2JDRA

Structure of pkb-beta (akt2) complexed with the inhibitor a-443654
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE-PROTEIN KINASE
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdrA01
3C7QA 4GL9A 2UW7A 3F2NA 4JRVA 4XG9A 4I0TA 2BRNA 3U6HA 5DVRA 4RPVA 2BRBA 2X39A 4PWNA 4FT9A 4OAVB 2BVAA 3D15A 3T8OA 2Q0NA 5CANA 4AZVA 4PQNA 5HVJA 3BU5A 2VTJA 2UZTA 3E87A 3P86A 5HBHA 2ZYBA 1JWHA 2P2HA 4Y73A 4A9YA 5HKMA 3HMPA 4KWPA 2HYYA 3MI9A 4JNWA 4MHAA 4D1ZA 3BCEA 3OCGA 3FBVA 4CCBA 5CSPA 3TV7A 3VUGA 5BVOA 1WAKA 3OW4A 4V01A 4GKHA 1UNLA 1XH8A 3PE2A 4OTQA 4XP3A 2QLQA 3MIAA 4DAWA 2W1CA 4RQKA 3Q5ZA 4ZSLA 4OR5A 5M4FA 2FGIA 4BCNA 3FKOA 3DS6A 3NSZA 4TYEA 2J0KA 3FY2A 1WBVA 2GNGA 2BMCA 3QHRA 2O64A 1WVXA 2B4SB 3NUXA 4K33A 1Q5KA 1J3HA 2XYNA 4OTHA 2CGVA 4BVUA 4BZDA 4BDEA 4DCAA 3ZSHA 3VUTA 3QCYA 3U9CA 3ORXA 4M69A 2OJGA 3QUPA 4ZTQA 2OFUA 3FMLA 3P5KA 4CG9A 2VWVA 5M09A 4LGHA 3H0ZA 4LMNA 5L6WL 5A46A 5AR2A 4LV5A 3KMMA 2C69A 2YIWA 5AUVA 2I1MA 1PXPA 5M4CA 2WFYA 4S34A 3V5TA 3BHHA 1H4LA 4CLIA 5J7HA 3C50A 3B8QA 3DZQA 4O84A 4K11A 3G51A 3NLBA 4EH2A 4AT4A 2W5BA 4C3FA 3ACJA 3KVXA 3AGLA 3WF5A 5EQEA 3DGKA 4WNMA 5EM6A 4HVHA 4AN2A 3QUDA 5FRIA 4FV0A 2BALA 3RJCA 1Q41A 5L6OA 3ZUVA 2VTSA 5AFVA 2HZIA 1M7NA 3V8TA 1RE8A 1YOLA 4N70A 1U4DA 3QXPA 4E7WA 1CM8A 4RMZA 4Z3VA 1J7IA 5DFPA 3ZS5A 2VTQA 3I7CA 4BI2A 3D2KA 3DCVA 3QCQA 2GFCA 2VNWA 3QTSA 4C33A 2BILB 2Y4IB 4D55A 2YAKA 2Z02A 3FLZA 3TCPA 3WIGA 5IISA 3F5XA 5EM8A 5HO6A 4Z55A 3VBWA 4DFXE 2WMRA 4C59A 1IEPA 3HYHA 3R1QA 5AA8A 4I1ZA 3EN7A 4RRVA 5JFWA 3FC1X 5L2QA 4OBOA 3R1NA 5GZ9A 3AT2A 4BIDA 3C4EA 3OCSA 2XF0A 4X0MA 4DEDA 2YHVA 5HOAA 4G6NA 3F61A 4ZTNA 4LRMA 4MAOA 4F9BA 3IDCA 3SXFA 2HENA 4KKEA 1JNKA 4L3JA 4QMLA 2UW5A 3EQFA 3QRUA 2JDTA 3UOKA 2I7QA 3QUEA 5A54A 4BGHA 5E8WA 3CY2A 4XG2A 5IQHA 4QPSA 4KBKA 4YJPA 3VNTA 4IWOA 4EQMA 4DFBA 4QRCA 3L8PA 5B0XA 2KTYA 2VU3A 3ZFXA 3UC4A 4FTKA 3EN5A 2OGVA 4FV7A 3OWPA 3VS7A 4B99A 3HRFA 2H96A 4ALWA 4GKIA 4TWNA 3EKKA 3UYSA 1LPUA 5HE1A 1Q8YA 1Q99A 3TM0A 2GS2A 3AOXA 4V05A 3P79A 5AV0A 5L2TA 3S1HA 3C5UA 4ZJVA 5FG8A 2PE0A 3Q6WA 3C4XA 2UW4A 1U5RA 3HRCA 1Q8WA 1V1KA 1Y6AA 2XK3A 5I3OA 4D2RA 1Q3WA 3WF8A 3MV5A 3UIMA 5K4JA 1HOWA 2GMXA 5AA9A 2HXQA 4L7SA 3DY7A 4PDSA 4TTHB 1MQ4A 1Y8YA 3P4KA 5CVGA 3RAWA 4DHFA 2XJ1A 4FT3A 4PTCA 4DH3A 3DXPA 3WZJA 1SVHA 1YXXA 3E63A 1OUKA 4JL9A 4E93A 5EH0A 1FGKA 4KKGA 2F9GA 1PJKA 5IH6A 3QZFA 3FPQA 3ORKA 2EB2A 2BKKA 4O83A 1HCLA 2X0GA 3SLSA 4RX9A 4KRDA 4BHZA 2Z8CA 2WNTA 4EK6A 3EQDA 2GDOA 5EDQA 2EWAA 1NVQA 2OJFE 3SG8A 2BR1A 2C6TA 2JD5A 4NT4A 2Y0AA 1MRYA 3NPCA 4AGCA 4FG7A 1UU3A 3P08A 3RP9A 5HD7A 4RIYA 1PKGA 2JC6A 2OZAB 1W84A 2IVUA 2ZB1A 2XIXA 3COKA 3CSVA 3BI6A 3JS2A 2WU7A 3POOA 4QT1A 1OL5A 4AOTA 4NIFB 4KBAA 2W1FA 4U80A 3S4QA 3O7LD 3AD6A 1U59A 1PXMA 2BZHB 3Q5IA 4HCUA 1KE5A 3R0TA 4RA5A 5EFQA 3RTPA 4X3FB 3UZTA 2PK9A 4IDVA 1V0PA 3R9NA 4AZFA 5I9ZA 5E4HA 3NYNA 4UBAA 4B6LA 2HZ0A 3KXGA 5CU0A 3QRTA 4DGOA 4NFNA 2XIKA 2BZIB 5EI8A 4BDJA 4PPCA 4BI0A 4CXAA 3R1YA 1Q62A 4HCTA 3A2CA 2J51A 3P23A 3WZKA 4JS8A 5M56A 2R5TA 3MFUA 3F2AA 5AUTA 3IO7A 4YC3A 4O7LA 3BWFA 3F3ZA 1VZOA 4O96A 5L6PA 2WEVA 1F0QA 3LFCA 4YTCA 2VO0A 3UVPA 4UWBA 4U79A 3OHTA 5B2MA 3QKLA 4C3RA 3AC1A 4QMNA 4O2PA 1KV1A 3PA3A 4WIHA 3NCGA 4BDDA 5E8SA 3R9RA 4RC3A 2OO8X 5EOLA 4O0UA 3ITZA 1URWA 3OW3A 4AS0A 4CMOA 4GRBA 3HP5A 4BDFA 4NW5A 4O1OA 3TWJA 5K3YA 2XEYA 3COHA 4H36A 4MCVA 5C1QB 3KRRA 4BY9E 2BFXA 3ZM4A 4MYGA 3KF7A 4RWKA 3ODZX 4DFNA 4GJ3A 5LMKC 3PXYA 5E8ZA 3TZ8A 3L9MA 4H39A 1PW2A 4JJRA 5GZAA 2X2MA 4FKTA 4M69B 4UZDA 3IW4A 5LMAA 5H3QA 3RNIA 4RLKA 5AEPA 1FMKA 2ETMA 3WYXA 2QODA 3GOPA 1M2PA 3LXLA 4FSYA 4FIGA 4TWCA 2XKDA 3IW8A 2PUPA 4LG4A 4MXOA 3FLNC 2WMQA 4FR4A 2FYSA 3H10A 4YSMA 4AGDA 4FL2A 4ANBA 4L3LA 1UKHA 4U41A 2J50A 4AF3A 3AD4A 4IMYA 3VJNA 4AW5A 5HU9A 5AR7A 3ENHA 4C37A 3BLRA 3DKCA 3GUBA 2X81A 3P7AA 4MNFA 2Y6MA 5TF9A 3AC8A 3A61A 5M06A 1YOJA 4ID7A 3HV7A 2W1DA 4U0IA 3Q3BA 4TYGA 4BKYA 3ZFYA 4YHFA 5C9CA 1YRPA 4CZUA 3Q9ZA 3LXPA 3FMKA 2JAVA 5E8XA 1YHVA 4FKIA 4JAJA 2PE2A 3FEGA 1OL7A 3GU7A 2BRGA 4RWJA 5HICA 3CPBA 2WD1A 2YITA 1Q3DA 4FUYA 4YC6A 2EXMA 5AUZA 4BKJA 3BV2A 2C5YA 3V3VA 2SRCA 2HIWA 4ACMA 2CN8A 2XMYA 5BQ0A 3L8XA 3MVJA 4W4XA 5KMIA 4RGJA 2DYLA 3D14A 2UZDA 4I94A 4IC7A 2W05A 5HTBA 1JSVA 5CT0A 3HAMA 4OTIA 3RK9A 3KEXA 3T3UA 3FKLA 2VTLA 4AOJA 3FLWA 3PZEA 3KCKA 5I9UA 3W8QA 2OF2A 2VX3A 5BYLA 3G90X 2WHBA 4J97A 2FSMX 4D1SA 5JRSA 4YSJA 2AC3A 4QMZA 2X2KA 4NEUA 2I6LA 4ACGA 5IA3A 4MNEB 4FTAA 3R7IA 1PXKA 3EQCA 3PY3A 4QOXA 4TXCA 2PYWA 3TNIA 3O50A 4FVQA 5FTQA 3V5PA 2Q0BA 5DT4A 4XOYA 3PZHA 4C2VA 5DLSA 2C3IB 2HXLA 4IX6A 2OU7A 2QNJA 3PSDA 5HG8A 5KUPA 4D9TA 5F95A 3I79A 4C36A 5I0BA 1MRVA 4IH8A 1NXKA 4O0RA 4WKQA 4GJ2A 3VQUA 4ERKA 2ITWA 2W4JA 3VBXA 4CYJA 1FVRA 1I44A 4YNOA 4OTDA 3ZLXA 1FVVA 4R5YA 5HIBA 2I0VA 2ZV9A 3ACKA 3LFNA 3AD5A 4DYMA 3VRYA 3MWUA 4BDKA 2J9MA 5HO8A 4LGDA 2W17A 3I0QA 4ASXA 5IEYA 4AN3A 3LMHA 3N4TA 2ZOQA 3ATSA 3DAJA 5C03A 4DFLA 2I0EA 1NVSA 2PMOX 3IQ7A 2IO6A 5AP0A 2WTDA 2GNLA 5JKGA 2C6MA 2PMIA 3KRWA 2C30A 2PUUA 