Q9I C;  2JHM F;  1FZF C;  1N86 C;  2J0H A;  2J64 A;  2Z4E C;  3BVH B;  2J3F A;  2Q9I B;  1LT9 C;  2FIB A;  3FIB A;  1M1J C;  2Z4E B;  4ZFG A;  2J0G A;  1LT9 B;  1RF0 B;  1RE3 B;  1M1J B;  2HOD C;  1FID A;  2J1G A;  2JHH C;  2JHI F;  2HOD B;  3HUS B;  1FZD A;  3BVH C;  1FIB A;  1Z3S A;  2GY7 A;  1FZE B;  1RF0 C;  1RE3 C;  4JZC A;  3H32 B;  2FFD B;  2HLO B;  2HPC C;  2J3G A;  1N73 B;  2HPC B;  1LTJ C;  3HUS C;  1LTJ B;  2J3O A;  2H43 B;  1FZE C;  1LWU B;  3H32 C;  4M7F A;  2FFD C;  1RF1 C;  2XNX C;  2HLO C;  2J3F D;  2OYI B;  3E1I B;  1RF1 B;  1N73 C;  2XNX B;  1FZC C;  4EPU A;  2J0Y A;  1FZC B;  4R9T A;  1FZG B;  2WNP F;  2J60 A;  2H43 C;  1LWU C;  3GHG C;  4R9J A;  1RE4 C;  3GHG B;  1FZF B;  1N86 B;  2J2P A;  2OYI C;  1RE4 B;  3E1I C;  2OYH C;  4NYT A;  2J61 A; 
#chains in the Genus database with same CATH homology
 1FZB C;  2J5Z A;  4JYO X;  2OYH B;  2D39 A;  1FZG C;  1JC9 A;  1FZB B;  2J3U A;  1FIC A;  1FZA C;  1Z3U A;  2JHL F;  2J61 B;  4M7H A;  1FZA B;  2JHK F;  2Q9I C;  2JHM F;  1FZF C;  1N86 C;  2J0H A;  2J64 A;  2Z4E C;  3BVH B;  2J3F A;  2Q9I B;  1LT9 C;  2FIB A;  3FIB A;  1M1J C;  2Z4E B;  4ZFG A;  2J0G A;  1LT9 B;  1RF0 B;  1RE3 B;  1M1J B;  2HOD C;  1FID A;  2J1G A;  2JHH C;  2JHI F;  2HOD B;  3HUS B;  1FZD A;  3BVH C;  1FIB A;  1Z3S A;  2GY7 A;  1FZE B;  1RF0 C;  1RE3 C;  4JZC A;  3H32 B;  2FFD B;  2HPC C;  2HLO B;  2J3G A;  1N73 B;  2HPC B;  1LTJ C;  3HUS C;  1LTJ B;  2J3O A;  2H43 B;  1FZE C;  1LWU B;  3H32 C;  4M7F A;  2FFD C;  1RF1 C;  2XNX C;  2HLO C;  2J3F D;  2OYI B;  3E1I B;  1RF1 B;  1N73 C;  2XNX B;  1FZC C;  4EPU A;  2J0Y A;  1FZC B;  4R9T A;  1FZG B;  2WNP F;  2J60 A;  2H43 C;  1LWU C;  3GHG C;  4R9J A;  1RE4 C;  1FZF B;  1N86 B;  2J2P A;  2OYI C;  1RE4 B;  3E1I C;  2OYH C;  4NYT A;  2J61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...