2LALA

Crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
b'TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LENTIL LECTIN (ALPHA CHAIN)
publication title Structural analysis of two crystal forms of lentil lectin at 1.8 A resolution.
pubmed doi rcsb
source organism Lens culinaris
molecule tags Lectin
total genus 24
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lalA00
2DU0A 4U36A 3ZYPA 2JD4A 3H0OA 4FP2A 3AYDA 4FPHA 3RMYA 3V65A 4XJ9A 3ZPYA 1QKQA 3OBRA 1JBCA 2LALA 3AK0A 2PHTA 4M3CE 4PCRA 4AVVA 1A3KA 1FV2A 2AGSA 1VAMA 3ILRA 4XILA 4YGCA 3WCRA 1IS5A 1RINA 1QDOA 5T54A 1YYNA 2ZGRA 1W0OA 2ZZJA 1Z0HA 3AJYA 4MYEA 1C57A 3AZVA 3OBTA 4YW5A 2W52A 4ZXKA 1N1TA 1CIWA 2SLIA 4FPGA 5F5QA 1LOFC 3D4KA 4R9DA 1A8DA 5DXDA 2UWCA 3WHTA 1DQ5A 2P2KA 3UJOA 1ENQA 2DVDA 1LOCA 5GLWA 2UWAA 2JJ6A 1H9WA 1WD3A 2GDFA 1KDMA 3WNXA 1FNZA 3O12A 5HCAA 2VUAA 4NO4A 4Y1VA 2JKBA 1UZZA 2ZBJA 4BM8A 1LOBA 1LHOA 2C9AA 3VKFC 1ENRA 4YW2A 2Z42A 2DU1A 3WDVA 4Y26A 1MS4A 4FVVA 1DLLA 4IQPA 1QNYA 1SCSA 1GANA 1LENA 2I2SA 2A7AA 3RSJA 3T2TA 2R1DA 3LSDA 2JE9A 1CPMA 2DVGA 2EXIA 4Q1RA 1DQ6A 4SLIA 5JOYA 3IN9A 2P3IA 1BYHA 4YGBA 5JMCA 3INAA 1G9FA 3I4IA 4LBOA 4UW4A 4Y24A 1N3OA 4HL0A 3DUIA 2JE7A 5GZCA 1LOGA 4AGGA 1AJOA 4JCKA 2DVAA 1S0IA 2DUOA 4XJUA 1G9AA 4Y22A 3B3QE 2ARXA 5KXBA 1MVQA 1MR5A 3ZXKA 5HCBA 1SFYA 3NWKA 1AZDA 2CL2A 5DUUA 1CONA 5DG1A 4M3CA 5GLTA 2NM1A 1G9DA 1G9CA 1CQ9A 2ZGOA 1LODA 2EF6A 2ZGKA 4YFWA 4Q1PA 2VH9A 3POWA 3PMEA 4ISQA 3B9CA 3BTAA 1SLIA 4YZ5A 3D6EA 1EPWA 2WNEA 2DUPA 3IPVA 4FPYA 4AWDA 1GNZA 1W6PA 3AZYA 4Q8LA 4XBQA 4YG6A 1YO8A 1C1FA 5CA6A 2ZMNA 2EXKA 5DG2A 2OW4A 3JUUA 2ENRA 4GWNA 2ZHNA 1I3HA 2EALA 1MVEA 5GLVA 3WG4A 3ILNA 3BIWE 1Q8SA 1YIFA 1ULCA 2PHWA 3ZXJA 1I1EA 4BQ1A 3WG1A 2NZ9A 1IS3A 2NYYA 1JHNA 1ENSA 5JDBA 4F83A 5CNAA 2ZGQA 3AFKA 1DQ1A 1AF9A 1GICA 1JN2P 1BXHA 3QLQA 4BPZA 3ZYRA 1S0CA 4OZXA 4XDQA 3VV1A 1LGNA 3A4UA 2EXJA 2GALA 4TZDA 4M3CB 1UKGA 2JECA 4BMBA 4DRVA 1GV9A 1MS1A 2XB6C 2GMEA 3B69A 4R9CA 4RA0A 4Q27A 4Y20A 1V6MA 2ZGTA 3R4UA 4ATFA 3KM5A 3WUDA 1MS3A 5DUWA 5AVAA 1KJRA 4CZSA 3AP9A 1LU2A 4YZ1A 3IPVB 1W6PB 4YGEA 1KITA 2TEPA 2ZHKA 3C2UA 1N3PA 2GNDA 4ISRA 2WT2A 3AP7A 4KBBA 3SH5A 2D43A 2YY1A 3OY8A 1APNA 1GBGA 1N1YA 2DURA 1WUVA 4YZ3A 5GLUA 3MW2A 4FP3A 4YLZA 4D69A 2VW2A 2NMOA 1Z78A 3RMXA 2D3PA 2VXRA 3DGTA 1WLWA 3SISA 4JC1A 3RS6A 3WUCA 3V0AB 1QNWA 4XTPA 1UMZA 4GALA 5IK7A 4P9YA 3N7JA 5F9TA 1LHWA 5KXDA 1MS9A 3ZXFA 3VKLA 5L73A 1DBNA 3M2MA 2V5YA 4FOVA 3ENRA 1LOFA 1S0GA 4XJZA 1OFSA 1CESA 2DVFA 1YRZA 3FLTA 5IK4A 5EXOA 1DYKA 3FUQA 3HR9A 5CB7A 2YMZA 4Y20B 1DFQA 3GALA 2CYFA 3LSEA 1DQ4A 3POYA 2GNTA 2E7TA 2P3KA 4AYUA 4DQAA 2ARBA 5JLVA 1ULEA 2ZGSA 3L2YA 5GALA 1LULA 3AX4A 2W68A 4GKYA 5DUVA 3ZSKA 3WOGA 1F9KA 5IK8A 4C1WA 1GNHA 1Q8VA 4HANA 2FHRA 3NV4A 3AZWA 1G7YA 1W6MA 1SLAA 3APBA 3SLIA 5E88A 2ZGUA 4GA9A 3ZSLA 5T5PA 2W08A 2ZMLA 3AP6A 3TAYA 3WCSA 3ZXEA 2B7YA 5H9RA 2P34A 1C4RA 2ERFA 5IUQA 1GSLA 1FNYA 1VALA 1UX6A 4YFZA 2WQZC 2WSUA 4XXAA 1GZ9A 1W0PA 1JOJA 1X50A 2DWRA 2PHXA 1LHUA 3N7LA 2EXHA 4AVSA 1LOAA 4YZ2A 1LCLA 4XHXA 3RQ0A 2A6VA 1AX0A 1LHNA 3PVEA 1QOSA 2A6YA 1S0JA 3KQRA 3N3HA 5T5JA 4CRQA 3WDXA 2OUHA 1KQRA 2CNAA 1FATA 2PHRA 1WBLA 1QOOA 4Z8BA 4ITCA 3AXEA 5CAZA 3FLRA 5JOXA 2D6KA 4XZPA 3VKMA 3HN1A 3JU9A 2A3YA 1WW6A 3OYWA 4BLJA 4M3CF 2WT1A 3AYAA 1JYIA 1YI7A 3WHUA 1WLCA 4M01A 4YM1A 1W6OA 2LTNA 5HCFA 1MZ6A 1W6NA 4R9AA 5KXEA 4XBLA 2CY6A 1GZWA 4UW5A 3SITA 1AVBA 3FBYA 4FQ4A 4Q2FA 2YV8A 5EWSA 1NLSA 1Q8QA 4Y1ZA 1V6IA 4M00A 4XJ8A 2UURA 1LEDA 1MS0A 1SLBA 1H9PA 1OKQA 1UPSA 2GN3A 3VKOA 2VW0A 4FPLA 4UW6A 3BODA 4PQ9A 1WCSA 2ZGLA 3UK9A 4XOGA 4BOWA 4DFSA 1GLHA 4L8QA 4LBQA 2A6WA 3PVNA 4FQZA 3ZVXA 1Q56A 4Y1UA 4FPOB 2DYCA 3WDWA 2DUQA 3D5OA 2D3RA 4LBMA 5KXCA 2ZAAA 3WDTA 1S0BA 3IMNA 4XMAA 1KRIA 2ZGMA 2R0HA 2WJSA 1S0FA 5H9PA 2UU8A 4Y22B 1DQ0A 1FV3A 3WLUA 1MS8A 3OYWB 4YZ4A 4YG0A 1G8WA 1N47A 1BQPA 3B01A 4PBPA 1DQ2A 2D3SA 2EIGA 1VIWB 1W6NB 1S0EA 1AX2A 2FMDA 3NV1A 3W58A 1GZWB 1FYUA 2YROA 1IKPA 2E6VA 3HMYA 4GWMA 1LJ7A 4K1ZA 4XJAA 4AGRA 1SLLA 2Q5TA 3N7MA 4LBJA 4YW3A 4WVVA 2EAKA 1GKBA 2R0FA 3POSA 4WZFA 1ZM1A 2CWSA 2VU9A 1LGCA 3A0KA 1O4ZA 4FPEA 1RIRA 1LHVA 1VLNA 3N35A 4YM0A 1MZ5A 4ZKTB 2YXSA 5IT6A 5JOZA 2E51A 3WG2A 3AXDA 3PJQA 2WSVA 4LBQB 4K21A 1AX1A 3UJQA 2KM2A 1ULFA 3ZXLA 3SH4A 2R16A 1AJKA 1CVNA 2GNMA 3U4XA 1V6LA 2CTVA 2ZKNA 3WDUA 1WW5A 3IKWA 2PELA 5GZDA 1W6QA 2CWMA 4LBNA 1MACA 3O0XA 4XTMA 1LOEA 1LTEA 2WKKA 2ZABA 5FRAA 1SCRA 4PF5A 2R1BA 1S0DA 2WLQA 3MW4A 1WW7A 4BLIA 5BYNA 4XIKA 5LK5A 3WG3A 1YXWA 3ILFA 3O0VA 4FOQA 3N36A 4P9XA 5DZFA 1F5FA 4YM3A 2SBAA 1S1AA 3WZ1A 1IOAA 2A70A 2ZACA 1O4YA 2D44A 1DHKB 4YM2A 1JXNA 3ZSJA 1PZ8A 2ZGPA 3AJZA 1SACA 4K1YA 4Y1YA 5GLZA 2AENA 3Q9OA 5T50A 1D2SA 3A0NA 5GJ6A 5GZEA 5T5OA 3V0BA 1CPNA 4I30A 2A3XA 1CR7A 4GXLA 5H9SA 1LESA 2GMMA 3OY8B 4H55A 2R49A 4XHBA 2C5DA 5DZEA 1KDKA 2E53A 2NP0A 4AVTA 3O5SA 1BJQA 3TB0A 1SBFA 5GM0A 3WVJA 4ATEA 4NOTA 2A6ZA 2YZ4A 5T5LA 1H30A 5DUXA 1QGLA 3OJBA 1WBFA 