3DBFA 4U44A 3DNDA 3NW5A 3KK8A 1YQJA 3ZDIA 5BVDA 5HU3A 3Q96A 5IEXA 5GINE 2BAJA 4BCFA 5L2SA 4L3PA 3SRVA 4ASZA 5C26A 1H28A 3UP2A 3BHVA 4H3PA 4J8MA 3POZA 3ENMA 5T68A 4BYIA 3HECA 5IMEA 4WD5A 1CKIA 1TQIA 5CS6A 4DLJA 3NW7A 5ANJA 3UNKA 3ZXZA 3W2PA 4CD0A 5CVHA 5HLPA 3KFAA 2OXXA 3GU4A 2B7AA 2JKQA 3OWLA 5DT3A 4M0YA 4K6ZA 3Q2MA 3T3VA 4MH7A 3QQJA 2C3KA 5E8UA 5HX6A 5BVEA 3Q60A 5L4QA 1K3AA 2GS6A 2XYUA 3MTFA 4TT7A 4DF3A 5M53A 4FSRA 3KXHA 3PJ3A 4X2KA 2PVJA 3A99A 4JIKA 4RJ6A 4QP2A 3FWQA 4II5A 3UC3A 3W33A 2FA2A 4AOIA 4C34A 1XBCA 1LEWA 3SXSA 3BYSA 4EKLA 4QO9A 2V55A 2VWBA 1VJYA 3FI4A 5BNJA 1YXSA 4A9TA 3OT3A 4EHEA 4G17A 4X2JA 3FV8A 4HNIA 4FSMA 4TY1A 2GTNA 2BAQA 4F6UA 2C5NA 3FZOA 3KF4A 4F1OA 4IX5A 4M67A 5EOBA 1U5QA 3UYTA 3PTGA 2V0DA 2WQMA 4MQ2A 4FA2A 4EUUA 2GNHA 1PXIA 5IA1A 5GZ8A 2PUNA 4AACA 2PL0A 4BTJA 1DS5A 3GU8A 5IQCA 4XCUA 2QU6A 4XLIA 4F9WA 3PUPA 1H8FA 5CASA 5A4QA 4A4LA 4G3EA 4FTQA 3D7TA 4GG7A 4DITA 4DTAA 5HESA 4QPMA 1YHWA 2UZVA 5KHXA 3C4CA 5EM5A 2OJJA 2VTNA 2E9VA 4M8TA 1YXUA 2C5XA 2WO6A 3NZ0A 3E8DA 4U6RA 4JR7A 5LQFA 4LFIA 4CKJA 2HZNA 3N9XA 2QHNA 1OM1A 1H01A 3QZGA 3DU8A 2NRUA 3A4PA 4RFZA 5CF5A 3MB7A 4CFVA 3PPKA 4ITJA 4RA4A 3TN8A 5IUHA 3HAVA 3MA6A 4NYEA 2IVTA 1KE7A 2AC5A 1OKYA 3TKIA 3UO6A 3VBYA 4DGMA 3ZRMA 4ASDA 4O86A 3QRIA 3NEWA 2NNWB 2A4LA 2OH0E 2C0IA 2OK1A 4G1WA 3TDWA 4YR8A 3M11A 1BI7A 2C1AA 3LE6A 4NJDA 3QYZA 2IZRA 4W8DA 1ZAOA 2VNYA 3MJ1A 2REIA 3A7JA 4FUXA 4GG5A 4S32A 3R7VA 3MA3A 3FQEA 4N6ZA 2R7IA 3PDTA 5DNRA 3MGYA 4NCTA 3C1XA 1UU8A 3LFFA 4NCTC 4RX8A 4J53A 3UDBA 3LJ2A 3VS4A 2VN9A 3LQ3A 1YKRA 4X2FA 1JKKA 1PYEA 3C4FA 4M15A 3DV3A 2R3PA 5HCXA 2PZYA 4RVMA 2QD9A 4UMQA 2HOGA 4W4VA 3UOHA 4MK0A 3UIXA 3VAPA 3U4WA 2FSTX 5E91A 3VULA 3CIKA 4F7JA 3KN6A 4IAAA 3PXFA 2OF4A 4I3ZA 3NIEA 1YXTA 3KN5A 2IW6A 4DGGA 4WG5A 1CTPE 3QQLA 3FUPA 1GIJA 2ZDUA 5FTOA 4XP2A 3R01A 5IKWA 4PMMA 4PL5A 4L52A 5CVFA 4AAAA 4ZAUA 4PNIA 2VTTA 4OT6A 4AUAA 4BF2A 4BFMA 3BKBA 3L9PA 5L3AA 3EQIA 3FXWA 3HRBA 3L8SA 3NNUA 3PVWA 4KIPA 3FLQA 4YJNA 4UWCA 3AMYA 3HMNA 4IX4A 5CAQA 1G8SA 4C57A 4I20A 3UG1A 3QF9A 3ORPA 5E7RA 5CXHA 3K2LA 3E7OA 4QNAA 4QD6A 5M44A 2FUMA 2WQNA 3DXNA 3W55A 4HYHA 5FLFA 4YJVA 3O17A 2QR7A 3QA8A 3LJ0A 3QTUA 1KE6A 4IVDA 3DZOA 2WTKC 1M2QA 1UA2A 4IZ7A 3O96A 5FP5A 2PUIA 2X6DA 3GU5A 3HL7A 1REKA 3CQUA 3D2IA 4NM0A 4RVLA 2B9IA 4Y95A 5L8LA 3BYOA 2CMWA 2PMNX 2XK4A 3PA5A 3BQCA 4EH3A 4BCIA 5C8MA 4YGAA 1E1XA 5HVKA 2XJ0A 3BE9A 4YMJA 4FZAB 2OW3A 5AR8A 4E8AA 3KQ7A 2BZKB 2UW8A 3RCJA 3FDNA 2QOLA 3MFRA 3L9LA 5FQDC 5IG1A 1GJOA 4MVFA 3RHXA 4LRJA 1W82A 2QQ7A 2W0JA 4QTBA 3C0HA 2PVNA 4Y83A 4QTEA 3F88A 4WRSA 4EOKA 4M7IA 3DFCB 3F3WA 3MDYA 2YDJA 3F9NA 1YDRE 2XKCA 4ALUA 2O3PA 4D4RA 3F6XA 5CEQA 2RG6A 3EFLA 2H9VA 5ACKA 1YDTE 1B39A 4E5WA 1MRUA 3OEFX 4H05A 3D83A 4H1MA 1Q8ZA 4CZYB 1UWJA 4FEVA 4FKWA 2C0TA 4NZWB 4FZDB 5EYMA 4WO5A 5KMMA 4P7EA 3W2RA 4ARKA 3TIYA 5HD4A 2ITNA 3RAHA 4JG6A 2IG7A 4FKGA 2QOIA 3KXXA 4WRGA 3KKVA 1LEZA 1IASA 5M08A 4J71A 3HP2A 2WMTA 3TZMA 2YISA 4FICA 3KC3A 4DN5A 4ZSJA 5EKNA 1IR3A 3DLSA 1OVEA 5J8IA 4H3QA 3NCZA 3VS5A 3FI8A 2OFVA 1OZ1A 3LFDA 1GZOA 1Q24A 4MF0A 3PXRA 2EXCX 2G2FA 4IW0A 3KRXA 2QOQA 3FL4A 5AMNA 1BMKA 2IW8A 1ZZ2A 4MKCA 3K54A 2W1HA 4JX7A 2X7OA 2WB8A 5IDNA 2B1PA 2XNOA 3JVSA 2P3GX 2XP2A 5EYCA 3PJ8A 4GT5A 4K0YA 4FOCA 3VHEA 4O7TA 4R1VA 3N4VA 3C51A 3RPRA 4J95A 4EJ7A 2HY0A 5E1SA 2W99B 1OKZA 2BRMA 3HA8A 4FGBA 4GVJA 4WNOA 4BCJA 3NNXA 3OCBA 5G6VA 3S0OA 3LCOA 3D94A 2F49A 3E3PA 4MBJA 1OIUA 4YTIA 3EJ1A 3E62A 1JBPE 2OKRA 4L00A 3CTHA 4ORKA 2VX0A 2G01A 1AD5A 2WGJA 2JIUA 4FV4A 3CJGA 4JDIA 4XV9A 3EZVA 3V04A 3HA6A 5J9YA 4CFNA 1Y6BA 3ZHPC 4BBFA 1Y57A 5AP2A 4QTCA 3FQHA 2YACA 5H8EA 2ITXA 4JBQA 5CLPA 3FMNA 3SX9A 5KMLA 4IHPA 3ANQA 4NIFA 4E6AA 4XJ0A 1FINA 3MW1A 1ZOGA 3QFVA 3WF9A 3GBZA 4HNFA 5HE2A 4EH5A 5GIOE 1VYZA 4QP8A 3B2WA 2J6MA 2VWIA 4CSVA 5D7AA 4QP1A 4RG0A 1JSTA 3FY0A 4B4LA 5HLWA 4FIEA 2GHMA 3GU6A 3PVGA 4GCJA 4UWYA 3CGOA 4ACHA 3EQGA 4BZOA 5H8BA 5L2IA 5A4CA 2E9UA 2EB3A 1STCE 5FTGA 1G5SA 4I5MA 1XKKA 1U46A 4I5PA 1BYGA 5D41A 4JQEA 3GGFA 4JLCA 5AR3A 1IA9A 2WQEA 3AQVA 2HW6A 3OFMA 3QALE 4APPA 1M14A 4M13A 5IH4A 3P9JA 5HTCA 3BU6A 3EN9A 2EUFB 3FHRA 3QTXA 4E5BA 1Q8TA 4WG4A 1ZZLA 3U9NA 1B6CB 4K77A 4UV0A 4DH7A 5CAVA 4FKUA 3OXIA 1Z5MA 2YCFA 5DEYA 4ERWA 3A7IA 4ZJIA 4L68A 4TL0A 1H27A 4DGNA 5IQEA 3BBWA 3ZU7A 2PULA 4AE9A 3U54A 4CFFA 2ITPA 4PY1A 2YWPA 2BCJA 4DEHA 5LMKA 2F7XE 5FM3A 1CKJA 3ULIA 4F7NA 5HO7A 1JAMA 1Y91A 2XIYA 4QYFA 5LARA 4WUNA 4I24A 3N4UA 2BDFA 2PZIA 2R3OA 3IDPA 4QQTA 4HVGA 2WIPA 4ZMFA 1ZYDA 4UB7A 3LFQA 4I22A 2XCKA 2WMVA 4FG9A 2YAAA 4N4SA 4BZNA 3A7GA 3VUMA 2VO3A 3GVUA 4RSSA 3VBTA 1TKIA 4IZYA 4J98A 4XS2A 3HX4A 4ZZMA 4DEEA 2FVDA 3DQXA 4P5ZA 3NAXA 5DEWA 5C8NA 4DBXA 5AP6A 5HCZA 3NAYA 4BRXA 4BCOA 3OZ6A 4U5JA 4OBQA 1BLXA 1R1WA 2VTHA 4O91A 4ANSA 2QURA 2UZUE 5CQWA 3T9TA 1H0WA 2W06A 3DLZA 4JBOA 4EQUA 3OOGA 3E92A 4EOOA 3G15A 5ETIA 5DMZA 3OEZA 4AT3A 3WI6A 5TO8A 1OIRA 4BBEA 4NJ3A 3RWPA 5CSXA 4MQ1A 4OTPA 2OXYA 3NWWA 4AA0A 4RIXB 4D4SA 4HVIA 3R63A 3HKOA 4ENXA 3BYVA 3VWAA 4R7HA 