The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
120
|
structure length |
120
|
Chain Sequence |
GSHMTKPAPDFGGRWKHVNHFDEAPTEIPLYTSYTYQATPMDGTLKTMLERWAADSNMQLSYNLPSDYTLIGPVSAISTTSVQQAATELSAVYAAQGVSVSVSANKLLVQPVPVSSGAKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein transport
|
molecule keywords |
Uncharacterized protein
|
publication title |
A Component of the Xanthomonadaceae Type IV Secretion System Combines a VirB7 Motif with a N0 Domain Found in Outer Membrane Transport Proteins.
pubmed doi rcsb |
source organism |
Xanthomonas axonopodis pv. citri
|
total genus |
19
|
structure length |
120
|
sequence length |
120
|
ec nomenclature | |
pdb deposition date | 2010-10-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10671 | TcpQ | Toxin co-regulated pilus biosynthesis protein Q |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bab) Sandwich | Phage tail protein beta-alpha-beta fold | Phage tail protein beta-alpha-beta fold |
#chains in the Genus database with same CATH superfamily 2L4W A; 3OV5 A; #chains in the Genus database with same CATH topology 2W16 A; 3GS9 A; 4MTK A; 2W78 A; 2X53 1; 2M5J A; 2W75 A; 3GR5 A; 3D37 A; 4UHV A; 2WZP R; 3OV5 A; 2L4W A; 1K28 D; 3EZJ A; 3CDD A; 4JTM A; 2Z6B D; 2D1U A; 1WRU A; 4G08 A; 3ADY A; 2W6T A; 2O5P A; 2W76 A; 1ZZV A; 4M0H A; 2P5Z X; 4AR0 A; 2IAH A; 1WTH D; 4M0N A; 2W77 A; 2A02 A; 2W6U A; #chains in the Genus database with same CATH homology 2W16 A; 3GS9 A; 2W78 A; 2X53 1; 2M5J A; 2W75 A; 3GR5 A; 2WZP R; 3OV5 A; 2L4W A; 1K28 D; 3EZJ A; 4JTM A; 2Z6B D; 2D1U A; 4G08 A; 3ADY A; 2W6T A; 2O5P A; 2W76 A; 1ZZV A; 4M0H A; 4AR0 A; 2IAH A; 1WTH D; 4M0N A; 2W77 A; 2A02 A; 2W6U A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...