4GKXA 2AREA 2AUYA 1QMJA 1QOTA 4P9WA 1BKZA 4K20A 4FPCA 3ZSMA 3ATGA 4R9BA 5SV8A 2E7QA 3NV2A 1W6QB 5T52A 2D7FA 2PHFA 3M3OA 3I8TA 1V00A 2HYKA 1DZQA 3FUOA 1WLDA 2D6PA 3AYEA 2WT0A 1V6KA 2GN7A 3MEPA 2XG3A 1QDCA 2VW1A 2VY0A 4CTEA 4DS0A 4YG3A 3VKNA 4RL7A 2OUJA 3V64A 2V73A 5E89A 2NN8A 1JW6A 4C1XA 4WVWA 2ZA9A 3AP4A 5GZFA 1AXZA 3OPZA 3N7KA 3PVOA 1CJPA 3V0BB 3RRDA 2DTYA 1W6MB 3CNAA 3LCPA 4W65A 1QU0A 1IS4A 1DIWA 4U2AA 1U0AA 3WV6A 3USUA 2OVUA 4FPJA 4DRRA 1CN1A 3NV3A 1PZ9A 1ULGA 1V6NA 1J1TA 1OQ1A 2DV9A 3ASIA 1R1ZA 2A3WA 4XJWA 4AGVA 3AZZA 4LBQD 4WV8A 3R4SA 1HDKA 3UL2A 5JOWA 1Y7BA 1LU1A 2A71A 2H0BA 2P3JA 1RITA 4FPFA 2UWBA 1IS6A 1HKDA 1JUIA 4TYSA 1G86A 2ES3A 1URXA 4FOWA 4YW4A 1XQNA 1V6JA 1UZYA 3GNEA 4YGDA 4Q8KA 1GYKA 3WDYA 1WW4A 1BZWA 2ZHMA 2BQPA 1AXKA 5T55A 3FFZA 4Y1XA 4Q26A 2A6XA 3M3CA 4XXPA 1Q8OA 3RG0A 4FPKA 1V6OA 2JDZA 1GZCA 3O0WA 1SBDA 3B00A 3R05A 1D0HA 3W59A 2A75A 1JYCA 1C1LA 1LECA 2D6MA 3MW3A 1W6OB 2A5ZA 5GZGA 3SH3A 1N1VA 2AYHA 1LEMA 1HQWA 4ASMB 2AH2A 2PHUA 2W39A 2GMPA 1FAYA 3USUB 1UN1A 5EYXA 4XYXA 4XMIA 1SBEA 2ZGNA 2G4IA 3V0AA 1QF3A 2DTWA 1ONAA 3VUOA 2RHPA 2NMNA 1HQLA 2D6NA 5EYYA 5CBLA 3AZXA 4LBLA 4PBOA 2ZHLA 1DGLA 3SNMA 1HLCA 3AYCA 1G9BA 1IKQA 2GNBA 3M3QA 2DVBA 4XBNA 1ULDA 2AR6A 4YW1A 1UAIA 1F31A 3T1LA 3BOPA 1VAVA 3FLPA 3IM0A 1UL9A 5H9QA 1MS5A 1FX5A 1TEIA 1WD4A 3OGGA 4P14A 1KJLA 5FREA 1Q8PA 1DYPA 5JVVA 2D6LX 2P37A 5IK5A 4XE9A 4UW3A 3M1HA 1PZ7A 4LBKA 4XIOA 3M3EA 3AP5A 5E8AA 2ZMKA 3MPPG 1AXYA 1N3QA 3QCWA 1ZA4A 1SLCA 3T1MA 1N1SA 2D6OX 1B09A 5DZGA 1LGBA 4FOYA 1SLTA 1A78A 4BMEA 4JRAA 4DPNA 1NXD1
chains in the Genus database with same CATH superfamily
1EAH1 4F7ZA 4XJ9A 4XFIA 4H7LA 5F6KA 5A7NA 4B29A 5C4WA 2B45X 5EJ1B 2E31A 1ZRFA 1QJX1 2VUJA 5T3NA 4YVWB 4AVAA 4JTOA 1FV2A 3Q8BA 1I9RA 1VAMA 4N8MA 4YGCA 4Y3OA 1RINA 5T54A 5C4WC 1YYNA 3VD4A 5J7MA 3KVBA 1YFYA 2XJVA 2BU9A 4PI2A 5C3RA 1Z0HA 4MYEA 1GU3A 3OBTA 4CE8A 4XDOA 2OKXA 2RS52 1N1TA 3D8CA 3IBMA 4FPGA 4W6YA 1LOFC 5F5QA 1WWYA 4R9DA 3TNQA 1PO13 3VDDA 2JDHA 1DQ5A 2P2KA 2Y34A 3PIJA 2DVDA 1LOCA 2XKOA 4FXGB 2JJ6A 1OA2A 3WQ7A 4UT5A 1WD3A 4AI8A 3O12A 3PUHA 2WLPA 3WF1A 4INDA 2YGMA 4NO4A 4MO3M 4CP9B 4CSWA 5ISLA 1RUI2 4GB32 1Y9QA 2DU1A 3RYRA 5A3UA 1UYZA 5FR3A 1W03A 1MS4A 3KGLA 4LHNA 1QNYA 1CAXA 1O4TA 5HXVA 3B93A 4CP0A 3RSJA 4COUA 2ADDA 2YB7A 3IMMA 2BGPA 1GNYA 1QJX2 5FBZA 4BISA 3BN6A 2FDJA 3MV01 3LQCA 1CAUB 1PGW1 1CPMA 2DVGA 2LROA 5C9AB 4Q1RA 1DQ6A 3HNBM 1WLTA 2D5FA 3ECQA 4LO7A 5JMCA 3LE0A 5FV3A 2PYTA 1G9FA 4UW4A 4Y24A 2WFF1 3E97A 4HN0A 5IWFA 4HT1T 2WS92 1UY1A 5D2AA 3NKGA 3X29B 4CP1A 3AC0A 3HWJA 4E4SA 5K0UC 4SBVA 1HJGA 1V0AA 3QACA 4Z2WA 5KXBA 5JR7B 3GJAA 3OGSA 5C8WA 1SZBA 4PJYA 3ON7A 4ET7A 4CDQB 4EN7B 2QDNA 3DEMA 1D4M1 3PL0A 4YFWA 4C91A 4JDOA 3RZJA 1X9PA 4ISQA 2PAMA 3PTRB 5A32B 1HB1A 4AQ6A 2X10A 3O1UA 4XF3A 1DZTA 2X5IB 4AWDA 1GNZA 2VL4A 1PGW2 1SHWB 3AMQA 3ZYHA 4ARYA 2EXKA 4AAXA 2OW4A 3H1WA 2RS13 3I3EA 2ZHNA 3JD72 2EALA 1MVEA 4N43B 3RZGA 3LD8A 2VR4A 2WFF2 1R081 2UYAA 3LDRA 4P02B 3ZXJA 4ES8A 5FZAA 1SEFA 4O65A 1OMIA 3IDCB 3WG1A 3T4HB 4BQWA 1HB2A 3VBRB 1VBA1 2NQYA 1O5UA 2K0GA 4RFRB 2R071 1RUNA 4AQSA 1UOBA 5FZLA 4OFGA 3AFKA 4A3XA 1AF9A 4AQ2A 4BPZA 3HN3A 5I0SA 1QJFA 3SHRA 4QXBA 3ZYRA 1D4M2 1DU3D 2W1QA 4XDQA 2BTVC 3VV1A 3MF6A 4Y33A 1TME1 1W8WA 4BMBA 1O3TA 1OUXA 2E9QA 3LF7A 3W9AA 2GMEA 4JQRA 2FCUA 3ZYJB 2PLV1 1ZRDA 3R4UA 5FMOS 1GWKA 4ATFA 4ZZ8A 3A22A 1YIPA 2JDYA 1KGYA 5AVAA 2GC1A 4N53B 1LU2A 1BLZA 1W90A 5CFDA 3T30A 4PHZA 4YGEA 1KITA 1VJ2A 3C2UA 4QKFA 3W20A 1QHDA 4QPWA 2D43A 5JZGB 3I2IA 1E5IA 1R082 5CFDC 2FDHA 5DDJ3 2FDFA 3GZEA 3RZZA 5FZ6A 1APNA 1GBGA 3CO2A 4DXRA 4LUMA 1GOGA 1H2NA 2WO3A 2XH6A 3MW2A 5GLUA 5FZFA 4MOAA 3JXSA 3AKRA 3RMXA 2R072 2VXRA 2HEYF 2WNVA 4RGGA 4MG2A 4AEMA 3ZPOA 2GC2A 5F3IA 5FY9A 1XYNA 4P5YA 5FKBA 1BK1A 1ZZ6A 1ZRIA 1PO21 4GALA 5A6XA 5IK7A 1PO12 3USSA 4EN8B 2RR11 3MIDA 3ETPA 4S2HA 1TME2 3U4SA 2FDIA 1O59A 5LBEA 4FOVA 3KT1A 2PLV2 4UOJA 2Y6FA 1OFSA 5IK4A 2J22A 2A1XA 3U11A 5EXOA 3S30A 4DMIA 5JXHA 4OI1A 1MPXA 1JYVA 2CYFA 2P3KA 2QQJA 5B4XA 2ARBA 1UIKA 2V4VA 3NL1A 3LEMA 2ZPXA 5GALA 3VL9A 1JHJA 2Y0IA 1OLRA 2QE3A 3WOGA 3I3QA 4C1WA 4GD4A 4CEWA 1Q8VA 4HANA 1PVC3 2CAVA 3AZWA 5LRSA 1W6MA 1SLAA 3IB3A 3ZFGC 3MIHA 2ZGUA 5E88A 4OI2A 4DY5A 4A7KA 5ANNA 3KCXA 1Y9MA 2ATFA 4CEWC 3IAQA 1L7QA 5FO9B 3EMRA 5C3OA 4M4RA 2P34A 1O91A 3LWCA 1AL0G 1GSLA 3GBGA 3JBG3 4HLTA 2PMWB 4MHUA 5FPVA 4IW3A 1ODNA 4GMP0 4YFZA 4LO5B 4AVSA 2DWRA 1OH3A 5C4WB 1LHUA 5LATA 2J1UA 2PXJA 3N9OA 4B8EA 5KHHA 4KWLA 4CVUA 4YZ2A 3WR0A 1LR5A 1RUD1 3POEA 1KFUL 1RHI1 2LM3A 1AX0A 3OTFA 4NMIA 4HK9A 5FFOC 2A6YA 5JSOA 5T5JA 3KQRA 4OI0A 1ND3B 1KQRA 1W2NA 1WBLA 1U5IA 4GULA 4ITCA 5CAZA 1PIV3 3O14A 4E2GA 2D6KA 3T0DA 2OIIA 3HJRA 4HONA 3VBOC 3MV11 2I07B 3VKMA 2JX9A 3VGIA 4AHZA 2FZ1A 3T0AA 4M3CF 2WT1A 3TEYA 4R52A 1K3IA 1OA3A 2J42A 3TNPB 3O1RA 1JYIA 4W4ZA 4LT5A 4DB5A 2W94A 2LTNA 3PU3A 1MZ6A 2RS12 4EN9B 2VOWA 1UYYA 2JB4A 2CY6A 2R6QA 3DKQA 1YUDA 3ZDSA 4K3UA 3OOXA 2YV8A 4S2FA 