2W9FB 2CKQA 1CDKA 3BGZA 1JOWB 4LOOA 2C6KA 4U43A 5K5XA 2QR8A 1W98A 5EYDA 2ERKA 2R0IA 1AQ1A 5CAPA 2UZEA 1M7QA 2J4ZA 4KSPA 2PY3A 3R8PA 1LP4A 2JGZA 3OY1A 4QMVA 2JEDA 4F1TA 2P4IA 1IA8A 3BEGA 3F66A 3R71A 5HQ0A 4RZWA 2UW3A 2Y4IC 3ZLYA 4I5HA 3QLGA 5DRBA 2CN5A 4HCVA 1M52A 4BWPA 1B38A 1WBTA 2VO7A 2GCDA 4MNEA 2PTKA 4WT6A 5GJGA 4ZXTA 1J7LA 2ZM4A 3CQEA 4PP9A 3WE8A 4FK3A 3UP7A 4L9IA 4IFCA 3RM7A 4FG8A 4G5PA 4AZSA 3JVRA 4PUZA 5A3XA 2IW9A 3F5GA 3ZSIA 5GJDA 4UX9A 1NY3A 4G6LA 3E8NA 4KABA 4XLVA 2ESMA 2W4OA 4YTFA 3W8LA 2JDSA 4KKHA 2JDOA 4XNEA 5TOZA 4IM2A 1QPDA 3Q4TA 3FKNA 4FV1A 4QQCA 3CP9A 5D10A 5IUIA 5BMSA 3ZO2A 3E8CA 3QCXA 2VD5A 5ANOA 3HZTA 2XIZA 4NU1A 2G15A 4JOAA 2X9EA 5FD2A 1O6LA 2XRWA 2GNFA 3R83A 1SNXA 3IG7A 5B2KA 4C3PA 2CSNA 4DG0E 2YEXA 1YI4A 3FYJX 4FZ7A 1U54A 3E8EA 2YJRA 1L3RE 4B8LA 1H26A 2ZAZA 3PXZA 1OBDA 4FNWA 4RJ5A 4I6HA 3BWJA 4G31A 2G2HA 2VGOA 1MUOA 2CJMA 4G5JA 4TYIA 2XNEA 4DG3E 2I40A 3ZONA 3R8VA 1UKIA 4GUEA 4R3RA 3RNYA 4F09A 4ITIA 2YIXA 4Z7GA 5IUGA 5JSMA 3Q2JA 2JLDA 4W4WA 5CTPA 4GFMA 4NM3A 4WSQA 3MESA 3DBQA 4UMRA 2GTMA 3E7VA 3R8ZA 1APME 4E73A 2WTJA 2ITOA 3R7GA 4CZTA 4FEQA 4YZBA 3SXRA 2RFSA 3VS0A 5CF4A 4PV0A 2E9PA 2W5HA 4ONAA 2ITVA 4BGGA 3RMFA 4KIQA 4HVDA 3ZZEA 4AZEA 5DBXA 4IVCA 5EG3A 4QQ5A 3T9IA 3W2OA 4X3FC 4FOBA 5CX9A 3RKBA 4CTBA 4DINA 2C6EA 2C5OA 3GCVA 5C4KA 4E3CA 4ZSGA 4BCQA 2J0IA 2GHLA 5HBJA 3PVBA 4JXFA 5E92A 4FGRA 5CYIA 4EK8A 5K0XA 4RIWB 4CT1A 4BCHA 5IH5A 4IB5A 2R3KA 3RVGA 4CFUA 1OIYA 4KBCA 4FZ6A 3I6UA 2FSOX 5JFVA 1UU7A 1NVRA 4O27B 3SD0A 3NNVA 4PDYA 3DKOA 4PL4A 3PIYA 2QONA 3PPJA 4C4JA 3NS9A 2H34A 3NRMA 3EB0A 4YJQA 3SRVB 2YZAA 2HW7A 4NTTA 3MH3A 5AR4A 3LFSA 3ZFMA 4PDOA 5IDPA 3MSSA 2X4FA 2XK7A 3MS9A 3OC1A 4W9XA 5ANEA 3I81A 5J95A 2WMAA 4FYNA 5GJFA 2ZV2A 2BKZA 4V0GB 5AM6A 4F70A 3CKWA 3G6GA 3OWJA 4Z16A 2XIRA 5AP1A 5LXMA 2ZB0A 4IM3A 1JLUE 3QYWA 3RAKA 4QMWA 3KREA 1XH5A 3VO3A 2WTVA 2CCIA 4RJ7A 5BVNA 3PSCA 4O82A 1WCCA 2XEZA 3ZM9A 1UNHA 3PE1A 4AW0A 3FSFA 4JRNA 3FMEA 2CDZA 4JQ7A 2O0UA 4EBWA 5KMJA 3RI1A 2G9XA 4I4FA 4O38A 5EHLA 4EOSA 5I3RA 4IAIA 2BAKA 4I6BA 1WBNA 3FMMA 4CVAA 5I9XA 1OKVA 5KE0A 2RL5A 3JPVA 3GCUA 4HYSA 5M4IA 3V51A 3OTUA 3ELJA 5M55A 3AC5A 4UN0C 4IEBA 2UZOA 3R2YA 1OIQA 4FEXA 3WZUA 4GV1A 5C27A 4D9UA 4E20A 5IU2A 1PXNA 2DWBA 4HZSA 4K2RA 1WBWA 5T3QA 4U40A 3COIA 1PMUA 5EHYA 3TKHA 4FKLA 3FC2A 3MVMA 4FNZA 4WBBB 1DM2A 2HWPA 4BDAA 5LVPA 4E1ZA 3MPMA 4NKSA 3IK3A 4GFGA 4O0VA 3W2QA 4IFGA 4MXXA 3QA0A 4BN1A 2WU6A 4BB4A 3RALA 3LXKA 3ORLA 4I41A 4DH8A 3CTJA 1EH4A 3FZ1A 2QC6A 4R7IA 3UVQA 3UPXA 3B2TA 3O23A 4QMUA 3NMUF 1ZMUA 2ZMDA 3QU0A 3DA6A 3DXQA 1ZYJA 3RGFA 2WOUA 3C13A 3EOCA 4GW8A 4W4YA 2YM3A 1G8AA 4M66A 2HK5A 4BBMA 4ZOGA 3DK3A 5LVLA 4G9RA 2HZ4A 4LOQA 1XJDA 4B0GA 3UZPA 4EJNA 4AW2A 1XHAA 4MD9E 3BYUA 1TQMA 4DGLC 4U42A 2ACXA 4CQGA 4XG8A 3PG3A 2G1TA 3UZRA 1YOMA 4WNKA 4ITHA 4X7QA 3ZO3A 3ZRKA 4X6QC 2QCSA 4RC4A 5M57A 4F64A 1H0VA 2QOBA 5JQ5A 2PVHA 4I4EA 3D0EA 2BIKB 3PSBA 4R5SA 3BYMA 5HI2A 4PL3A 3ZLSA 5J9LA 2JBPA 3LQ8A 4CGAA 5EHOA 3PRFA 5CF8A 5M51A 4TYJA 5HE0A 4LMUA 1W0XC 2WTWA 4QP9A 5L2WA 4TYHB 2WKMA 4FV8A 2PVMA 2R3QA 3O51A 3NYXA 3AT3A 2V22A 3Q53A 4FIIA 4UYAA 3RBWA 3WF7A 1WFCA 4D5KA 4H58A 5DI1A 4FBXA 5KBQA 1E1VA 1TQPA 4F0FA 2OG8A 5J1WA 5BVWA 2W4KA 4RZVA 3M1SA 1U54B 2PZPA 3GB2A 4IQ6A 4N57A 4BTKA 3ATTA 5CY3A 2OSCA 2EXEA 5E8VA 3NDMA 2QKWB 4F08A 4F7SA 2IN6A 4IE9A 4LYNA 2VTMA 3PYYA 5CXZA 5K4IA 4O0TA 2B52A 2YA9A 2QLUA 3I5NA 3GEQA 4XUFA 2OIBA 3SHEA 2QI8A 3VBVA 4F1MA 1O6YA 2YIQA 2IVSA 2BPMA 3C4ZA 5E90A 5TT7A 4C8BA 1R3CA 2QOCA 3PJ2A 2VWWA 3PLAE 4MXAA 2OH4A 3RPSA 2Y7JA 4BWXA 3HVCA 2YERA 3L9NA 2O5KA 3D4QA 4BC6A 4UZHA 2RKUA 5KMNA 4FVRA 4HGLA 4FSNA 4K18A 4PDPA 2JIVA 2UZWE 5HLNA 2UW6A 3FZTA 3JY0A 3LIJA 3CD3A 2UV2A 3ZO4A 4CV9A 4MD8E 1K9AA 5AP7A 5AV3A 3ZEWA 4QTDA 3EL8A 3MTLA 2VRXA 1J7UA 1Q61A 4BCGA 4FTUA 5FWKK 2G2IA 4EL9A 3QZIA 3NUYA 4I0RA 1GIIA 2C4GA 2O2UA 3PIZA 1SVEA 4E6CA 4ZMEA 2ZMCA 1YXVA 2OICA 4JG7A 3ZRLA 3CEKA 4FI1A 4WBOA 4HYIA 2CNUA 1YVJA 3TACA 4O7YA 4IAKA 4BTFA 2XK6A 2QOOA 2WMUA 3CCNA 2BIYA 3F7ZA 4IJ9A 5EYKA 1AGWA 3IDBA 1ZXEA 3V8SA 3TUCA 4GIIA 1XQZA 4OGRA 4K8AA 3TV4A 4G3CA 2VWXA 4YHJA 4FE2A 2RIOA 2CGXA 2XKEA 5FUTA 2QOKA 2Y9QA 3G0EA 2Y6OA 3SOCA 4DH1A 5EDPA 3I0OA 4XRJA 3CS9A 3IONA 2XA4A 4A9SA 5JK3A 4Y5HA 1ZMWA 1BL7A 4O2ZA 5ICPA 3HMIA 5KZ0A 1KE9A 2C3LA 3K3JA 4FKRA 4IWQA 4U9AA 5DPVA 3TIZA 3ALNA 4I92A 4OTRA 3UNJA 5FEQA 3ZCLA 5J79A 2X1NA 4X21A 4PF4A 1OPLA 2W96B 5IQIA 3PJ1A 5EK7A 3LCTA 3G2FA 2PVKA 4XH6A 2E9OA 3FLYA 4OBPA 3BU3A 3AC4A 4WG3A 2V5QA 3K5UA 3QLFA 5ETFA 4IB1A 1ZLTA 3VJOA 2ITZA 5JRQA 3EMGA 4PRJA 4M68A 4FC0A 5JFSA 4TYHA 4RX5A 2XK8A 5JH6A 4I6FA 4UMUA 5DOSA 3TUBA 2ITQA 4BHNA 4ZZOA 4CCUA 3PLSA 3UPZA 1VYWA 2A19B 4B9DA 3PP1A 4AX8A 3U6IA 3DT1A 4PNKA 5A4TA 3AMAA 1L8TA 5JMSA 3MH1A 3O7LB 4IC8A 4KS7A 3CY3A 4P2KA 1P4OA 4H1JA 4I93A 1PY5A 3ZXTA 2YDKA 1RJBA 4HGTA 3H9OA 4C38A 3TNPC 1PF8A 5TE0A 4BDCA 3FXXA 2PU8A 5BUIA 1XH6A 1Z9XA 3FZSA 4GS6A 4ZIMA 5JZNA 5DT0A 2R3LA 5TKDA 3DQWA 3A8XA 4CRLA 3Q9YA 3Q4UA 2ONLA 1OGUA 4PTEA 3DB6A 4O6LA 1XBBA 4TZRA 3OTVA 5CZHA 4ZSAA 3W10A 4S33A 4ANLA 2YM5A 5ITAA 5CALA 2GQSA 3DFAA 2QHMA 4NH1A 4EH9A 2WMBA 3GCQA 4ZK5A 4NTSA 2QOFA 3CR0A 3O2MA 4GT3A 4C0TA 5EKOA 4Q9SA 4BIEA 2YM6A 3KA0A 2QO2A 3NW6A 4RFMA 2BFYA 3FQSA 4RX7A 4F9CA 4YZMA 1R39A 2V7OA 3JXWA 5KHWA 4D2TA 3KMUA 5CAOA 4DLIA 3JUHA 4E5AX 4KIKB 4I5CA 3IPHA 2CLXA 2ZV8A 4AXAA 3R00A 2C6OA 5IQDA 1JPAA 4IAFA 3R73A 4M3QA 2X6EA 3QCSA 4L01A 4TN6A 5HVYA 3THBA 4DBNA 3SW7A 3TZ7A 4JBVA 5AV4A 2ZV7A 5G1XA 4A7CA 3OF0A 4A9UA 3DTCA 2W1GA 3DBEA 4QP7A 4J52A 4F9AA 3CD8A 4ZTMA 2ITTA 3V5LA 4FTLA 3RWQA 2VO6A 4IWDA 3OUKA 3ZMMA 1W8CA 1OI9A 5L8JA 4D1XA 5LVNA 3RPYA 5EQPA 4EC8A 4DT9A 1X8BA 3LCDA 4IAZA 5ETAA 4YLJA 2OJ9A 4C02A 5KO1A 4KB8A 4Z9LA 5DWRA 1OB3A 3GFEA 5CI6A 2XVDA 4IB0A 1PMNA 3KXZA 4ZTRA 5AX3A 3PVUA 4AN9A 5IQFA 3WYYA 3AC2A 2PE1A 3D5XA 1OECA 4F65A 2J2IB 5FGKA 2VV9A 4WA9A 1UU9A 4D5HA 2GS7A 2O65A 3BLHA 2HAKA 4AZWA 3ZTXA 5ACBC 4EK3A 4KA3A 5DRDA 3RK5A 5GHVA 3LMIA 5AUUA 5IQBA 4AA4A 4ZLZA 3DOGA 4V0GA 4FEUA 3U4UA 1FPUA 5F9EA 4Y85A 1YHSA 3LCKA 3E88A 5HG5A 5HEZA 1MP8A 3WBLA 3R02A 4EWHA 4IANA 5KZIA 1T45A 5AAFA 4G16A 3SOAA 5FDPA 3OCTA 4FV6A 4ANMA 3GNIB 4C61A 3LKMA 2CLQA 3GQIA 4NK9A 5CAUA 3RPOA 1H1RA 3AC3A 4GK4A 4YLLA 3BIZA 4IX3A 2BDWA 3ZDUA 3OD6X 3LMGA 3QX4A 4YJSA 4EHVA 5K5NA 5EI2A 3A60A 2Z7RA 3I6WA 3TXOA 5KNJA 2PZ5A 1H00A 5DGZA 4IVBA 2A1AB 2GFSA 4LRKA 4OLIA 1RW8A 4A4XA 2BTRA 2JDRA 4TWOA 4OT5A 4ACDA 3O8TA 3SVVA 1I09A 3NUSA 4BGQA 1KOAA 3R7UA 5BX0A 2B9JA 4O81A 3ERKA 1A9UA 2XM8A 4ZTSA 4AT5A 4DTKA 3ROYA 4DFZE 1A06A 2P55A 4YBKA 2OBJA 3DAEA 3RCDA 3C9WA 2JKMA 3GFWA 4GT4A 3KCFA 3I1AA 4TRLA 5DYJA 2P2IA 3DAKA 4AP7A 3KU2A 4J1RA 5FDXA 3SW4A 4FIHA 1CMKE 4EH4A 1ZARA 4ZSEA 2C6IA 4BYJA 3PWDA 1BX6A 1H08A 5JZJA 5CZIA 5A4EA 1GY3A 1GZ8A 4GK3A 3SC1A 4QNYA 5IA5A 2NO3A 3R30A 2XNBA 3F5PA 1KOBA 1PHKA 3HUCA 4L44A 3VUHA 1P5EA 2PVFA 3MJ2A 4DTBA 5AAEA 2XNNA 4OUCA 4J99A 4RQVA 3R9HA 4AFEA 5CEKA 2GNJA 2UZNA 1Q97A 5FXQA 3PA4A 3V5JA 4NKAA 3FAAA 3V5QA 4AGWA 4EOPA 2O8YA 2PZRA 4MXCA 3U51A 2IZTA 1P14A 2BDJA 4AQCA 2FB8A 3OUNB 3IW6A 1XH4A 3FMJA 4GYIA 4J8NA 4QP6A 4XRLA 2W1EA 3UMXA 4D0XA 5HORA 4QMOA 3CTQA 1H1SA 4BDIA 3QTIA 1SNUA 1BKXA 3VF8A 2ZM1A 5DHJA 3GC7A 3UIBA 5A9UA 3QD4A 2Z60A 3U8WA 3D5UA 4EEVA 5IQAA 2BTSA 2QVSE 4YZDA 4RIOA 4F63A 1SZMA 2I0YA 4C4HA 4GMYA 3UOLA 5C4LA 2WTKB 3FZPA 1XO2B 5F94A 4USFA 4FK6A 1ZYLA 4QP3A 4FKSA 4OAUC 4FNYA 4E4NA 3DDQA 3GCPA 3W2SA 4EH6A 3TNQB 1H1PA 3BRBA 2XZSA 4EYJA 4QQJA 2BUJA 2JBOA 3UQFA 4F0IA 5FBNC 3QBNA 4BI1A 1SYKA 2VWYA 3JY9A 4G3GA 5EW3A 5J7BA 2Y8OA 1QPEA 3S00A 4E6DA 4YZCA 1NT2A 3LXNA 4Y72A 4OTGA 3QRJA 3QQHA 3QTZA 4EORA 1NA7A 4GK2A 2WMSA 2A2AA 5E1EA 4D58A 4FSWA 4FSQA 2P33A 4EBVA 3TUDA 4GIHA 2YCQA 3E64A 2CKEA 2DQ7X 2VTOA 1A48A 5DH3A 3AXWA 3UE4A 1Z57A 3R2BA 3LJ1A 3VIDA 1P4FA 2R9SA 2VX1A 4F0GA 3L1SA 1WBPA 4BL1A 3A7HA 3FLSA 5FP6A 1IAJA 2BROA 3IECA 4AGUA 4F9YA 1Y8GA 2R3JA 3LW0A 3FJQE 3Q4CA 2WTIA 3QTRA 3R8MA 3H9RA 4EOIA 3RAIA 5HNIX 2X9FA 5BYYA 1R0EA 1DAWA 3D7ZA 5AJQA 3GC0A 2QU5A 1PXLA 2VTRA 3ORNA 4RT7A 5JN2A 5CWZA 4BCPA 3MPTA 5H9BA 4LM5A 3TZ9A 1QMZA 4RIYB 4D4VA 3NYVA 5I4NA 3N51A 3VUKA 4DG2E 2Y4PA 3R6XA 1ZRZA 4AW1A 2C0OA 3WZEA 3QX2A 3LPBA 4RWIA 4QYEA 3GCSA 2OJIA 3WARA 3Q04A 2GQRA 4EOJA 4PMSA 5BPYA 3ZBFA 3OOMA 3P0MA 4C4GA 5BUEA 3C4WA 4FKQA 3UGCA 2VTPA 4EI4A 3RPVA 3ORTA 1K2PA 5AIKA 3TNWA 3DK7A 4G6OA 5KKRB 2YM8A 4XOZA 4H3BA 3NVMB 3UVRA 2VUWA 4O7WA 3MB6A 4FODA 3MY0A 3OMVA 4E4XA 4U97A 3TJDA 4N6YA 3UQGA 3AG9A 5DR9A 5ANDA 3DJ5A 4BWKA 5KMKA 3DPKA 2R3RA 1R78A 4FTJA 3WE4A 2UZLA 4DEBA 2GQGA 3FPMA 2VZ6A 4FL1A 4NM7A 4RLLA 3OG7A 3BELA 5AV1A 1GNGA 2F7ZE 5ANKA 5CEMA 4FNXA 5AV2A 4F4PA 4A06A 2OWBA 1O9UA 2YFXA 4QYGA 4R3PA 4DA5A 4FV3A 2R3MA 4HYUA 3QL8A 4CLJA 1YI3A 1ZY5A 2P0CA 1ZYSA 3LCSA 4IIRA 3I7BA 4QMSA 4ZLYA 3FL5A 4FSUA 3QQFA 5F20A 3ZC6A 2ZVAA 4QP4A 1ZOHA 2X8DA 3Q6UA 4YC8A 3I5ZA 4C58A 2ZM3A 4HGSA 4KIOA 5D1JA 3D7TB 3ORZA 5J9ZA 1YW2A 3HMOA 4FT7A 5DR2A 3R9DA 4EH7A 3G9NA 1BUHA 4EC9A 1IG1A 2R7BA 5LWMA 3VHKA 4FL3A 5IQGA 4GFOA 2CGUA 4NUSA 5IA2A 5CQUA 4JIAA 3W1FA 5AWMA 4TNDA 3KXNA 4U81A 2R3NA 3P78A 4MBIA 4XP0A 4G34A 4KNBA 4I21A 1OL2A 4D2PA 3R7EA 5F1ZA 4XMOA 4UY9A 4WNPA 3H0YA 5E9EA 3PRIA 4U7ZA 4BDHA 3MIYA 4UALA 4CTCA 5AADA 4F7LA 2CKPA 5KMOA 2IPXA 3ROCA 3DK6A 4AZTA 5CU6A 3KK9A 2IJMA 2KULA 4CEGA 3R04A 1JVPP 2EU9A 3G0FA 4UMTA 5C01A 3FI3A 3NR9A 2XBAA 2Z7LA 1H1QA 1OPKA 3GP0A 2B54A 2CCHA 3KVWA 3DJ7A 3RINA 4NM5A 2YLFA 3FSKA 3IW5A 5I9VA 4P4CA 4U45A 2PWLA 3HNGA 2V7AA 2RGPA 2WAJA 1GAGA 2OIQA 5B7VA 4PP7A 2LAVA 4FSTA 5J5TA 3V6RA 1RQQA 3WILA 2CPKE 4OTFA 4QMXA 4RVKA 3P1AA 4DH5A 3QD0A 4LL0A 1JSUA 1H24A 4JQ8A 3TL8A 1JKLA 3BE2A 5EDRA 4O7NA 4XG4A 5CNNA 3ANRA 2UUEA 4ZTHA 5KKRC 4EHZA 1LR4A 4QMPA 3NYOA 2HCKA 1DI8A 3Q4ZA 3OY3A 3FZRA 3G5DA 3ZEPA 1JKTA 4YJUA 4IADA 4PMPA 1PXJA 3GENA 3E3BX 4QYYA 2PVYA 4FTTA 4YNEA 4YZNA 2PHKA 4D28A 2RG5A 3KMWA 3QTQA 5HGIA 4U3YA 4HGEA 2NPQA 3QC9A 4UEUA 3HDNA 4RIXA 2ITYA 3EWHA 4FZFB 3SDJA 4YUQA 5M4UA 1DI9A 4BR3A 3QWKA 4PX6A 4TKSA 5LJJA 3QKMA 5EQYA 4USDA 3ODYX 1KUTA 4HPTE 3V8WA 2WQBA 3LM0A 4QYHA 3TKUA 