1H2MA 5EWSA 1C8M1 1Q8QA 4JVAA 4M00A 3ZLIA 5A6ZA 4XJ8A 1MS0A 4QPGC 4NHMA 4RQPC 1H9PA 1HRV1 1OKQA 2QQMA 2RV9A 3OSDA 5A3LA 5BNPA 1Q43A 2B9UA 1MZEA 1XC6A 3GBFA 3PU8A 4A41A 4FPLA 4A2UA 3BODA 1D2QA 1WCSA 3Q8AA 3UK9A 1HQNA 3M8LA 4BOWA 4DFSA 2GAUA 1RHI2 4L8QA 1VBB3 2WIIB 4PDWC 4RFT0 2A6WA 3PVNA 3CJIC 4FQZA 3T3YA 3UKNA 5AC93 3A7QA 2DFBA 1TVGA 5L7OC 5K0UB 4I2OA 4FSJA 2BUKA 2MEV2 4NHLA 1S0BA 2LRPA 1L3JA 2JKXA 4QAWA 1ZRRA 2ZGMA 3ZSEA 4DNYA 5FJKA 5IVYA 1FOD3 1W04A 4AFAA 1JZ2A 2UU8A 1FV3A 2QFEA 4UI9L 3TEZA 4YZ4A 1E57A 3U37A 3B9IA 1N47A 3KWVA 3AL6A 3KF5A 4PBPA 2YG0A 5IVBA 4XQ4A 1VMHA 4LITA 2XLFA 1GOHA 2EIGA 1W6NB 3KS7A 2ZXQA 1BVVA 2FMDA 4UF0A 2C4XA 5DDJ2 1GZWB 3HMYA 2WO7A 4GWMA 1HRV2 4AGRA 1W28A 1DG6A 4WVVA 3WD5A 1GKBA 3POSA 5CKQA 5A6YA 1O5LA 2VU9A 1P8JA 3BTXA 4XURA 5LA9A 3HD8B 1RIRA 4FPEA 4ZKTB 4KWUA 2CGPA 5JOZA 4V2WA 3WG2A 2BWCA 1AX1A 2WINB 3RWKX 5FZ0A 4EWAA 4WVMB 2VMEA 2VNVA 3AB0A 4LK6A 2R16A 1M4WA 1AJKA 4MSVA 5JR2A 2E63A 3H1YA 5JWPA 2VCCA 5LB6A 4A45A 3VL8A 5LWBA 3H8XA 4ZONA 2G9ZA 2PELA 1NA1C 4UFMA 3IIIA 5A3WA 4DEVA 3O0XA 4XTMA 2ZABA 2WKKA 5LEJA 1A6CA 3ZYFA 1B35A 3WP4A 4D6RA 1J1LA 4QHOA 5F8PA 1S0DA 3G7DA 4D6SA 4G9SB 4XQDA 5LK5A 4I02A 2C24A 3U1XA 3ITQA 1YFXA 1YXWA 5FZMA 2R7EB 1ALYA 2TUNA 1NZCA 4LHLA 4H7MA 5B2GB 2IWGB 2SBAA 3I54A 3ZIWA 5FZ8A 5FYCA 2BBAA 1REFA 5FMDA 2ZACA 4NRMA 1RUG3 5DABA 1CAVB 4B4PA 5CFDB 3IZOA 3MLJA 3ZSJA 3JBG2 1ZBE1 3HT1A 1UX7A 4HOOA 5GJ6A 1XBFA 5F32A 5T5OA 1UKRA 1NG0A 5DZEA 2IZWA 5FXXA 1O3RA 1KDKA 4UYBA 1H8TA 3O5SA 1RUJ3 1DP0A 2B9VA 3RI9A 1WCDJ 4FFHA 2A6ZA 4NOTA 3VD3A 4FT8A 3PLQA 4ONUA 1OSGA 2HWF1 1OD3A 1ZRCA 3PNAA 4JHZA 5FZ3A 3J8F3 1PIV2 3ZSMA 4FPCA 3LKJA 2D7FA 1BEV1 2ZJCA 3KGZA 4GJYA 1KXGA 1V00A 2JENA 3WF4A 5F5IA 1DZQA 1FXZA 2B5HA 2D6PA 2ID4A 2ZX0A 4JV4A 2Z4FA 3J7LA 2OS2A 1CGPA 3MEPA 4EROA 3OB8A 1QDCA 2VW1A 4A6SA 2FDKA 4CTEA 1QJU2 1AR71 1YQ5A 4IE5A 4QB1A 4XZUG 3RFRA 3HQRA 3SMHA 4WVWA 3AP4A 3ZFGB 5A3NA 1PMHX 4AHYA 1AXZA 4CCOA 4CEWB 1CJPA 3KHBA 3RRDA 3V0BB 4QHZA 1W6MB 3CNAA 3RI8A 1UCXA 3RGBA 1QU0A 3RDIA 1IS4A 1DIWA 4WM7A 4DXSA 4AFMA 1U0AA 3AKTA 2OZJA 2OVUA 3P6BA 3USUA 3WV6A 5AC92 4B7KA 3ACIA 3VZKA 1RUC3 3VZMA 2XMLA 1J1TA 4ZS2A 3ASIA 3TOJA 4LA3A 1F4AA 4WM7C 2VZUA 3LFMA 3R4SA 4WV8A 3VDAA 1Y9GA 3BPZA 5JOWA 1OF4A 1FOD2 1RITA 3WW1A 4BQ5A 4UXAA 4O9EA 4AEJA 1URXA 3I2OA 2Q1ZB 2YU1A 3VBFA 1W8ZA 1ZBA1 2XJUA 2VNRA 3GNEA 4YVSC 4ZU5A 2EIEA 5LASA 3VBOB 1BZWA 1AR91 1QQP3 2ZHMA 3BYWA 5FDBA 3TEWA 1XYOA 1VBC3 3OBAA 2X29A 3CU7A 2OXBA 3RG0A 4KH9A 4CDUB 3OG2A 4MX3A 5J36A 3W59A 4Y4YA 5ABJA 3BPSA 5BNNA 4XUNA 1JYCA 1C1LA 1LECA 2D6MA 3LZZA 3W21A 4XFBA 1JZ8A 1H8VA 3SH3A 5BNNC 1FPN1 1NOVA 2PA7A 1PGSA 2YUEA 3T2PA 1HQWA 3OGJA 4BYYA 1S2EA 1XNKA 4N7IA 4QPGB 4RQPB 1K12A 2PHUA 5FZEA 4D0QA 1WKYA 2HBUA 4LKFA 1O3SA 5EYXA 4XMIA 1SBEA 2G4IA 4UFJA 3WP5A 1ONAA 3H7YA 4PDWB 3AVSA 2HWD3 1HQLA 1EV12 3CJIB 3E1F1 3AZXA 4LBLA 4YVWA 2ZHLA 3T2QA 5DMYA 3UKTA 5C33A 4P9GA 2BW8A 3GJBA 2GNBA 1ZBA2 2FQPA 2OQ6A 4EN6B 5L7OB 1WA4A 3NKTA 2AR6A 1XU2A 1JYNA 4AF9A 1UAIA 1F31A 4IE0A 4CXXA 3N9NA 2ZX1A 4NPLA 3HQXA 4EQVA 4ZPIA 3S5QA 1MS5A 4C0HA 2JEMA 1TEIA 4P14A 3V64A 5FREA 4QU2A 2CV6A 5IK5A 4JHTA 1YWKA 2D6LX 3S5AA 4LBKA 1LB2A 2C1FA 3CDZB 2VQ0A 5FP7A 1RMU1 2BGCA 4ORFA 3VHRA 4A6OA 1RUG2 3L9JT 3M3EA 5FYIA 3CQOA 1Y3TA 1FPN2 5FZKA 3MPPG 4CP9A 4NIAA 2W87A 3SEEA 1ZA4A 1N1SA 2D6OX 5FWJA 1LGBA 1SLTA 2F6BA 4NVPA 2OYZA 2BOJA 1O7FA 4XCAA 2TNFA 2P6HA 4L97A 1RL3A 5FK8A 1RUJ2 4KNCA 4DPNA 5A1AA 2FD8A 2RM21 4CXWA 3ZYPA 4ZHNA 3H0OA 3V65A 5L36A 3KHCA 1QKQA 3D3AA 2VMGA 5GKAC 1OURA 5LBBA 5C9AA 5FMCA 2AEZA 2VM9A 1NKGA 3J8F2 3MHZA 4PCRA 4W50A 4AVVA 2I74A 2ORZA 2J1AA 4BHPA 4DO0A 4LPLA 1QDOA 2GSYA 1XPWA 3HNYM 4KG8A 5DAWA 3MPBA 2ZZJA 4LORA 4AVBA 2ZEWA 3AJYA 2V72A 2LS6A 1C57A 1OD5A 3AZVA 4GAZA 2W52A 2WYFA 2XBO3 4Y5Z0 1NA1B 4FTEA 1H0BA 2ZEXA 3MF9A 4W6WA 5DXDA 1AYM3 2WNUC 4K8RB 3WHTA 3WEZA 4BQXA 4Q4Y3 1C3HA 1VE0A 1ENQA 1PNFA 2Q30A 5K4LA 2CHHA 4IEOA 4BIOA 3KMHA 1KDMA 3WNXA 4CDQA 2ADEA 4BE3A 5KHGA 4FBFA 4BM8A 3MO4A 2Y64A 1LOBA 1LHOA 2WL1A 2C9AA 4QD2A 5FO7B 3VKFC 1ENRA 1TE1B 1W99A 4WZCA 5JSPA 3WDVA 1VBD3 5K7PA 4Y26A 5HI0A 4IL7A 3M70A 5A3MA 4EZHA 3EBRA 1MEC3 1SCSA 1GANA 3T2TA 1RB8G 1X7NA 1HXS1 3C3VA 3V56A 4E2QA 4CP2A 1XB9A 2D5HA 4N43A 5B4NA 3PTYA 4P5HA 5LEKA 2P3IA 2VTFA 4IEZA 5C8CC 5JI7A 5AFBA 4K7JA 1V9U1 5F3GA 2IXKA 3DUIA 3VBRA 3I97A 3KVAA 2HWE3 4AGGA 4LUKA 3RWNA 2DUOA 5EP9A 1QQP2 3E6DA 1MVQA 1KS5A 5FXVA 1SFYA 1O6UA 3LA3A 1CAWB 1W2UA 1QXRA 3NWKA 5FZHA 3E5UA 5DUUA 1J3PA 2E33A 2BOIA 3ZXAC 5GLTA 1G9DA 1YCIA 4QQLA 4Q1PA 2VH9A 3QH6A 5C7GA 3CL1A 2WNOA 1W2TA 3BTAA 1HXS2 4CEYA 1EPWA 4N53A 1SPPB 2VMCA 5FZIA 2J1EA 1EUTA 4XBQA 2IXLA 4IGQA 1NX9A 5KWRA 1C1FA 4CEYC 4EYUA 5CA6A 3JUUA 1ZYBA 4AOCA 1I3HA 1T6BX 3WG4A 3ILNA 4META 2XWJB 1ACCA 1AR82 1YQ2A 3BIWE 1Q8SA 5FY4A 3ELNA 1I1EA 3NNGA 1W2OA 4ZZ5A 4WM7B 4BQ1A 1WGPA 4HZFA 1IS3A 4XABA 4IXLA 5FP4A 4OQ8A 1ENSA 5CVRA 3W5NA 2WWSA 5JDBA 5I8TA 1XRUA 3OPWA 4F83A 5ANQA 3ACLA 5FYHA 2ZGQA 