1H07A 5KCVA 4XX9A 4WUAA 4Q5EA 3QC4A 4RC2A 3D5WA 3S95A 4EONA 1GZKA 5JGAA 4C35A 3DNEA 4O0YA 2YDIA 1MQBA 3BGPA 2QG5A 1PMEA 5A4LA 4IZAA 3MH0A 4PMTA 3ZH8A 2PVLA 3M42A 1T46A 3PG1A 3W18A 3HLLA 2C6LA 4FKJA 4X3JA 2R64A 1ZYCA 4FKVA 4YO4A 4B7TA 1YI6A 2RFEA 2X4ZA 1WBSA 3PXQA 4BDGA 4EZ5A 4F6WA 4KD1A 4F99A 2H8HA 4Q2AA 2J0LA 1ZY4A 3TV6A 5EW8A 3ETAA 4GU9A 3DB8A 3KXMA 5D7VA 3RK7A 5HHWA 2OIDA 3R22A 4KUJA 4G3FA 2YJSA 1BI8A 3DJ6A 3H3CA 3F2RA 3E5AA 3VRZA 3PFQA 1JQHA 5HG7A 4O22A 4TWPA 1ZWSA 2RSVA 2C47A 3LLTA 2PSQA 4BCKA 4X6RA 5AUWA 3FHIA 4UXLA 3UOJA 4ZLOA 4O7VA 2Z2WA 4FMQA 4XG3A 3OT8A 5BYZA 5E8YA 4BICA 2F2CB 3ZUUA 4O7SA 4D2SA 5JEBA 4O1PA 4DC2A 4U3ZA 3UJGA 5A14A 5JGDA 1GIHA 4CMUA 3LLAA 2ETRA 3QZHA 5DG5A 3FYKX 4L7FA 4AA5A 3K3IA 2GHGA 2J5FA 1R0PA 2WPAA 3EQHA 4OW8A 3NUAA 4QPAA 3PPZA 3R7OA 3TNHA 2W9ZB 2RFNA 4WSYA 4HW7A 3IGOA 2J7TA 1XR1A 4RBLA 4C7TA 4R77A 3SG9A 4D2WA 5F4NA 4L42A 1H1WA 1FMOE 2QO7A 4DE4A 2WOTA 2X8EA 3LFAA 4EZ7A 5HIDA 5IPJA 3CQWA 2CHLA 4IDTA 4D2VA 4FF8A 1QL6A 3UBDA 3JR1A 2HELA 4IJPA 2X7FA 3TJCA 4ZY4A 4C62A 3QKKA 3V6SA 4D4YA 3TDVA 5IA4A 5K0KA 4AU8A 4TPTA 3RZBA 3PIXA 4ZZNA 3VF9A 2XNPA 4JT3A 5CF6A 1UV5A 2W5AA 4O6EA 3BV3A 5LVMA 1ZOEA 2XM9A 3NGAA 5J1VA 3TTJA 4XHKB 3LOKA 4YPSA 3S2PA 3MVHA 4C4EA 4EOLA 3NNWA 4P5QA 4X2NA 4S30A 3GOKA 4JDJA 2AUHA 2ERZE 4EK4A 3BLQA 4EYMA 2C68A 3REPA 4QMQA 2XKFA 4AWIA 5CI7A 3MFSA 3CXWA 5EW9A 3LZBA 4A07A 3JYAA 5D9HA 1IAHA 3A62A 4R8QA 4DFUA 4X3FA 1PXOA 2J90A 4YPDA 4JI9A 4O0WA 4GUBA 1FOTA 3CC6A 4Q9ZA 3EQRA 2GPHA 1XWSA 1FBNA 1OPJA 2B53A 4U8ZA 2A0CX 3CBLA 1GZNA 3MVLA 3MY5A 5H2UA 1TVOA 2F7EE 3P7BA 4EKKA 4USEA 1P2AA 4CFXA 1H25A 3NIZA 3KULB 1VR2A 5FBOA 4CQEA 4F6SA 4RFYA 2F2UA 5AP3A 4EWQA 4FTMA 1QPCA 3F3UA 3OS3A 2UVXA 3HDMA 4TNBA 4GSBA 4LI5A 4YTHA 4ZEGA 4I6QA 2F4JA 2R3FA 3EZRA 2VAGA 3HMMA 3VS3A 3O8PA 5FXSA 5HTIA 5ETCA 4DEAA 3G33A 4FEWA 3ID6C 3TG1A 3VS6A 3ZO1A 5HIEA 3DDPA 3KB7A 3TTIA 2ZDTA 3BHYA 5B2LA 3MPAA 5LMBA 2PMLX 4FIJA 4EK5A 3DBDA 4ASEA 1SMHA 3BGQA 3KULA 1YWRA 3UO4A 3L8VA 4KIKA 3EIDA 5BMMA 1ZMVA 2CKOA 4P90A 2RF9A 5CENA 4E4MA 3RHKA 5HE3A 2YM7A 3C0IA 1CKPA 2H6DA 4G3DA 3FXZA 1PMVA 2DUVA 4ZY5A 3O8UA 2OXDA 3CGFA 4GYGA 4YBJA 4DT8A 2QOHA 3CE3A 3HV5A 4RIWA 3E93A 4IVAA 3BHTA 1KV2A 2OZOA 4BTMA 3R9OA 1ATPE 3QD3A 2OLCA 3TEIA 5DR6A 5BUJA 4FX3A 2XB7A 2JAMA 3QGYA 3W16A 3TT0A 5DA3A 1S9IA 3IOPA 5JGBA 1OL6A 4FV9A 3LHJA 3OBJA 3KRJA 2JIIA 1WVWA 2XNGA 4CYIA 3PY1A 4XG7A 4KINA 4EHGA 3DBCA 3CJFA 1M2RA 1UWHA 5I5ZA 5IF1A 4R78A 4YU2A 2GU8A 2IVVA 4R3CA 3BQRA 3H9FA 3QXOA 3RZFA 4CMTA 5I9YA 4L67A 3S3IA 4FTOA 4Z7HA 3IOKA 3HUBA 4MXYA 1J91A 4FTCA 4O0SA 4IAYA 2NP8A 3OROA 4ACCA 4JBPA 3UTOA 4ZTLA 3MY1A 1M17A 2GNIA 3AGMA 4NW6A 3NUUA 4YZ9A 3HV3A 5AM7A 1XBAA 3MH2A 3NX8A 3CKXA 3EN4A 3EYGA 3GC8A 2YCRA 4XV3A 4BDBA 1OUYA 3UG2A 2UZBA 4JDKA 5LVOA 1FVTA 4LGGA 4L43A 4Y5QA 4APCA 3ZBXA 4IXPA 5HX8A 5K9IA 5GNKA 2XNMA 4UMPA 3Q9WA 2WQOA 3FMHA 2BHEA 4CRSA 4DFYA 5CEPA 2X2LA 3QQGA 2YM4A 4J96A 3HV4A 5CSVA 3F5UA 3MN3A 4ANNA 3GI3A 4PPAA 4XV2A 4FT5A 4R6VA 4JG8A 4DEGA 1G3NA 3LAUA 4MTAA 4LUDA 2BHHA 3MYGA 2CGWA 2J5EA 3EKNA 4CNHA 4Y8DA 4HVSA 4M84A 5D11A 3PJCA 5CEOA 4XEYA 4A4OA 4DCEA 1HCKA 3QQKA 2NRYA 2QO9A 2ETKA 5AP4A 4M0ZA 2YLEA 4ANQA 2VTIA 4ZS0A 3NUPA 2WEIA 5LOHA 5JFXA 5EM7A 2J0MB 3V5WA 3PXKA 1PKDA 1OL1A 1OMWA 3Q52A 4MBLA 5AP5A 3ZZWA 4YP8A 4IBMA 5ANIA 4AG8A 4CT2A 1OKWA 3W32A 4YJOA 3RM6A 3R1SA 1VEBA 3ZUTA 2UW9A 5JQ8A 4O7ZA 2BZJA 3GC9A 3O71A 4M97A 4MWIA 1SVGA 2YN8A 2E2BA 2XRUA 3ORIA 4A9RA 4FYOA 1LUFA 3K5VA 2UVYA 3ZSGA 4M14A 4IWPA 2YABA 4EZ3A 4RJ3A 3VN9A 4K1BA 4XYFA 4N0SA 3EH9A 3G9LX 4MX9A 2IWIA 2B55A 3EN6A 3BHUA 2RFDA 1W7HA 5KBRA 5A6OA 4L46A 5T6KA 3U87A 1FGIA 3VW6A 3QRKA 1BL6A 3COMA 4I0SA 3HEGA 1ND4A 3OBGA 4FTIA 3UODA 3PWYA 4KS8A 3C5IA 2YZLA 2F57A 2FSLX 1V0BA 4MF1A 2OZAA 4XG6A 4EH8A 2BRHA 3LM5A 3SKCA 1URCA 3DTWA 2ZJWA 4CKRA 4Y46A 4LQMA 4YURA 4NWMA 3Q32A 4GU6A 4IM0A 4X2GA 5HG9A 2R3IA 3F3VA 3QGWA 3R21A 3QQUA 4FVPA 2VWZA 3F69A 2WIHA 1F3MC 3OVVA 4B8MA 4EOQA 2WMWA 2UW0A 4JDHA 5BVFA 3ZLWA 1SM2A 4HJOA 3FMDA 4I23A 2XJ2A 3BX5A 4FT0A 3I60A 5FM2A 4LL5A 4CFWA 4S31A 4RVTA 4PTGA 5DIAA 3VS1A 2XS0A 3IKAA 2B9HA 3QAME 5AX9A 2YIRA 5CSWA 5A6NA 5I9WA 2W7XA 4AFJA 5AUXA 3TI1A 5LCJA 2YWVA 2W1IA 3R28A 4D0WA 2Q83A 2XCHA 2WZJA 3D5VA 3HGKA 3QHWA 4QMYA 1KWPA 1PYXA 3W2CA 5FEEA 3VQHA 3QWJA 1UNGA 4UXQA 4HZRA 4UYNA 2JKOA 2XBJA 3O0GA 3IGGA 3LFBA 4FTNA 3EFWA 4FKPA 1RDQE 4JAIA 4MWHA 4KSQA 4AE6A 5IZFA 4C4FA 5FEDA 5CT7A 3PP0A 3AT4A 3LVPA 4KRCA 4QMTA 5H8GA 2C6DA 3OXTA 3VW8A 4QMMA 3DKGA 3BPRA 3LFEA 2B0QA 4LOPA 3CPCA 2OI4X 4LV8A 4RWLA 1KE8A 4C2WA 4E4LA 3EFJA 3IS5A 4LUEA 5CNOA 3UIUA 5GIPE 1ERKA 3U6JA 3BZ3A 5J87A 4L45A 3GQLA 2E9NA 2WMXA 3HV6A 3KY2A 4PPBA 4FTRA 3A7FA 5HBEA 3C0GA 2R3GA 3VBQA 3IW7A 5AAGA 1S9JA 3H4JA 2CNQA 4RJ4A 3ZC5A 4FV2A 4CFMA 5AR5A 4Q5HA 4L6QA 5D12A 3QD2B 3U55A 5EI6A 3VUIA 1DAYA 2W1ZA 3D9VA 4ENYA 5IMXA 2LGCA 2XH5A 4BKZA 2YIYA 4XBRA 4K9YA 4CG8A 4ZP5A 3CLYA 5TR6A 4JX3A 3AMBA 4R1YA 2JFMA 4WHZA 1REJA 4YO6A 2Z7QA 3BBTB 3ALOA 4G2FA 3F7WA 4RJ8A 5CEIA 2C5VA 2ITUA 1CSNA 