2QVSB 3NAPA 3NMBA 2JDKA 5FPLA 3QLQA 3DXTA 1AYN1 2WQ4A 1QJY2 3VHOA 4YVSB 3GCWA 3NAPC 2DF7A 3A4UA 2EXJA 4FI9A 5DAPA 4M3CB 2JECA 4QB6A 4QQOA 4DRVA 3CKHA 4QX8A 2PFWA 3LOIA 2ZGTA 2W5FA 2VC9A 2VTXA 3C7HA 1DGRN 1MS3A 3ZO0B 4E2SA 3C7OA 1RUF3 1AR63 1BCXA 3DV8A 3IPVB 3MFAA 4N90A 4QPIC 4Q0SA 2WO1A 3K4ZA 2TEPA 4KBBA 4YSFA 1N3PA 2GNDA 3BB6A 4ISRA 3AP7A 3R0RA 3MDPA 4DY3A 3VB9A 5IVJA 4NPRA 2R041 2PQSA 1Y4WA 3FHQA 5LZ6A 3ZN6B 1N1YA 5ACA1 2DURA 1WUVA 1RUH2 4RS5B 2VPVA 1PM4A 2UYBA 1RUI1 3LDBA 4GB31 4YLZA 5FK7A 2NMOA 5ERLA 2G1MA 4KI5M 4Q4X2 3UGGA 2VOVA 1WLWA 3QOPA 2PHDA 5FZCA 5FZ9A 3RS6A 1T2XA 2IVJA 2WZR1 2YBKA 3SISA 3WUCA 4ARXA 1QNWA 1WCQA 1AYN2 1UY2A 1DGWX 3POJA 5EIYB 4P9YA 3N7JA 1Q3EA 1FT9A 5KXDA 5F1RA 3ZXFA 4NAMA 4ZU7A 3FE5A 3VKLA 3VD7A 1LOFA 2HWC3 3WP3A 1CESA 2DVFA 2FMYA 3FLTA 1ND3A 3IIAA 3EYPA 3NSTA 4Q4V3 3TRSB 1POQA 1UQXA 4Y20B 1DFQA 1REDA 3GALA 4P9LA 5FP8A 1QXPA 1ND3C 1VBD2 2E7TA 1X82A 2GNTA 2WS91 2J1RA 2VTXJ 2WN2A 3K2OA 3KF3A 4AYUA 5JXIA 5I93A 3L2YA 3N9PA 4CDWA 1LULA 3AX4A 3KD4A 2R042 4GKYA 4S2DA 5DUVA 5IK8A 4IE7A 2PTMA 2FHRA 3NV4A 1SG3A 5ACA2 4BXFA 4CDWC 1QJZA 4NN0A 4XUTA 3FMGA 2W08A 1VBA3 1WCUA 4CCCA 4XF9A 3TAYA 1K5JA 3CMGA 5A70A 1K42A 2WZR2 3HVDA 4RHV1 1VBE1 5H9RA 3BU0A 1RUE3 3ZIXA 2ORXA 1VALA 2AZ5A 2QZ3A 5KHIA 1NY72 4IETA 2HWE2 4B3NA 3KV5A 3VHPA 1JOJA 3KB5A 1YFUA 4EE2A 3JD71 5KHKA 1R093 4MXWB 1GWLA 1VMJA 1TNFA 1QOSA 5K0UA 4IV3A 5CKNA 4MGYE 2WNUB 2OUHA 2RJ2A 3GHNA 1FATA 1QOOA 1W3VA 2JICA 2XJSA 4IV3C 1JH5A 3GYDA 2EA7A 4Q4Y2 2W3JA 4XZPA 4EV0A 3ACHA 4LXLA 4Q4W3 1TMF3 2A3YA 3TEXA 2BNMA 3AYAA 4N9IA 4Y5TA 1WLCA 4GH4A 2QQPA 1W6NA 2WQ8A 4HETA 2I45A 4XBLA 2FBEA 1CZSA 5HCHA 1GZWA 4RHV2 1VBE2 5FZDA 4GH4C 1AVBA 4M0NA 2YU2A 3AKQA 4Q2FA 5KHJA 1NLSA 2FCTA 1SLBA 2GN3A 1VRBA 4PLNA 4FFIA 4XUOA 1J58A 2VW0A 2VQAA 2ZGLA 5SV5A 5C8CB 4XOGA 2KXLA 2QQIA 3UYJA 3T09A 1RVF3 5J1XA 5I8YA 3ZVXA 1Q56A 2FCVA 3B5LB 3RNSA 2HWB3 3AFGA 4WVMA 4GZ9A 3H8UA 4CDXC 3K77A 5BNQA 2DUQA 3D5OA 3PUQA 5A7OA 4J6GA 3GDBA 5KXCA 2C9KA 2ZS6B 1IG3A 1X36A 1S0FA 3HAGA 4QGLA 3RYKA 5FZGA 1XNTA 1MQTC 1RUF2 1PO11 3OYWB 4YG0A 1G8WA 3B01A 1J3RA 4PIYA 2D3SA 4PI0A 1VIWB 1S0EA 3W58A 2XJQA 1LJ7A 1UY3A 1SLLA 1W39A 4CEYB 4LO4B 2EAKA 4WZFA 1UOGA 5D21A 1CAVA 1ZZBA 5IJRA 3IDAA 2CWSA 2QDRA 1LGCA 2QZ2A 3A0KA 5DAVA 2YXSA 4BQ3A 4CU7A 5IVEA 4QXCA 2WSVA 1QH6A 4LBQB 3EO6A 3O1OA 5A6QA 1U5XA 2CGOA 2JDUA 1NT0A 4IEVA 3D0JA 2QCSB 2Z5WA 4L99A 3SH4A 3ZXLA 2HWC2 3GF6A 3AMNA 1OOPA 4UBHA 3OBZA 2QKDA 1NUKA 4XW3A 2Y6LA 1OOPC 1HRI3 1R1A3 3WT3A 3BGAA 3NAPB 2XDVA 2E32A 2J1SA 4D6QA 4CPBA 3K75B 1FMD3 1GWMA 3PIGA 2VCBA 1UMIA 1XNBA 4FFFA 4N7UA 1IQDC 2BV4A 2J1VA 4XIKA 4OQ9A 3VD9A 2XPJA 3H9AA 2RE9A 3DPRA 4K9SA 3K4AA 3LGRA 3O0VA 3N36A 4FOQA 4YPJA 4PLMA 4QPIB 5FQ0B 4D8MA 3B7MA 3KCYA 3DPRC 2XVGA 5FYBA 1OQDA 4M4PA 5FOJB 4L2NA 3ZFGA 2D44A 1POV3 2GZWA 2HKXA 4K40A 1XJAA 1WMEA 3AJZA 4K1YA 5T50A 2VE1A 4FTSA 3V0BA 1TZOA 2JDAA 3I2KA 2A3XA 1CR7A 4GXLA 1NCQA 1LESA 2R30A 4I30A 4ZXEA 3LFIA 2QQVA 2RS11 3ROUA 3HPNA 4FO9A 2Q8EA 1NCQC 3TB0A 1R092 5GM0A 1HIXA 2YC4A 5T5LA 4BIFA 2AREA 3FBMA 3U75A 1QMJA 1QH7A 3ATGA 3ACFA 4R9BA 5T52A 1W6QB 3M3OA 4B4QA 5L7OA 1TMF2 1CIYA 3K46A 1WLDA 3NNFA 2JB8A 3AYEA 2WT0A 3NJYA 1V6KA 4MGKE 1KD7A 4LE3A 4QWNA 3VBOA 5LK7B 3L2HA 2VY0A 1D7PM 1RJ8A 4DS0A 4QKDA 2MEV1 4V1PA 2OUJA 2V73A 1OQEA 4CDUA 2NN8A 4GJZA 4K8FA 1J59A 2CGNA 4H14A 4C1XA 4CDWB 3OPZA 5CZKA 2AACA 4CA9A 3N7KA 4CDUC 1UXZA 1BBT3 4Q0UA 2VZVA 4ASKA 4QPGA 4KU8A 4TWTA 2JG9C 4RQPA 3SXWA 4YW6A 5DN2A 2Q1MA 3NV3A 5DDJ1 3O1TA 5F5AA 2DV9A 4XJWA 3KV4A 4AGVA 5IATA 4PDWA 2B4KA 1OVSA 4AI9A 2RG4A 3M7AA 1I5ZA 3CJIA 3WQ0A 4OUMA 5F2SA 4URTA 3E5QA 3PHMA 5FZ1A 3OGVA 1PM7A 2FDGA 2A71A 2HEWF 2WR9A 3H3ZA 1OA4A 5F5CA 4LTAA 3TYJA 1G86A 3T2OA 3A23A 1XQNA 2BZDA 5AFEA 3QH7A 2PN5A 1XE8A 1GP6A 1UZYA 2ZCWA 4YGDA 4CCDA 4IV3B 3WDYA 3WNNA 5A33A 1O3QA 1RJ7A 1CX1A 3PUAA 4LIVA 3UNPA 4Q26A 1EYBA 3I7DA 1Q8OA 4LNVA 5KR7A 2ARAA 2BYVE 1SBDA 1ZZ7A 3CZJA 1D0HA 3E5XA 5L9RA 2HBTA 1PX3A 1YQCA 4MGTA 1RXGA 5BV6A 3MW3A 3ZXDA 4GH4B 3LPFA 5A7QA 4COVA 1IPSA 2AYHA 3FHAA 1LEMA 5FPBA 2N7GA 4L11A 1PVC1 3GXUA 2W39A 5KC5A 2GMPA 5LBFA 3FX3A 4IUGA 2WZ8A 3S57A 3V0AA 4EZ4A 4LE4A 2D6NA 4RGAA 5CBLA 4PBOA 1RTVA 2WRAA 3ES4A 4AZZA 3JBG1 4CDXB 2VZ1A 1IKQA 4Q0VA 1H1AA 1G9BA 2DVBA 4OLLA 4UAPA 4XBNA 4H2AA 1AL23 4LK7A 3ORJA 1VAVA 3IM0A 1UL9A 5H9QA 4MGSA 4DZGA 4J1WA 1NA1A 2VBBA 3MICA 2R32A 4AQTA 1WD4A 4LHSA 1DYPA 2XQXA 4BQ2A 1MQTB 2IXIA 1XU1A 4XFHA 2RJKA 4NIIA 2RS33 4NIDA 4MGIE 2C6SA 1PIV1 2QJVA 5JIUA 1AXYA 3QCWA 2Y8KA 2YYOA 1BHGA 1SLCA 1PVC2 4GQ7A 1B09A 2VZQA 2YBSA 4FOYA 1UPIA 3HNMA 2YFUA 4X6RB 1NXD1 3I2HA 4CCNA 1L7RA 2O0OA 4U36A 5CADA 5E6HA 5CISA 1QJU1 4MGQA 3RMYA 3UGFA 1OBNA 3NW4A 3QD6A 1JBCA 2XKPA 3WF0A 2PHTA 4M3CE 1A3KA 3ILRA 2VO5A 3POIA 2XOMA 4XILA 3WCRA 4F8AA 1IS5A 3U78A 4IERA 1UIJA 2R063 2VQTA 1GOFA 1ND2C 4AHWA 5I0RA 4E4HA 1KS4A 2XLAA 3RPQA 1VBB1 3JQWA 1IPKA 2W47A 4LA2A 4ZXKA 1OOPB 2SLIA 2XL7A 4BU2A 5AC91 1V70A 1H4GA 1H4HA 2EVXA 2G9GA 2WAOA 3UJOA 5GLWA 4Z1VA 1CAWA 3CIHA 2KA3A 1OLMA 1H9WA 1VRH3 4C0BA 2GDFA 4BDVB 5A3PA 3S7EA 1FOD1 2RDSA 2VBPA 4Y1VA 3BUCA 1UZZA 2ZBJA 3I2DA 2V5DA 3WNKA 1W3XA 3BVCA 4YW2A 3DPRB 1XYPA 1K5MA 2G19A 2B42B 3DF0A 4XFCA 4FVVA 1DLLA 1SPPA 4IQPA 1UZWA 2EIBA 3WX5A 5APAA 2I2SA 3VDCA 3BTYA 3WW4A 1K5MC 5L9BA 4RD7A 4XAEA 3WNPA 2R1DA 2VNGA 4KU7A 1PGL1 4NE9A 2EXIA 3RJRA 4ASLA 4SLIA 5JOYA 3KLSA 4QX1A 3IN9A 3CZUA 1QIQA 3WSOA 2WO2A 4MZUA 1NCQB 1QXJA 2AEYA 1BYHA 1DYOA 2Q0AA 3ZDVA 2JXAA 1VBB2 3INAA 3I4IA 3OEAA 4PIZA 3POFA 3PDQA 4OI4A 4HL0A 5FYSA 3R6SA 5FZOB 2JE7A 4BWOA 1ST8A 5FBJA 1LOGA 2RMU3 3GCXA 4IV1A 5C71A 2DVAA 4CCJA 2NLRA 4LKDA 4Y22A 5FUIA 1EP0A 2ARXA 3BI3A 3AMMA 5FXZA 5HCBA 3ZXKA 4IV1C 3CLPA 4MVTA 4YVSA 1EV11 1PVXA 1AZDA 1S2KA 2CL2A 5DG1A 4M3CA 3HQUA 3KQ4B 1G9CA 1CQ9A 2P4EA 2EF6A 2WABA 2ZGKA 4P00B 3UKVA 2Y33A 4GWJA 1UYXA 3POWA 4RSUA 2ZX2A 3K3OA 3B9CA 5FY8A 4YZ5A 3D6EA 4XVHA 4CCEA 2ZAHA 1L7LA 1SQ4A 3IPVA 1YI9A 4FPYA 4Q8LA 4YG6A 1C28A 5DG2A 1ASJ3 2ENRA 3LEGA 3EB7A 4GMP3 4GWNA 3S6PA 5GLVA 2JG9B 5J48A 1RUG1 3VBUB 3ZN6A 2JG8C 4RS5A 1YIFA 1ULCA 1UOJA 1OC1A 4J1XA 2VMFA 4OHWA 4Z82A 5F3EA 3SEPA 3OF1A 4KMQA 5HBAA 2OX0A 4KG0A 1JOPA 1JU3A 4NWVA 2OQ7A 4RS5C 2NYYA 1JHNA 5JIAA 5EQUA 1RUJ1 3J9SA 3KZ4C 1GICA 1JN2P 1W8HA 4BQYA 1JZ5A 3ZN5A 1HB3A 4AE2A 1KEXA 1S0CA 3J8F1 1LGNA 2VQUA 2GALA 2O8OA 1H6YA 4TZDA 1UKGA 5EJZB 2E26A 1F2NA 4R9CA 2XB6C 4RA0A 5CG8A 2WAAA 4Q27A 3ACGA 4Y20A 1V6MA 4UWDA 3URFA 5FYMA 3WNOA 5A33B 1ODMA 2JD9A 2VVDA 2ZEYA 1KJRA 5FYUA 1W6PB 1GQPA 1UNBA 1UU5A 4P9JA 1GP5A 1JUHA 5E1RA 4AI3A 5LBCA 3RVHA 3TN93 2YDEA 2PQQA 1JZ7A 3WINE 5LA1A 4BCUA 4FP3A 3MIFA 4PT6A 3M3IA 4WM8C 4D69A 2VW2A 5F2WA 1Z78A 3DGTA 2D93A 4JC1A 5JCTA 4PLOA 4JDNA 3V0AB 2IXJA 4XTPA 2BEOA 1UMZA 1HW5A 1LHWA 5JAXA 1RUC1 3U07A 3VDBA 4QGNA 2B8MA 1UZVA 1OXCA 1DBNA 4MXWA 3M2MA 2V5YA 3ENRA 1VRH2 1S0GA 2P6CA 4XJZA 3UGHA 4BQ4A 1YRZA 4TN7A 2WNUA 5A7SA 1PHMA 3HR9A 5CB7A 4XF0A 3VBSC 3FN9A 2YMZA 3POGA 1HV1A 1DQ4A 3POYA 1DDLA 4DQAA 1COV3 1F4HA 2W0XA 4CUBA 2WWJA 4XAAA 1I6XA 4OYUA 4E8CA 3GBWA 1QQP1 2W68A 2RDQA 3M4FA 1H6XA 4YRDA 1F9KA 3ZSKA 5JI9A 5FPAA 1GNHA 1VBC1 2VGDA 1JOBA 4UFIA 4I0WB 1X8EA 4XF1A 1G7YA 4E4ZA 3SLIA 4BZ4A 4GA9A 4CXYA 3PJYA 1F5JA 2TBVA 2JIJA 5T5PA 3S7IA 3AP6A 4G3YC 4QDQA 3JCIA 3BALA 3MBWA 4QQ2A 4HSJA 4QQHA 3WNMA 4QDRA 3ZXEA 2E7AA 5FTTC 5CG9A 5FKCA 5A80A 1FNYA 4OZOA 1RUC2 4R4ZA 3RZHA 1OHFA 1Z7S3 2WQZC 4KL1A 4XXAA 3NNJA 4MUVA 4IGPA 2RMU2 5C8CA 2GH2A 2PHXA 3N7LA 2KD7A 1HV0A 4LULA 4NJ4A 5G05L 1ULOA 1ND2B 5FZ7A 1LOAA 5A3TA 1LCLA 2BNNA 2HWD1 2UY9A 3RQ0A 4IEXA 1AR81 2RS53 1S0JA 3WDXA 1YLLA 2CNAA 4JGZC 3P3NA 2BJSA 2YPJA 4DEQA 4D7YA 3ZFEC 1VBC2 3JU9A 2RDRA 3K3NA 3VD5A 3OYWA 4BLJA 3RJ2X 5IW0A 1YI7A 4M01A 4R4XA 5HCFA 1W6OA 1ASJ2 1QJY1 4R9AA 5KXEA 2Q8OA 1EAH3 4QM9A 4UW5A 4NAOA 3SITA 1NXMA 5FLHA 3FBYA 5LY1A 4FQ4A 1K5MB 1MZFA 5DPNA 1H1MA 3OPTA 2VJXA 1QJX3 2UURA 1LEDA 4S2GA 1O8SA 1RGSA 2WA4A 3SQOA 4E4DX 1YC61 2Y60A 1YEWA 4QT6A 4DXTA 3MZHA 2HWD2 1GLHA 3H42B 4LBQA 3THPA 2EAAA 5CYYA 2Q4SA 4YW7A 2Y6KA 1PK6B 4XC9A 2W1WA 2DYCA 2JE8A 3WDWA 1RUH1 5C5UA 4AXOA 5KBFA 4LBMA 4IE4A 2ZAAA 4XFFA 3IDBB 3WDTA 2WYSA 2RJLA 4Q4X1 4XMAA 4IV1B 2ZTNA 4LO6B 3VBHC 5BNOC 3OD0A 3I2GA 4B7EA 3UESA 5H9PA 2JDNA 2MNGA 1DQ0A 2XBO1 2ZEZA 4Y22B 4Q5OA 5D1IA 5EHDA 4FTBA 1MS8A 4K6BA 1AYM1 3MGUA 1BQPA 3OUHA 4IEWA 4O7XA 4Q4Y1 4KWJA 2XGXA 1DQ2A 3IAPA 1NLQA 4NPMA 4C8DA 4P08A 2XL9A 3N4MA 2WBKA 5BY5A 3TN92 3ZYGA 5C3QA 2YROA 1IKPA 2E6VA 1PMJX 4QPIA 1H2KA 5IAXA 5FQ0A 4XJAA 1IZ3A 2Q5TA 3N7MA 1QWRA 4AEKA 2WN3A 2R0FA 1E5HA 1ZM1A 2HJIA 2V4AA 1VBD1 3ZM8A 3JD73 4P9IA 1JZ6A 4CUAA 1KFXL 1HJFA 1LHVA 1VLNA 4HKOA 5FMBA 1MZ5A 2JG8B 2RDNA 2VNOA 5FY5A 5F3CA 2E51A 3AVRA 5IFTA 1S2BA 2WFF3 3PJQA 4OULA 2YPDA 4K21A 1UXXX 3DCQA 4MLOA 1OKOA 2C26A 3UJQA 5CEHA 4TLGA 1XOYA 2KM2A 1OF3A 2LUWA 3DN7A 4BK5A 4HBNA 1W9YA 1V6LA 2CTVA 2ZKNA 3B94A 1DGRA 3IDEA 4I0BA 1ULPA 2XBO2 3I2FA 3P3PA 1NQJA 2W1SA 1AYM2 1W6QA 2CWMA 5FYTA 1D4M3 1CZVA 1COV2 1LOEA 1NY71 1LTEA 2HWE1 2IXCA 2VCAA 3JQXA 1SCRA 5FRAA 2VUCA 4PF5A 4TXWA 3U10A 4AK3A 3T08A 2W1UA 3KCCA 1BVP1 1LKNA 3ZYIB 5BYNA 4BLIA 1YHFA 2DFCA 3OGRA 4Y5SA 2XLGA 3ILFA 4HMZA 5DZFA 4CU6A 4YM3A 5FP3A 1S1AA 1IOAA 3THCA 1O4YA 1MEC2 1JI6A 1DHKB 4LLOA 4YM2A 1DZRA 2XVKA 4HVQA 4Q29A 4Y1YA 1R083 1SACA 5GLZA 3THTA 2VXJA 1D2SA 1Z7S2 2DCJA 2P5BA 2VCMA 2BFUL 4IEQA 1CPNA 3ZMOA 3FC0A 4YWAA 2GMMA 4WM8B 4XQWA 2R49A 1UY4A 4KWKA 2WDBA 3ZKUA 1QY4A 4KQ7A 4AVTA 2R073 2F4PA 1SBFA 3ZR5A 4E8DA 2PAEA 1X8MA 4AI0A 2YZ4A 5J96B 1H30A 1RXFA 3NQHA 5DUXA 5D8AB 1SDWA 4KGQA 3OJBA 1ZA7A 2AUYA 2VMDA 2QBXA 2RVAA 1NE4A 1TME3 4AEDB 4FAHA 3KT7A 1C5HA 2BP6A 4L9BA 3VDDC 3HBKA 2PLV3 3ZXGA 1F8VA 2OA2A 3VBSB 3VZJA 1UU4A 4E9KA 2VMIA 1XNAA 1XNCA 5A1LA 5J37A 1EAH2 2VECA 4QPYA 3WQ1A 1M06G 3GGLA 5AVPA 4YG3A 5I8SA 4DUVA 2ZX3A 3VKNA 2BDRA 5CFCB 3PVBB 4A7YA 4URAA 1JW6A 4XUQA 3FHIB 3B02A 4LQRA 5GZFA 3MLLA 2GP3A 5FYYA 5FZBA 2BFUS 1RUF1 1AR61 2ET7A 2DTYA 4OHXA 4RR3A 2DCKA 5EJ3A 1W9SA 3VHNA 