2XK9A 3NUNA 5DE2A 3KGAA 2R2PA 2VWUA 1FQ1B 5CU3A 4QTAA 3SAYA 4NL0A 5C8KA 2CNVA 3MFTA 1Q8UA 4MEDA 2I0HA 1OITA 5HNBA 2J0JA 3II5A 3UNZA 3FE3A 3SA0A 2UVZA 3EHAA 4XV1A 5LCKA 4IACA 4JR3A 1KSWA 4YHTA 3G6HA 5HZNA 1O6KA 2FH9A 2DS1A 2X7GA 5AUYA 4IB3A 4NFMA 3VUDA 3WOWA 1V0OA 3ZYAA 4CV8A 4DEIA 2PPQA 4HPUE 4W9WA 4E26A 4W8EA 1IRKA 1YDSE 3PY0A 4MD7E 1WZYA 2R0UA 4FIFA 5BVKA 1WVYA 4CKIA 3A8WA 2YCSA 4MXZA 4V04A 4GVAA 3R8UA 2IZUA 5IA0A 4O7RA 2FO0A 4WOVA 4J7BA 1QCFA 3ORMA 3SV0A 3OP5A 3A4OX 4G9CA 3UO5A 2R3HA 2HWOA 1OBGA 4C4IA 1WBOA 4E6QA 3R7YA 1Q4LA 3B8RA 3DKFA 4FKOA 3UMWA 3EFKA 1QPJA 3BEAA 5LWNA 2X8IA 3UQCA 5M07A 3KL8A 2QKRA 3R8LA 1PRYA 3EQBA 2PVRA 3GT8A 1YWNA 2HY81 1GOLA 4OTWA 2JDVA 2QG7A 3WZDA 4GEOA 2R4BA 2B9FA 2GSFA 3ET7A 3F82A 3EQPA 3MBLA 4GH2A 3VVHA 5JT2A 4XBUA 5AIRA 4L8MA 2Z7SA 1J1CA 2WELA 3H30A 4YLKA 3I4BA 3KRLA 3EYHA 5DN3A 3LQ5A 3OXZA 4IZ5A 4L53A 4M12A 4YJRA 4ZS4A 2O63A 1W83A 5CSHA 2WXVA 5CU4A 4HOKA 4ANOA 3P7CA 3WF6A 3F3TA 1YWVA 2AYPA 3ULZA 2C1BA 3FI2A 5ANGA 4EQCA 4JVGA 2VGPA 4FSZA 4NSTA 3NVKI 5J5SA 2JITA 4BCMA 4O0XA 4EUTA 3SGCA 4BIBA 3SQQA 5IEVA 5KX8A 2ONLC 1JKSA 3OWKA 1J1BA 4ALVA 3WIKA 4ZJJA 2JKKA 4R7BA 2WTCA 3QTWA 4YJTA 2EVAA 4KAOA 4S2ZA 2XUUA 1F5QA 5E8TA 4EOMA 2A27A 2C3JA 5FXRA 3M2WA 1UVRA 5HCYA 3VS2A 1XH9A 2V62A 3Q9XA 4FV5A 1E9HA 4ZY6A 3V01A 1WMKA 4TW9A 5HNGA 3VC4A 3ZOSA 1NW1A 3GXLA 5CU2A 3EL7A 5L8KA 4O21A 2VTAA 2IZSA 1XH7A 2JFLA
chains in the Genus database with same CATH superfamily
3C7QA 4GL9A 2UW7A 3F2NA 4JRVA 4XG9A 4I0TA 2BRNA 3U6HA 5DVRA 4RPVA 2BRBA 2X39A 4PWNA 4FT9A 4OAVB 2BVAA 3D15A 3T8OA 2Q0NA 5CANA 4AZVA 4PQNA 5HVJA 3BU5A 2VTJA 2UZTA 3E87A 3P86A 5HBHA 2ZYBA 1JWHA 2P2HA 4Y73A 4A9YA 5HKMA 3HMPA 4KWPA 2HYYA 3MI9A 4JNWA 4MHAA 4D1ZA 3BCEA 3OCGA 3FBVA 4CCBA 5CSPA 3TV7A 3VUGA 5BVOA 1WAKA 3OW4A 4V01A 4GKHA 1UNLA 1XH8A 3PE2A 4OTQA 4XP3A 2QLQA 3MIAA 4DAWA 2W1CA 4RQKA 3Q5ZA 4ZSLA 4OR5A 5M4FA 2FGIA 4BCNA 3FKOA 3DS6A 3NSZA 4TYEA 2J0KA 3FY2A 1WBVA 2GNGA 2BMCA 3QHRA 2O64A 1WVXA 2B4SB 3NUXA 4K33A 1Q5KA 1J3HA 2XYNA 4OTHA 2CGVA 4BVUA 4BZDA 4BDEA 4DCAA 3ZSHA 3VUTA 3QCYA 3U9CA 3ORXA 4M69A 2OJGA 3QUPA 4ZTQA 2OFUA 3FMLA 3P5KA 4CG9A 2VWVA 5M09A 4LGHA 4AXCA 3H0ZA 4LMNA 5L6WL 5A46A 5AR2A 4LV5A 3KMMA 2C69A 2YIWA 5AUVA 2I1MA 1PXPA 5M4CA 2WFYA 4S34A 3V5TA 3BHHA 1H4LA 4CLIA 5J7HA 3C50A 3B8QA 3DZQA 4O84A 4K11A 3G51A 3NLBA 4EH2A 4AT4A 2W5BA 4C3FA 3ACJA 3KVXA 3AGLA 3WF5A 5EQEA 3DGKA 4WNMA 5EM6A 4HVHA 4AN2A 3QUDA 4O4FA 5FRIA 4FV0A 2BALA 3RJCA 1Q41A 5L6OA 3ZUVA 2VTSA 5AFVA 2HZIA 1M7NA 3V8TA 1RE8A 1YOLA 4N70A 4DDIA 1U4DA 3QXPA 4E7WA 1CM8A 4RMZA 4Z3VA 1J7IA 5DFPA 3ZS5A 2VTQA 3I7CA 4BI2A 3D2KA 3DCVA 3QCQA 2GFCA 2VNWA 3QTSA 4C33A 2BILB 2Y4IB 4D55A 2YAKA 2Z02A 3FLZA 3TCPA 3WIGA 5IISA 3F5XA 5EM8A 5HO6A 4Z55A 3VBWA 4DFXE 2WMRA 4C59A 1IEPA 3HYHA 3R1QA 5AA8A 4I1ZA 3EN7A 4RRVA 5JFWA 3FC1X 5L2QA 4OBOA 3R1NA 5GZ9A 3AT2A 4BIDA 3C4EA 3OCSA 2XF0A 4X0MA 4DEDA 2YHVA 5HOAA 4G6NA 3F61A 4ZTNA 4LRMA 4MAOA 4F9BA 3IDCA 3SXFA 2HENA 4KKEA 1JNKA 4L3JA 4QMLA 2UW5A 3EQFA 3QRUA 2JDTA 3UOKA 2I7QA 3QUEA 5A54A 4BGHA 5E8WA 3CY2A 4XG2A 5IQHA 4QPSA 4KBKA 4YJPA 3VNTA 4IWOA 4EQMA 4DFBA 4QRCA 3L8PA 4QDEA 5B0XA 2KTYA 2VU3A 3ZFXA 3UC4A 4FTKA 3EN5A 2OGVA 4FV7A 3OWPA 3VS7A 4B99A 3HRFA 2H96A 4ALWA 4GKIA 4TWNA 3EKKA 3UYSA 1LPUA 5HE1A 1Q8YA 1Q99A 3TM0A 2GS2A 3AOXA 4V05A 3P79A 5AV0A 5L2TA 3S1HA 3C5UA 4ZJVA 5FG8A 2PE0A 3Q6WA 3C4XA 2UW4A 1U5RA 3HRCA 1Q8WA 1V1KA 1Y6AA 2XK3A 5I3OA 4D2RA 1Q3WA 3WF8A 3MV5A 3UIMA 5K4JA 1HOWA 2GMXA 5AA9A 2HXQA 4L7SA 3DY7A 4PDSA 4TTHB 1MQ4A 1Y8YA 3P4KA 5CVGA 3RAWA 4DHFA 2XJ1A 4FT3A 4PTCA 4DH3A 3DXPA 3WZJA 1SVHA 1YXXA 3E63A 1OUKA 4JL9A 4E93A 5EH0A 1FGKA 4KKGA 2F9GA 1PJKA 5IH6A 3QZFA 3FPQA 3ORKA 2EB2A 2BKKA 4O83A 1HCLA 2X0GA 3SLSA 4RX9A 4KRDA 4BHZA 2Z8CA 2WNTA 4EK6A 3EQDA 2GDOA 5EDQA 2EWAA 1NVQA 2OJFE 3SG8A 2BR1A 2C6TA 2JD5A 4NT4A 2Y0AA 1MRYA 3NPCA 4AGCA 4FG7A 1UU3A 3P08A 3RP9A 5HD7A 4RIYA 1PKGA 2JC6A 2OZAB 1W84A 2IVUA 2ZB1A 2XIXA 3COKA 3CSVA 3BI6A 3JS2A 2WU7A 3POOA 4QT1A 1OL5A 4AOTA 4NIFB 4KBAA 2W1FA 4U80A 3S4QA 3O7LD 3AD6A 1U59A 1PXMA 2BZHB 3Q5IA 4HCUA 1KE5A 3R0TA 4RA5A 5EFQA 3RTPA 4X3FB 3UZTA 2PK9A 4IDVA 1V0PA 3R9NA 4AZFA 5I9ZA 5E4HA 3NYNA 4UBAA 4B6LA 2HZ0A 3KXGA 5CU0A 3QRTA 4DGOA 4NFNA 2XIKA 2BZIB 5EI8A 4BDJA 4PPCA 4BI0A 4CXAA 3R1YA 1Q62A 4HCTA 3A2CA 2J51A 3P23A 3WZKA 4JS8A 5M56A 2R5TA 3MFUA 3F2AA 5AUTA 3IO7A 4YC3A 4O7LA 3BWFA 3F3ZA 1VZOA 4O96A 5L6PA 2WEVA 1F0QA 3LFCA 4YTCA 2VO0A 3UVPA 4UWBA 4U79A 3OHTA 5B2MA 3QKLA 4C3RA 3AC1A 4QMNA 4O2PA 1KV1A 3PA3A 4WIHA 3NCGA 4BDDA 5E8SA 3R9RA 4RC3A 2OO8X 5EOLA 4O0UA 3ITZA 1URWA 3OW3A 4AS0A 4CMOA 4GRBA 3HP5A 4BDFA 4NW5A 4O1OA 3TWJA 5K3YA 2XEYA 3COHA 4H36A 4MCVA 5C1QB 3KRRA 4BY9E 2BFXA 3ZM4A 4MYGA 3KF7A 4RWKA 3ODZX 4DFNA 4GJ3A 5LMKC 3BL7A 3PXYA 5E8ZA 3TZ8A 3L9MA 4H39A 1PW2A 4JJRA 5GZAA 2X2MA 4FKTA 4M69B 4UZDA 3IW4A 5LMAA 5H3QA 3RNIA 4RLKA 5AEPA 1FMKA 4DHJA 2ETMA 3WYXA 2QODA 3GOPA 1M2PA 3LXLA 4FSYA 4FIGA 4TWCA 2XKDA 3IW8A 2PUPA 4LG4A 4MXOA 3FLNC 2WMQA 4FR4A 2FYSA 3H10A 4YSMA 4AGDA 4FL2A 4ANBA 