1X9TA 2BVBA 3WF3A 3LCPA 2DBNA 1W9WA 4CU9A 3K4DA 1YNAA 4I01A 4IEUA 4U2AA 4AFCA 3LA2A 4RR3C 4DRRA 1PO23 2X53S 1CN1A 3MLKA 4AR2A 1PZ9A 4XETA 2XXZA 1OQ1A 2RR13 2A3WA 3AZZA 1ZNPA 5DAQA 5FZ4A 3J4UH 3W5MA 1Y7BA 3H7JA 4JQTA 4QDSA 4F3JA 4FPFA 2H0BA 4CDXA 4CCMA 2UWBA 1IS6A 3DECA 3RYPA 1HKDA 4BJ0A 4TYSA 1TG7A 2ES3A 2DBIA 4YW4A 4NHKA 4JGZB 5DAXA 1V6JA 1HB4A 5CFCC 3H50A 4X6QB 4LOTA 4FFGA 2DCZA 1NLRA 1W2AX 3D0SA 3SKVA 2WZPP 1J3QA 5FMOL 3ZFEB 1MQTA 1AXKA 2HWC1 3NVCA 3OEBA 3M3CA 4Q4V1 2IUWA 3O0WA 1GZCA 1AHSA 3R05A 1AR62 3DYMA 1E5SA 2QNKA 3WW2A 2A75A 2MHFA 1H2LA 1AUYA 1OUSA 1W6OB 4XFGA 5IVCA 2B46X 3AMHA 2QTWB 3KSCA 4NRQA 2YHJA 4A4AA 1U5YA 5EZWA 4ASMB 2AH2A 3EXUA 2XHNA 1FAYA 3BIEA 5JSRA 1UN1A 2K2SA 4N9HA 1CD3G 4OMCA 1ZZ9A 1GQGA 1W8TA 1QF3A 1G6NA 2DTWA 4AFDA 3VUOA 1LNSA 5FO8B 1RUD3 2RHPA 2NMNA 5FY7A 4BK4A 5K8SA 1RHI3 5EYYA 3I3MA 3SNMA 1RUE1 4AI1A 3A21A 3AYCA 4CU8A 5LCWL 3M3QA 2DCTA 3FZ3A 3QBQA 5BPXA 3H8RA 2MEV3 2QQWA 1PX4A 3BOPA 2WUHA 3FLPA 2XUMA 3WF2A 3S0MA 5BNOB 3VBHB 3OGGA 4HK8A 3JZVA 1KJLA 1R091 1Q8PA 5JVVA 1HX6A 4Q4V2 4IEYA 4UW3A 4JX0A 3WXPA 3M1HA 1PZ7A 4CPBD 2ET1A 4I09A 1ZX5A 4JKLA 3THDA 3I49A 3NJVA 1WZXA 3J7HA 5IVVA 2D98A 3J7MA 1T6GC 5FP9A 1EPZA 2JWPA 2OZ6A 2ZMKA 3C7FA 5F37A 4Q4W1 1C8M3 3T1MA 1TMF1 4QU1A 3ST7A 1HRV3 2P3YA 3EHKA 3ME2A 4XDPA 4NHYA 3HBZA 1VBA2 1UU6A 4JRAA 4Q0PA 3GZAA 1IQAA 2VVFA 2DU0A 3DKWA 5FPUA 2F4LA 3OUJA 2JD4A 4FP2A 4FPHA 3AYDA 1RUE2 3ZPYA 3VZLA 3I59A 2VULA 2WNVC 3OBRA 5CIRA 5A1FA 2LALA 2XJRA 3AK0A 2AGSA 3ZR6A 4COZA 2CDOA 4OCTA 3MIEA 2ZGRA 1W0OA 2QQOA 1D0GA 1U5ZA 4JTNA 1OI6A 5FZOA 4YW5A 2F17A 5IUQA 2VUDA 1RVF1 4A7ZA 5JUVA 1CIWA 1HN1A 1JYXA 3D4KA 2QQNA 2HWB1 1A8DA 4JKMA 2UWCA 3LB9A 2K9ZA 4PQQA 2B39A 2A73B 2UWAA 4LLFA 4HPKA 3EJKA 1VP6A 2P17A 2H6BA 4Q4W2 5G04L 4AAPA 1JMUB 4FCAA 2BNOA 3CJXA 1FNZA 5HCAA 5JPMB 2VUAA 1JU4A 2X8KA 4IGOA 4DUWA 3LEIA 5CKMA 2JKBA 3WW3A 5FPXA 2OPKA 4BA6A 5FIXA 2Z42A 3WY6A 3O7OA 3NJZA 3VN4A 5FCCA 1LENA 3F95A 1PO22 2A7AA 4GIQA 1GZTA 4LKSA 1SFPA 3LSDA 4AVCA 2RR12 2X05A 2JE9A 2JG9A 3G6JB 3VBUA 2IC1A 3MIBA 3ZOIA 3I2JA 4UFLA 4YGBA 5J3UA 5L19A 4LBOA 1RVF2 3ALQA 3LEKA 2VVEA 2Q1FA 3Q8CA 3VBUC 1N3OA 4NWWA 2HWB2 5GZCA 1UW8A 1AJOA 4JCKA 1IGOA 1O8PA 1S0IA 1GMMA 1ZZCA 4XJUA 3VDDB 5FYVA 1G9AA 3B3QE 1NCRA 1MR5A 1DGWA 5FYZA 1VAKA 5FUNA 2VZTA 1CONA 1NCRC 1HRI1 1R1A1 2NM1A 2VZPA 4L92A 1E5RA 2ZGOA 1LODA 3R4DB 3ZFFA 1NZIA 2YC0A 5I91A 4HSLA 4BB3A 3PMEA 2Z79A 1FMD1 1QJU3 2XVLA 1Q5OA 1SLIA 3ZFFC 2WWUA 2XHKA 2Z69A 2WZEA 1ZBE3 4HVRA 2WNEA 2DUPA 1W8FA 1CAXB 2Y38A 1W6PA 3AZYA 3N9MA 4C90A 2D97A 1YO8A 2IVIB 1RC6A 5I0DA 2ZMNA 2JDMA 4Y4RA 3ES1A 4HKLA 2Q8CA 5FJHA 3NO8A 1UD1A 5BNPC 1RUD2 5EV7A 4AG4A 4QX2A 4XACA 1POV1 1GUIA 4RR3B 1VR3A 2PHWA 3DL3A 5J98B 2BGOA 2HWF3 2BWAA 1A8MA 4UFHA 3DYPA 3EQEA 2J7MA 2JDPA 3D82A 4RGKA 2H6CA 2NZ9A 1CJDA 2VOKA 2XR4A 3JB4C 4DUXA 1BEV3 3BOWA 2HEVF 4YYOA 2HLEA 4QMAA 3MYXA 1OLME 1W0NA 5CNAA 4L0PA 4WVZA 1DQ1A 5HXMA 1QEXA 1BXHA 1WMFA 1HRI2 1R1A2 3C8XA 4LIUA 1ZZ8A 4OUSA 4OZXA 3ABZA 1UMHA 4AFBA 1FMD2 2KR2A 1AR73 1GV9A 1MS1A 3B69A 2YFZA 1C8M2 5L9VA 2V09A 4OHYA 4IE6A 4IEPA 4QX0A 3KM5A 3WUDA 5DUWA 4CZSA 1W8NA 3POBA 2VZRA 3AP9A 1TNRA 2BERA 4CYDA 4YZ1A 5F7UA 1JS9A 2W95A 2C0ZA 4NIGA 4OHZA 5IYYA 2HH9A 2ZHKA 2DCYA 1FI2A 3SH5A 2WT2A 2ZZQA 4TTGA 2YY1A 2XONA 1CZTA 3H3UA 4HVOA 3AM2A 3OY8A 4JRLA 2VG9A 4QX3A 1LAJA 2ARCA 3O1SA 4HXCA 3RZLA 4YZ3A 3ZKYA 5A7PA 3CHXA 4RYDA 1Y43B 2D3PA 1BBT1 4LO8A 2QQKA 4AHXA 1EV13 4B1MA 1XE0A 1EUUA 3GZTB 3H1MA 5F9TA 5JXGA 1C5IA 1NYWA 1MS9A 1YQ6A 3DYOA 4KGGA 4QM8A 5A7WA 1ZBA3 4G4FA 1GFF2 4YARA 1ND2A 5JPNB 1CWPA 1BMV1 4W6XA 4Q0QA 5L73A 1VMFA 1AR93 5EPAA 2WFPA 3MUY1 3KT4A 2CAUA 5FY1A 1DYKA 1B35C 4XF4A 3FUQA 5C70A 4KBZA 1PGL2 5EFUA 1OT5A 1JZ3A 4CUGA 3LSEA 4I3GA 5JLVA 1ULEA 2GC0A 4I0AA 2ZGSA 5M0TA 3JB8A 5E16A 3J7NA 4PIXA 1FPN3 2GU9A 4H3WA 1W9TA 4D3WA 1K45A 4NROA 4DOUA 3APBA 4B4RA 3ZSLA 3WQBA 3UT0A 4ZU4A 2QUOA 2H0VA 1EY2A 4A3ZA 2MPFA 1WCKA 2ZMLA 3I3BA 2LW8A 1WMDA 1BBT2 1U12A 1QJEA 4HG6B 4ZY9A 3WCSA 2B7YA 4A44A 4FXKB 3WP6A 1C4RA 2WNVB 1H8TC 2ERFA 4XCBA 3OD4A 3CEWA 1UX6A 2WSUA 3P1IA 3C7GA 4Z07A 1BMV2 1GZ9A 1W0PA 1X50A 3I59B 4I3PA 4TLFA 5A3OA 2EXHA 5DQ0A 3GHMA 2OPWA 4XHXA 3SCHA 2Y6HA 2A6VA 3HOBA 3LAGA 1LHNA 1NAEA 1PK6A 3PVEA 2VZ3A 4JGYA 5FPZA 3N3HA 3Q8EA 4CRQA 2XJPA 2PHRA 4B1LA 4BH9A 1RMU3 2W9XA 1PK6C 3AXEA 4DXZA 3FLRA 1AL21 4JGYC 3WNLA 4Z8BA 5C3PA 5FAXA 2W46A 5JOXA 5LA0A 1ZBE2 3HN1A 3N9QA 4LKEA 5FWEA 1WW6A 3MIGA 5I0UA 4O9GA 4AL9A 4HPKB 1OFNA 2QQUA 3WHUA 4YM1A 2G9FA 3NJXA 1TQ5A 2RS31 2RM23 4MADA 4XEZA 4D7SA 5HPOA 1PNGA 5F39A 1F35A 3CF6E 2HWF2 4Y1ZA 1V6IA 3FWEA 3FFQA 4YNIA 4QX7A 1RYYA 1UPSA 3GZUC 2XUEA 3VKOA 1JYTA 3CBNA 4JDMA 1BEV2 2JG8A 4UW6A 4NRPA 4PQ9A 4AI2A 1VB2A 4JZRA 1D4VB 2Z2SB 1JYWA 2PHLA 3HIFA 4HKWA 4Y1UA 2ZX4A 2CDPA 1W06A 1GQHA 4FPOB 1J83A 1AL22 1AR72 2D3RA 4DIQA 3F2ZA 4WBBA 5HV0A 3VBFC 2P1BA 3IMNA 2R061 4DINB 1KRIA 2CSGA 2IFWA 2R0HA 2WJSA 3OCPA 4QGMA 5C5TA 1YJKA 1BK0A 3FJSA 3PMSA 2W92A 1NCRB 3J26N 5I0TA 2O14A 3WLUA 2RS32 3ZMNA 5FOBB 1US3A 3N9LA 1IHMA 5ABJC 3ZFFB 1AX2A 1DF0A 1W8UA 3ETQA 3NV1A 1HXS3 1VRH1 2DDUA 1FYUA 2GH8A 2VOTA 3FL7A 3LA7A 4K1ZA 1YJLA 3AL5A 4LBJA 4YW3A 3DXUA 3LIHA 5LA2A 4MHRA 1UO9A 4CCKA 5BNPB 2J1TA 1O4ZA 4MV2A 2JIGA 3N35A 2IFRA 4YM0A 5IT6A 4V2VA 1AR83 1V9U3 2VBDA 2FZ2A 4WM8A 3AXDA 2UY8A 4QXKA 1SDDB 4EJRA 2VD7A 4YVWC 3U0ZA 1AR92 1XXNA 5BXXA 1ULFA 3LDKA 5JXJA 4QX5A 2R062 4R8HA 3U4XA 1CVNA 2GNMA 4O61A 4OHVA 3PUSA 5D8AA 3WDUA 4QKBA 1WW5A 3IKWA 5CU1A 3MUZ1 4TSVA 2K46A 3KV6A 5GZDA 3AMPA 3E6CC 1ZREA 1W05A 4LBNA 1XNDA 1QJY3 1WA6X 1MACA 2XQRA 4OMDA 4QHBA 5D8AC 4AEDA 4FAGA 5C3SA 5LW9A 2RMU1 5KC6A 5FXWA 1JODA 2XJTA 3RZMA 3H8OA 3VBSA 2R1BA 2BRTA 4AEDC 2WLQA 3MW4A 1WW7A 4XFAA 1S4CA 2Y6JA 3VZNA 3WG3A 4UF0B 2IXHA 2YGLA 4P9XA 1S55A 1UYPA 1F5FA 1JTZX 3HT2A 3WZ1A 1NQDA 5CFCA 2A70A 1JXNA 2YBPA 1PZ8A 2VZSA 2ZGPA 1CAUA 3MFCA 4IESA 3T4VA 2AENA 3BCWA 1YQ8A 3Q9OA 3A0NA 4X8NA 5GZEA 3SC7X 3SCGA 1VB4A 1F15A 5H9SA 3Q8FA 3OY8B 1RUH3 4H55A 4OVEA 2C5DA 4XHBA 4EN0A 5C9AC 2E53A 1ASJ1 4GMP1 2NP0A 4LJHA 5HV4A 4Q4X3 2YC2A 4COWA 1BJQA 4ATEA 3WVJA 3BTZA 1PMIA 2OT7A 3NNLA 5FY0A 4D94A 2VOXA 1AYN3 3LOBA 1QGLA 4HFSA 1WBFA 4GKXA 2BBVA 1RMU2 1HN0A 1QOTA 4P9WA 1BKZA 4K20A 3TBDA 4LHKA 5A7WB 2E7QA 3NV2A 5SV8A 1GR3A 2AC1A 1YFWA 2PHFA 3I8TA 4UBGA 2HYKA 3FUOA 4J25A 1B35B 1OLQA 4ZS3A 4JGZA 3O1VA 5K9YA 2GN7A 4MGZE 2NPIA 2XG3A 3UETA 2GP5A 4JAAA 4LR4A 1OPOA 2RM22 1IPJA 5FLJA 3ZFEA 4CDQC 5A32A 2X5IA 3OUIA 4RL7A 1VPHA 2ETEA 5E89A 2R043 3ZN4A 1SMVA 2ZA9A 1X33A 5ACA3 2X5IC 1CX4A 4NUBA 1C8NA 1NE6A 5F6LB 5LRRA 5TSWA 1RUI3 3PVOA 4GB33 3SCFA 2O1QA 2WA3A 2ZOEB 2Q8DA 4W65A 1OPMA 5J09A 4LMFA 2WZR3 3BU7A 3IT8A 4N43C 2Y0OA 1H8TB 1UY0A 4FPJA 3TN91 2L9LA 1I5PA 1SFNA 4MH0E 4MXVA 1ULGA 4IDZA 1V6NA 1R1ZA 1OH4A 4LBQD 3T0BA 3O1MA 1HDKA 3TWIA 3VBRC 3AKPA 3UL2A 4M0HA 4NR1A 2GC3A 1LU1A 4LEJA 2P3JA 4D7TA 4ES9A 2X09A 2Y6GA 3GM8A 3IWZA 1JUIA 2CU5A 3LIGA 5IHRA 4FOWA 4Z92B 1LRHA 1XSRA 4Q8KA 1GYKA 2WS93 1R64A 4JGYB 3VBHA 5BNOA 4XUPA 2ZKLA 1WW4A 4EWEA 2PAKA 4RN5A 5FUPA 1GP4A 4LOSA 3C7EA 2BQPA 3NRUA 5LY2A 3AKSA 5T55A 3FFZA 4Y1XA 1J84A 2A6XA 4E27A 4XXPA 1WMXA 1OVPA 1V6OA 3LPGA 2JDZA 4FPKA 3UV9A 3B00A 5IVFA 4N53C 1A34A 5IAVA 4QQPA 3RZKA 5JZGA 1DCSA 3NNMA 1W9FA 4PF1A 1COV1 4GWIA 2XWBB 4JKKA 1VBE3 2A5ZA 4RHV3 5GZGA 3BKZA 1V9U2 1N1VA 1REEA 2VMHA 3HEIA 5JZGC 2Y26A 5IFPA 1JZ4A 2VAUA 4QXHA 3I3DA 2VZOA 4OUEA 3PURA 3P5BA 3USUB 1RUOA 3KV9A 4XYXA 1IG0A 4A42A 1POV0 2ZGNA 4Z2AA 1DLCA 1ENXA 1STMA 3K48A 1MEC1 3K51A 4NIHA 3SKJE 3VZOA 1DGLA 3ZYBA 1HLCA 4CUCA 2ILMA 3VLBB 1H1IA 1US2A 1Z7S1 2BVVA 5JMOA 1ULDA 1UZ0A 4YW1A 3T1LA 4BXSV 2W2IA 4EWDA 3O1PA 3VBFB 1ZVFA 2W91A 3PUIA 4QB2A 5FLIA 1FX5A 3H3LA 3MI8A 2EICA 4W8JA 4X8PA 2P37A 4XE9A 2RS51 4CCLA 4COYA 5BUVA 1XSQA 1UF2C 2EIDA 2D40A 4XIOA 2O8QA 5ABJB 1UOFA 5BNNB 3AP5A 5E8AA 4XPVA 5C6CA 1N3QA 2BPA2 1W8OA 2QQLA 5DZGA 4UFKA 4NHXA 3U14A 1XE7A 1A78A 2WC2A 4HN1A 4QKNA 4AW7A 3ZX7A 4BMEA 3E6BA 1UWWA 2HYXA
chains in the Genus database with same CATH topology
1EAH1 4F7ZA 4XJ9A 4XFIA 4H7LA 5F6KA 4B29A 5C4WA 2B45X 1ZRFA 1QJX1 2VUJA 5T3NA 4YVWB 4AVAA 4JTOA 1FV2A 1I9RA 1VAMA 4YGCA 1RINA 5T54A 5C4WC 1YYNA 5J7MA 1YFYA 2XJVA 1Z0HA 4MYEA 3OBTA 2RS52 1N1TA 3D8CA 3IBMA 4FPGA 4W6YA 1LOFC 5F5QA 4R9DA 3TNQA 1PO13 3VDDA 1DQ5A 2P2KA 2DVDA 1LOCA 2XKOA 4FXGB 2JJ6A 1OA2A 3WQ7A 1WD3A 4AI8A 3O12A 2WLPA 4INDA 2YGMA 4NO4A 1RUI2 4GB32 1Y9QA 2DU1A 3RYRA 1MS4A 3KGLA 4LHNA 1QNYA 1CAXA 1O4TA 5HXVA 3B93A 4CP0A 3RSJA 4COUA 5FBZA 1QJX2 1CAUB 1PGW1 1CPMA 2DVGA 5C9AB 4Q1RA 1DQ6A 1WLTA 2D5FA 3ECQA 4LO7A 5JMCA 2PYTA 1G9FA 4UW4A 4Y24A 2WFF1 3E97A 4HN0A 4HT1T 2WS92 4E4SA 3X29B 3NKGA 4CP1A 5K0UC 3HWJA 4SBVA 3QACA 4Z2WA 5KXBA 5JR7B 5C8WA 4PJYA 4CDQB 4EN7B 2QDNA 1D4M1 4YFWA 4C91A 4JDOA 4ISQA 2PAMA 5A32B 4AQ6A 4XF3A 1DZTA 2X5IB 4AWDA 1GNZA 1PGW2 3AMQA 2EXKA 2OW4A 3H1WA 2RS13 2ZHNA 3JD72 2EALA 1MVEA 4N43B 2WFF2 1R081 2UYAA 3ZXJA 4ES8A 1SEFA 1OMIA 3IDCB 3WG1A 3VBRB 1VBA1 2NQYA 1O5UA 2K0GA 2R071 1RUNA 4AQSA 4OFGA 3AFKA 4A3XA 1AF9A 4AQ2A 4BPZA 5I0SA 3SHRA 3ZYRA 1D4M2 1DU3D 4XDQA 2BTVC 3VV1A 3MF6A 1TME1 1O3TA 4BMBA 2E9QA 3W9AA 2GMEA 4JQRA 3ZYJB 2PLV1 1ZRDA 3R4UA 5FMOS 4ATFA 1YIPA 5AVAA 2GC1A 4N53B 1LU2A 5CFDA 4YGEA 1KITA 1VJ2A 3C2UA 1QHDA 2D43A 5JZGB 5CFDC 1R082 5DDJ3 3RZZA 1APNA 1GBGA 3CO2A 4LUMA 1H2NA 5GLUA 2XH6A 3MW2A 3AKRA 3RMXA 2R072 2VXRA 2HEYF 2WNVA 4RGGA 4AEMA 2GC2A 1XYNA 1BK1A 1ZZ6A 4GALA 1PO21 5IK7A 1PO12 3USSA 4EN8B 2RR11 3MIDA 4S2HA 1TME2 4FOVA 3KT1A 2PLV2 1OFSA 5IK4A 3U11A 5EXOA 3S30A 4OI1A 2CYFA 2P3KA 2ARBA 1UIKA 3NL1A 2ZPXA 5GALA 3VL9A 2Y0IA 1OLRA 2QE3A 3WOGA 4C1WA 4CEWA 1Q8VA 4HANA 1PVC3 2CAVA 3AZWA 5LRSA 1W6MA 1SLAA 3ZFGC 3MIHA 2ZGUA 5E88A 4OI2A 4DY5A 4A7KA 3KCXA 2ATFA 4CEWC 5FO9B 2P34A 1O91A 3LWCA 1AL0G 1GSLA 3GBGA 3JBG3 4HLTA 4YFZA 4GMP0 4LO5B 4AVSA 2DWRA 5C4WB 1LHUA 4B8EA 5KHHA 4KWLA 4YZ2A 3WR0A 1LR5A 1RUD1 1KFUL 1RHI1 2LM3A 1AX0A 3OTFA 5JSOA 4HK9A 5FFOC 2A6YA 5T5JA 3KQRA 4OI0A 1ND3B 