4L3LA 1UKHA 4U41A 2J50A 4AF3A 3AD4A 4IMYA 3VJNA 4AW5A 5HU9A 5AR7A 3ENHA 4C37A 3BLRA 3DKCA 3GUBA 2X81A 3P7AA 4MNFA 2Y6MA 5TF9A 3AC8A 3A61A 5M06A 1YOJA 4ID7A 3HV7A 2W1DA 4U0IA 3Q3BA 4TYGA 4BKYA 3ZFYA 4YHFA 5C9CA 1YRPA 4CZUA 3Q9ZA 3LXPA 3FMKA 2JAVA 5E8XA 1YHVA 4FKIA 4JAJA 2PE2A 3FEGA 1OL7A 3GU7A 2BRGA 4RWJA 5HICA 3CPBA 2WD1A 2YITA 1Q3DA 4FUYA 4YC6A 2EXMA 5AUZA 4BKJA 3BV2A 2C5YA 3V3VA 2SRCA 2HIWA 4ACMA 2CN8A 2XMYA 5BQ0A 3L8XA 3MVJA 4W4XA 5KMIA 4RGJA 2DYLA 3D14A 2UZDA 4I94A 4IC7A 2W05A 5HTBA 1JSVA 5CT0A 3HAMA 4OTIA 3RK9A 3KEXA 3T3UA 3FKLA 2VTLA 4AOJA 3FLWA 3PZEA 3KCKA 5I9UA 3W8QA 2OF2A 2VX3A 5BYLA 3G90X 2WHBA 4J97A 2FSMX 4D1SA 5JRSA 4YSJA 2AC3A 4QMZA 2X2KA 4NEUA 2I6LA 4ACGA 5IA3A 4MNEB 4FTAA 3R7IA 1PXKA 3EQCA 3PY3A 4QOXA 4TXCA 2PYWA 3TNIA 4AXEA 3O50A 4FVQA 5FTQA 3V5PA 2Q0BA 5DT4A 4XOYA 3PZHA 4C2VA 5DLSA 2C3IB 2HXLA 4IX6A 2OU7A 2QNJA 3PSDA 5HG8A 5KUPA 4D9TA 5F95A 3I79A 2XAMA 4C36A 5I0BA 1MRVA 4IH8A 1NXKA 4O0RA 4WKQA 4GJ2A 3VQUA 4ERKA 2ITWA 2W4JA 3VBXA 4CYJA 1FVRA 1I44A 4YNOA 4OTDA 3ZLXA 1FVVA 4R5YA 5HIBA 2I0VA 2ZV9A 3ACKA 3LFNA 3AD5A 4DYMA 1XMMA 3VRYA 3MWUA 4BDKA 2J9MA 5HO8A 2X0PA 4LGDA 2W17A 3I0QA 4ASXA 5IEYA 4AN3A 3LMHA 3N4TA 2ZOQA 3UDZA 3ATSA 3DAJA 5C03A 4DFLA 3W0RA 2I0EA 1NVSA 2PMOX 3IQ7A 2IO6A 5AP0A 2WTDA 2GNLA 5JKGA 2C6MA 2PMIA 3KRWA 2C30A 2PUUA 3DBFA 4U44A 3DNDA 3NW5A 3KK8A 1YQJA 3ZDIA 5BVDA 5HU3A 3Q96A 5IEXA 5GINE 2BAJA 4BCFA 5L2SA 3W0OA 4L3PA 3SRVA 4ASZA 5C26A 1H28A 3UP2A 3BHVA 4H3PA 4J8MA 3POZA 3ENMA 5T68A 4BYIA 3HECA 5IMEA 4WD5A 1CKIA 1TQIA 5CS6A 4DLJA 3NW7A 5ANJA 3UNKA 3ZXZA 3W2PA 4CD0A 5CVHA 5HLPA 3KFAA 2OXXA 3GU4A 2B7AA 2JKQA 3OWLA 5DT3A 4M0YA 4K6ZA 3Q2MA 3T3VA 4MH7A 3QQJA 2C3KA 5E8UA 5HX6A 5BVEA 3Q60A 5L4QA 4BJJA 1K3AA 2GS6A 2XYUA 3MTFA 4TT7A 4DF3A 5M53A 4FSRA 3KXHA 3PJ3A 4X2KA 2XARA 2PVJA 3A99A 4JIKA 4RJ6A 4QP2A 3FWQA 4II5A 3UC3A 3W33A 2FA2A 4AOIA 4C34A 1XBCA 1LEWA 3SXSA 3BYSA 4EKLA 4QO9A 2V55A 2VWBA 1VJYA 3FI4A 5BNJA 1YXSA 4A9TA 3OT3A 4EHEA 4G17A 4X2JA 3FV8A 4HNIA 4FSMA 4TY1A 2GTNA 2BAQA 4F6UA 2C5NA 3FZOA 3KF4A 4F1OA 4IX5A 4M67A 5EOBA 1U5QA 3UYTA 3PTGA 2V0DA 2WQMA 4MQ2A 4FA2A 4EUUA 2GNHA 1PXIA 3PUFC 5IA1A 5GZ8A 2PUNA 1W2DA 2PL0A 4AACA 1DS5A 3GU8A 4BTJA 4XCUA 5IQCA 2QU6A 4XLIA 4F9WA 3PUPA 1H8FA 5CASA 5A4QA 4A4LA 4G3EA 4FTQA 3D7TA 4GG7A 4DITA 4DTAA 5HESA 4QPMA 1YHWA 2UZVA 5KHXA 3C4CA 5EM5A 2OJJA 2VTNA 2E9VA 4M8TA 1YXUA 2C5XA 2WO6A 3NZ0A 3E8DA 4U6RA 4JR7A 5LQFA 4LFIA 4CKJA 2HZNA 3N9XA 2QHNA 1OM1A 1H01A 3QZGA 3DU8A 2NRUA 3A4PA 4RFZA 5CF5A 3MB7A 4CFVA 3PPKA 4ITJA 4RA4A 3TN8A 5IUHA 3HAVA 3MA6A 4NYEA 2IVTA 1KE7A 2AC5A 1OKYA 3TKIA 3UO6A 3VBYA 4DGMA 3ZRMA 4ASDA 4O86A 3QRIA 3NEWA 2NNWB 2A4LA 2OH0E 2C0IA 2OK1A 4G1WA 3TDWA 4YR8A 3M11A 1BI7A 2C1AA 3LE6A 4NJDA 3QYZA 2IZRA 4W8DA 1ZAOA 2VNYA 3MJ1A 2REIA 3A7JA 4FUXA 4GG5A 4S32A 3R7VA 3MA3A 3FQEA 4N6ZA 2R7IA 3PDTA 5DNRA 3MGYA 4NCTA 3C1XA 1UU8A 3LFFA 4NCTC 4RX8A 4J53A 3UDBA 3LJ2A 3VS4A 2VN9A 3LQ3A 1YKRA 4X2FA 1JKKA 1PYEA 3C4FA 4M15A 3DV3A 2R3PA 5HCXA 2PZYA 4RVMA 2QD9A 4UMQA 2HOGA 4W4VA 3UOHA 4MK0A 3UIXA 3VAPA 3U4WA 2FSTX 5E91A 4BJJB 3VULA 3CIKA 4F7JA 3KN6A 4IAAA 3PXFA 2OF4A 4I3ZA 3NIEA 1YXTA 3KN5A 2IW6A 4DGGA 4WG5A 1CTPE 3QQLA 3FUPA 1GIJA 2ZDUA 5FTOA 4XP2A 3R01A 5IKWA 4PMMA 4PL5A 4L52A 5CVFA 4AAAA 4ZAUA 4PNIA 2VTTA 4OT6A 4AUAA 4BF2A 4BFMA 3BKBA 3L9PA 5L3AA 3EQIA 3FXWA 3HRBA 3L8SA 3NNUA 3PVWA 4KIPA 3FLQA 4YJNA 4UWCA 3AMYA 3HMNA 4IX4A 5CAQA 1G8SA 4C57A 4I20A 3UG1A 3QF9A 3ORPA 5E7RA 5CXHA 3K2LA 3E7OA 4QNAA 4QD6A 5M44A 2FUMA 2WQNA 3DXNA 3W55A 4HYHA 5FLFA 4YJVA 3O17A 2QR7A 3QA8A 3LJ0A 3QTUA 1KE6A 4IVDA 3DZOA 2WTKC 1M2QA 1UA2A 4IZ7A 3O96A 5FP5A 2PUIA 2X6DA 3GU5A 3HL7A 1REKA 3CQUA 3D2IA 4NM0A 4RVLA 2B9IA 4Y95A 5L8LA 3BYOA 2CMWA 2PMNX 2XK4A 3PA5A 3BQCA 4EH3A 4BCIA 5C8MA 4YGAA 1E1XA 5HVKA 2XJ0A 3BE9A 4YMJA 4FZAB 2OW3A 5AR8A 4E8AA 3KQ7A 2BZKB 2UW8A 3RCJA 3FDNA 2QOLA 3MFRA 3L9LA 5FQDC 5IG1A 1GJOA 4MVFA 3RHXA 4LRJA 1W82A 2QQ7A 2W0JA 4QTBA 3C0HA 2PVNA 4Y83A 4QTEA 4AAYA 3F88A 4WRSA 4EOKA 4M7IA 3DFCB 3F3WA 3MDYA 2YDJA 3F9NA 1YDRE 2XKCA 4ALUA 2O3PA 4D4RA 3F6XA 5CEQA 2RG6A 3EFLA 2H9VA 5ACKA 3O5AA 1YDTE 1B39A 4E5WA 1MRUA 3OEFX 4H05A 3D83A 4H1MA 1Q8ZA 4CZYB 1UWJA 4FEVA 4FKWA 2C0TA 4NZWB 4FZDB 5EYMA 4WO5A 5KMMA 4P7EA 3W2RA 4ARKA 3TIYA 5HD4A 2ITNA 3RAHA 4JG6A 2IG7A 4FKGA 2QOIA 3KXXA 2XANA 4WRGA 3KKVA 1LEZA 1IASA 5M08A 4J71A 3HP2A 2WMTA 3TZMA 2YISA 4FICA 3KC3A 4DN5A 4ZSJA 5EKNA 1IR3A 3DLSA 1OVEA 5J8IA 4H3QA 3NCZA 3VS5A 3FI8A 2OFVA 4FJVA 3KIOC 1OZ1A 3LFDA 1GZOA 1Q24A 4MF0A 3PXRA 2EXCX 2G2FA 4IW0A 3KRXA 2QOQA 3FL4A 5AMNA 1BMKA 2IW8A 1ZZ2A 4MKCA 3K54A 2W1HA 4JX7A 2X7OA 2WB8A 5IDNA 2B1PA 2XNOA 3JVSA 2P3GX 2XP2A 5EYCA 3PJ8A 4GT5A 4K0YA 4FOCA 3VHEA 4O7TA 4R1VA 3N4VA 3C51A 3RPRA 4J95A 4EJ7A 2HY0A 5E1SA 2W99B 4DHZA 1OKZA 2BRMA 3HA8A 4FGBA 4GVJA 4WNOA 4BCJA 3NNXA 3OCBA 5G6VA 3S0OA 3LCOA 3D94A 2F49A 3E3PA 4MBJA 1OIUA 4YTIA 3EJ1A 3E62A 1JBPE 2OKRA 4L00A 3CTHA 4ORKA 2VX0A 2G01A 1AD5A 2WGJA 2JIUA 4FV4A 3CJGA 4JDIA 4XV9A 3EZVA 3V04A 3HA6A 5J9YA 4CFNA 1Y6BA 3ZHPC 4BBFA 1Y57A 5AP2A 4QTCA 3FQHA 2YACA 5H8EA 2ITXA 4JBQA 5CLPA 3FMNA 3SX9A 5KMLA 4IHPA 3ANQA 4I6LA 4NIFA 4E6AA 4XJ0A 1FINA 3MW1A 1ZOGA 3QFVA 3WF9A 3GBZA 4HNFA 5HE2A 4EH5A 5GIOE 1VYZA 4QP8A 3B2WA 2J6MA 2VWIA 4CSVA 5D7AA 4QP1A 4RG0A 1JSTA 3FY0A 4B4LA 5HLWA 4FIEA 2GHMA 3GU6A 3PVGA 4GCJA 4UWYA 3CGOA 4ACHA 3EQGA 4BZOA 5H8BA 5L2IA 5A4CA 2E9UA 2EB3A 4O4BB 1STCE 5FTGA 1G5SA 4I5MA 1XKKA 1U46A 4I5PA 1BYGA 5D41A 4QEBA 4JQEA 3GGFA 4JLCA 5AR3A 1IA9A 2WQEA 3AQVA 2HW6A 3OFMA 3QALE 4APPA 1M14A 4M13A 5IH4A 3P9JA 5HTCA 3BU6A 3EN9A 2EUFB 4LV7A 3FHRA 3QTXA 4E5BA 1Q8TA 4WG4A 1ZZLA 3U9NA 1B6CB 4K77A 4UV0A 4DH7A 5CAVA 4FKUA 3OXIA 1Z5MA 2YCFA 5DEYA 4ERWA 3A7IA 4ZJIA 4L68A 4TL0A 1H27A 4DGNA 5IQEA 3BBWA 3ZU7A 2PULA 4AE9A 3U54A 4CFFA 2ITPA 4PY1A 2YWPA 2BCJA 4DEHA 5LMKA 2F7XE 5FM3A 1CKJA 3ULIA 4F7NA 5HO7A 1JAMA 1Y91A 2XIYA 4QYFA 5LARA 4WUNA 4I24A 3N4UA 2BDFA 2PZIA 2R3OA 3IDPA 4QQTA 4HVGA 2WIPA 4ZMFA 1ZYDA 4UB7A 3LFQA 4I22A 2XCKA 2WMVA 4FG9A 2YAAA 4N4SA 4BZNA 3A7GA 3VUMA 2VO3A 3GVUA 4RSSA 3VBTA 1TKIA 4IZYA 4J98A 4XS2A 3HX4A 4ZZMA 4DEEA 2FVDA 3DQXA 4P5ZA 3NAXA 5DEWA 5C8NA 4DBXA 5AP6A 5HCZA 3NAYA 4BRXA 4BCOA 3OZ6A 4U5JA 4OBQA 1BLXA 1R1WA 2VTHA 4O91A 4ANSA 2QURA 2UZUE 5CQWA 3T9TA 1H0WA 2W06A 3DLZA 4JBOA 4DHIB 4EQUA 3OOGA 3E92A 4EOOA 3G15A 5ETIA 5DMZA 3OEZA 4AT3A 3WI6A 5TO8A 1OIRA 4BBEA 4NJ3A 3RWPA 5CSXA 4MQ1A 4OTPA 2OXYA 3NWWA 4AA0A 3AKKA 4RIXB 4D4SA 4HVIA 3R63A 3HKOA 4ENXA 2X0OA 3BYVA 3VWAA 4R7HA 2W9FB 2CKQA 1CDKA 3BGZA 1JOWB 4LOOA 2C6KA 4AQKA 4U43A 5K5XA 2QR8A 1W98A 5EYDA 2ERKA 2R0IA 1AQ1A 5CAPA 2UZEA 1M7QA 2J4ZA 4KSPA 2PY3A 3R8PA 1LP4A 2JGZA 3OY1A 4QMVA 2JEDA 4F1TA 2P4IA 1IA8A 3BEGA 3F66A 3R71A 5HQ0A 4RZWA 2UW3A 2Y4IC 3ZLYA 4I5HA 3QLGA 5DRBA 2CN5A 4HCVA 1G8JA 1M52A 4BWPA 1B38A 1WBTA 2VO7A 2GCDA 4MNEA 2PTKA 4WT6A 5GJGA 4ZXTA 1J7LA 2ZM4A 3CQEA 4PP9A 3WE8A 4FK3A 3UP7A 4L9IA 4IFCA 3RM7A 4FG8A 4G5PA 4AZSA 3JVRA 4PUZA 5A3XA 2IW9A 3F5GA 3ZSIA 5GJDA 4UX9A 1NY3A 4G6LA 3E8NA 4KABA 4XLVA 2ESMA 2W4OA 4YTFA 3W8LA 2JDSA 4KKHA 2JDOA 4XNEA 5TOZA 4IM2A 1QPDA 3Q4TA 3FKNA 4FV1A 1W2CA 4QQCA 3CP9A 5D10A 5IUIA 5BMSA 3ZO2A 3E8CA 3QCXA 2VD5A 5ANOA 3HZTA 2XIZA 4NU1A 2G15A 4JOAA 2X9EA 5FD2A 1O6LA 2XRWA 2GNFA 3R83A 1SNXA 3IG7A 5B2KA 4C3PA 2CSNA 1VLRA 4DG0E 2YEXA 1YI4A 3FYJX 4FZ7A 1TZDA 1U54A 3E8EA 2YJRA 1L3RE 4B8LA 1H26A 2ZAZA 3PXZA 1OBDA 4FNWA 4RJ5A 4I6HA 3BWJA 1OGYA 4G31A 2G2HA 2VGOA 1MUOA 2CJMA 4G5JA 4TYIA 2XNEA 4DG3E 2I40A 3ZONA 3R8VA 1UKIA 4GUEA 4R3RA 1W2FA 3RNYA 4ITIA 2YIXA 4F09A 4Z7GA 5IUGA 5JSMA 3Q2JA 2JLDA 4W4WA 5CTPA 4GFMA 4NM3A 4WSQA 3MESA 3DBQA 4UMRA 2GTMA 3E7VA 3R8ZA 1APME 4E73A 2WTJA 2ITOA 3R7GA 4CZTA 4FEQA 4YZBA 3SXRA 2RFSA 3VS0A 5CF4A 4PV0A 2E9PA 2W5HA 4ONAA 2ITVA 4BGGA 3RMFA 4KIQA 4HVDA 3ZZEA 4AZEA 5DBXA 4IVCA 5EG3A 4QQ5A 3T9IA 3W2OA 4X3FC 4FOBA 5CX9A 3RKBA 4CTBA 4DINA 2C6EA 2C5OA 3GCVA 5C4KA 4E3CA 4ZSGA 4BCQA 2J0IA 2GHLA 5HBJA 3PVBA 4JXFA 5E92A 4FGRA 5CYIA 4EK8A 5K0XA 4RIWB 4CT1A 4BCHA 5IH5A 3PFYA 4IB5A 2R3KA 3RVGA 4CFUA 1OIYA 4KBCA 4FZ6A 3I6UA 2FSOX 5JFVA 1UU7A 1NVRA 4O27B 3SD0A 3NNVA 4PDYA 3DKOA 4PL4A 3PIYA 2QONA 3PPJA 4C4JA 3NS9A 2H34A 3NRMA 3EB0A 4YJQA 3SRVB 2YZAA 2HW7A 4NTTA 3MH3A 5AR4A 3LFSA 3ZFMA 4PDOA 5IDPA 3MSSA 2X4FA 2XK7A 3MS9A 3OC1A 4W9XA 5ANEA 3I81A 5J95A 4AXDA 2WMAA 4FYNA 5GJFA 2ZV2A 2BKZA 4V0GB 5AM6A 4F70A 3CKWA 3G6GA 3OWJA 4Z16A 2XIRA 5AP1A 5LXMA 2ZB0A 4IM3A 1JLUE 3QYWA 3RAKA 4QMWA 3KREA 1XH5A 3VO3A 2WTVA 2CCIA 4RJ7A 5BVNA 3PSCA 4O82A 1WCCA 2XEZA 3ZM9A 1UNHA 3PE1A 4AW0A 3FSFA 4JRNA 3FMEA 2CDZA 4JQ7A 2O0UA 4EBWA 5KMJA 3RI1A 2G9XA 4I4FA 4O38A 5EHLA 4EOSA 5I3RA 4IAIA 2BAKA 4I6BA 1WBNA 3FMMA 4CVAA 5I9XA 1OKVA 5KE0A 2RL5A 3JPVA 3GCUA 4HYSA 5M4IA 3V51A 3OTUA 3ELJA 5M55A 3AC5A 4UN0C 4IEBA 2UZOA 4MUQA 3R2YA 1OIQA 4FEXA 3WZUA 4GV1A 5C27A 4D9UA 4E20A 5IU2A 1PXNA 2DWBA 4HZSA 4K2RA 1WBWA 5T3QA 4U40A 3COIA 1PMUA 5EHYA 3TKHA 4FKLA 3FC2A 3MVMA 4FNZA 4WBBB 1DM2A 2HWPA 4BDAA 5LVPA 4E1ZA 3MPMA 4NKSA 3IK3A 4GFGA 4O0VA 3W2QA 4IFGA 4MXXA 3QA0A 4BN1A 2WU6A 4BB4A 3RALA 3LXKA 3ORLA 4I41A 4DH8A 3CTJA 1EH4A 3FZ1A 2QC6A 4R7IA 3UVQA 3UPXA 3B2TA 3O23A 4QMUA 3NMUF 1ZMUA 2ZMDA 3QU0A 3DA6A 3DXQA 1ZYJA 3RGFA 2WOUA 3C13A 3EOCA 4GW8A 4W4YA 2YM3A 1G8AA 4M66A 2HK5A 4BBMA 4ZOGA 3DK3A 5LVLA 4G9RA 2HZ4A 4LOQA 1XJDA 4B0GA 3UZPA 4EJNA 4AW2A 1XHAA 4MD9E 3BYUA 1TQMA 4DGLC 4U42A 2ACXA 4CQGA 4XG8A 3PG3A 2G1TA 3UZRA 1YOMA 4WNKA 4ITHA 4X7QA 3ZO3A 3ZRKA 4X6QC 2QCSA 4RC4A 5M57A 4F64A 1H0VA 2QOBA 5JQ5A 2PVHA 4I4EA 3D0EA 2BIKB 3PSBA 4O4CA 4R5SA 3BYMA 5HI2A 4PL3A 3ZLSA 5J9LA 2JBPA 3LQ8A 4CGAA 5EHOA 2AQXA 3PRFA 5CF8A 5M51A 4TYJA 5HE0A 4LMUA 1W0XC 2WTWA 4QP9A 5L2WA 4TYHB 2WKMA 4FV8A 2PVMA 2R3QA 3O51A 3NYXA 3AT3A 2V22A 3Q53A 4FIIA 4UYAA 3RBWA 3WF7A 1WFCA 4D5KA 4H58A 5DI1A 4FBXA 5KBQA 1E1VA 1TQPA 4F0FA 2OG8A 5J1WA 5BVWA 2W4KA 4RZVA 3M1SA 1U54B 2PZPA 3GB2A 4IQ6A 4N57A 4BTKA 3ATTA 5CY3A 2OSCA 2EXEA 5E8VA 3NDMA 2QKWB 4F08A 4F7SA 2IN6A 4IE9A 4LYNA 2VTMA 3PYYA 5CXZA 5K4IA 4O0TA 2B52A 2YA9A 2QLUA 3I5NA 3GEQA 4XUFA 2OIBA 3SHEA 2QI8A 3VBVA 4F1MA 1O6YA 2YIQA 2IVSA 5BV3A