1KQRA 1WBLA 1U5IA 4GULA 4ITCA 5CAZA 1PIV3 3O14A 4E2GA 2D6KA 2OIIA 3VBOC 2I07B 3VKMA 2JX9A 3VGIA 4AHZA 2FZ1A 4M3CF 2WT1A 4R52A 1OA3A 3TNPB 1JYIA 4LT5A 4DB5A 2LTNA 1MZ6A 2RS12 4EN9B 2VOWA 2CY6A 2R6QA 1YUDA 3ZDSA 4K3UA 2YV8A 4S2FA 1H2MA 5EWSA 1C8M1 1Q8QA 4JVAA 4M00A 4XJ8A 1MS0A 4QPGC 4NHMA 4RQPC 1H9PA 1HRV1 1OKQA 5A3LA 5BNPA 1Q43A 2B9UA 1MZEA 3GBFA 4FPLA 4A2UA 3BODA 1D2QA 1WCSA 3UK9A 1HQNA 3M8LA 4BOWA 4DFSA 2GAUA 1RHI2 4L8QA 1VBB3 2WIIB 4PDWC 4RFT0 2A6WA 3PVNA 3CJIC 4FQZA 3UKNA 5AC93 2DFBA 5L7OC 5K0UB 4I2OA 4FSJA 2BUKA 2MEV2 4NHLA 1S0BA 1L3JA 1ZRRA 2ZGMA 3ZSEA 4DNYA 1FOD3 4AFAA 2UU8A 1FV3A 2QFEA 4YZ4A 1E57A 3B9IA 1N47A 4PBPA 4XQ4A 2XLFA 2EIGA 1W6NB 3KS7A 1BVVA 2FMDA 5DDJ2 1GZWB 3HMYA 4GWMA 1HRV2 4AGRA 1DG6A 4WVVA 3WD5A 1GKBA 3POSA 1O5LA 2VU9A 3HD8B 1RIRA 4FPEA 4ZKTB 2CGPA 5JOZA 3WG2A 2BWCA 1AX1A 2WINB 4EWAA 4WVMB 3AB0A 2R16A 1M4WA 1AJKA 4MSVA 2E63A 3H1YA 5JWPA 3VL8A 2PELA 1NA1C 3O0XA 4XTMA 2ZABA 2WKKA 5LEJA 1A6CA 1B35A 3WP4A 1J1LA 1S0DA 3G7DA 4G9SB 4XQDA 5LK5A 4I02A 1YFXA 1YXWA 1ALYA 2TUNA 1NZCA 4LHLA 4H7MA 5B2GB 2IWGB 2SBAA 3I54A 3ZIWA 1REFA 2ZACA 1RUG3 4B4PA 1CAVB 5CFDB 3MLJA 3ZSJA 3JBG2 1ZBE1 3HT1A 5GJ6A 5T5OA 1UKRA 1NG0A 5DZEA 2IZWA 1O3RA 1KDKA 1H8TA 3O5SA 1RUJ3 3RI9A 1WCDJ 4NOTA 2A6ZA 4FT8A 3PLQA 4ONUA 1OSGA 2HWF1 1ZRCA 3PNAA 3J8F3 1PIV2 3ZSMA 4FPCA 3LKJA 2D7FA 1BEV1 2ZJCA 3KGZA 1KXGA 1V00A 2JENA 1DZQA 1FXZA 2B5HA 2D6PA 2ZX0A 4JV4A 1CGPA 3MEPA 4EROA 1QDCA 2VW1A 4CTEA 1QJU2 1AR71 3SMHA 4WVWA 3AP4A 3ZFGB 4AHYA 1AXZA 4CEWB 1CJPA 3V0BB 3RRDA 1W6MB 3CNAA 3RI8A 1UCXA 1QU0A 3RDIA 1IS4A 1DIWA 4WM7A 4AFMA 1U0AA 3AKTA 2OZJA 2OVUA 3USUA 3WV6A 5AC92 4B7KA 3VZKA 1RUC3 3VZMA 1J1TA 3TOJA 3ASIA 4LA3A 4WM7C 4WV8A 3R4SA 3BPZA 5JOWA 1RITA 1FOD2 3WW1A 4UXAA 4O9EA 4AEJA 1URXA 2Q1ZB 3VBFA 2XJUA 1ZBA1 3GNEA 2VNRA 4YVSC 4ZU5A 3VBOB 1BZWA 1AR91 1QQP3 2ZHMA 5FDBA 1XYOA 1VBC3 2X29A 3CU7A 3RG0A 4KH9A 4CDUB 4MX3A 5J36A 3W59A 4Y4YA 5ABJA 5BNNA 1JYCA 1C1LA 1LECA 2D6MA 3LZZA 4XFBA 1H8VA 3SH3A 5BNNC 1FPN1 1NOVA 2YUEA 1PGSA 2PA7A 1HQWA 3OGJA 4BYYA 1XNKA 4N7IA 4QPGB 4RQPB 2PHUA 1O3SA 5EYXA 4XMIA 1SBEA 2G4IA 3WP5A 1ONAA 3H7YA 4PDWB 2HWD3 1HQLA 1EV12 3CJIB 3AZXA 4LBLA 4YVWA 2ZHLA 3UKTA 5C33A 4P9GA 2BW8A 2GNBA 1ZBA2 2FQPA 5L7OB 4EN6B 1WA4A 3NKTA 2AR6A 1XU2A 4AF9A 1UAIA 1F31A 2ZX1A 3HQXA 1MS5A 4C0HA 2JEMA 1TEIA 4P14A 3V64A 5FREA 4QU2A 2CV6A 5IK5A 1YWKA 2D6LX 4LBKA 1LB2A 2C1FA 2VQ0A 1RMU1 2BGCA 4ORFA 3VHRA 1RUG2 3L9JT 3M3EA 1Y3TA 1FPN2 3MPPG 1ZA4A 1N1SA 2D6OX 1LGBA 1SLTA 2F6BA 4NVPA 2OYZA 1O7FA 2TNFA 4L97A 1RL3A 4DPNA 1RUJ2 4KNCA 2RM21 3ZYPA 3H0OA 3V65A 5L36A 1QKQA 5GKAC 2VMGA 5C9AA 3J8F2 4PCRA 4AVVA 2I74A 4BHPA 1QDOA 2GSYA 4KG8A 3MPBA 2ZZJA 4AVBA 3AJYA 1C57A 1OD5A 3AZVA 2W52A 4Y5Z0 2XBO3 1NA1B 4FTEA 1H0BA 3MF9A 5DXDA 4W6WA 3WHTA 1AYM3 2WNUC 4Q4Y3 1C3HA 1ENQA 1PNFA 2Q30A 4IEOA 4BIOA 3KMHA 1KDMA 3WNXA 4CDQA 4BE3A 5KHGA 4FBFA 4BM8A 1LOBA 1LHOA 2WL1A 2C9AA 4QD2A 5FO7B 3VKFC 1ENRA 1TE1B 4WZCA 5JSPA 3WDVA 1VBD3 5K7PA 4Y26A 5HI0A 4IL7A 3M70A 5A3MA 3EBRA 1MEC3 1SCSA 1GANA 3T2TA 1RB8G 1X7NA 1HXS1 3C3VA 3V56A 4E2QA 4CP2A 2D5HA 4N43A 3PTYA 4P5HA 5LEKA 2P3IA 4IEZA 5C8CC 5JI7A 5AFBA 4K7JA 1V9U1 2IXKA 3DUIA 3VBRA 2HWE3 4AGGA 4LUKA 3RWNA 2DUOA 1QQP2 3E6DA 1MVQA 1KS5A 1SFYA 3LA3A 1CAWB 1W2UA 1QXRA 3NWKA 3E5UA 5DUUA 1J3PA 3ZXAC 5GLTA 1G9DA 1YCIA 4QQLA 4Q1PA 2VH9A 3QH6A 3CL1A 3BTAA 1HXS2 4CEYA 1EPWA 4N53A 4XBQA 2IXLA 5KWRA 1C1FA 4CEYC 5CA6A 3JUUA 1ZYBA 1I3HA 3WG4A 3ILNA 4META 2XWJB 1AR82 3BIWE 1Q8SA 3ELNA 1I1EA 4WM7B 4BQ1A 1WGPA 4HZFA 1IS3A 4IXLA 1ENSA 5CVRA 2WWSA 5JDBA 5I8TA 1XRUA 4F83A 3ACLA 2ZGQA 2QVSB 3NAPA 3QLQA 1AYN1 2WQ4A 1QJY2 3VHOA 4YVSB 3NAPC 2DF7A 3A4UA 2EXJA 4M3CB 2JECA 4QQOA 4DRVA 2PFWA 3LOIA 2ZGTA 1DGRN 1MS3A 3ZO0B 4E2SA 1RUF3 1AR63 1BCXA 3DV8A 3IPVB 3MFAA 4N90A 4QPIC 4Q0SA 2TEPA 4KBBA 4YSFA 1N3PA 2GNDA 3BB6A 4ISRA 3AP7A 3R0RA 3MDPA 4DY3A 4NPRA 2R041 3ZN6B 1N1YA 5ACA1 2DURA 1WUVA 1RUH2 4RS5B 2VPVA 2UYBA 1RUI1 4GB31 4YLZA 2NMOA 4Q4X2 2VOVA 1WLWA 3QOPA 2PHDA 3SISA 3RS6A 3WUCA 2WZR1 1QNWA 1AYN2 1DGWX 4P9YA 3N7JA 1Q3EA 1FT9A 5KXDA 5F1RA 3ZXFA 4ZU7A 3FE5A 3VKLA 1LOFA 2HWC3 3WP3A 1CESA 2DVFA 2FMYA 3FLTA 1ND3A 3IIAA 3NSTA 4Q4V3 3TRSB 4Y20B 1DFQA 1REDA 3GALA 4P9LA 1QXPA 1ND3C 1VBD2 2E7TA 1X82A 2GNTA 2WS91 4X6RB 4AYUA 5I93A 3L2YA 4CDWA 1LULA 3AX4A 3KD4A 2R042 4GKYA 4S2DA 5DUVA 5IK8A 2PTMA 2FHRA 3NV4A 5ACA2 4CDWC 1QJZA 4NN0A 3FMGA 2W08A 1VBA3 4XF9A 3TAYA 2WZR2 4RHV1 1VBE1 5H9RA 1RUE3 3ZIXA 2QZ3A 1VALA 2AZ5A 5KHIA 1NY72 4IETA 2HWE2 4B3NA 3VHPA 1JOJA 3KB5A 1YFUA 3JD71 5KHKA 1R093 4MXWB 1TNFA 1QOSA 5K0UA 4IV3A 4MGYE 2WNUB 2OUHA 3GHNA 1FATA 1QOOA 2JICA 2XJSA 4IV3C 1JH5A 3GYDA 2EA7A 4XZPA 4EV0A 4Q4W3 1TMF3 2A3YA 2BNMA 3AYAA 4N9IA 1WLCA 4GH4A 2QQPA 1W6NA 4HETA 2I45A 4XBLA 2FBEA 1GZWA 4RHV2 1VBE2 4GH4C 1AVBA 4M0NA 3AKQA 4Q2FA 5KHJA 1NLSA 1SLBA 2GN3A 4PLNA 1J58A 2VW0A 2VQAA 2ZGLA 5SV5A 5C8CB 4XOGA 2KXLA 1RVF3 5I8YA 3ZVXA 1Q56A 3B5LB 3RNSA 2HWB3 3AFGA 4WVMA 4CDXC 3H8UA 5BNQA 2DUQA 3D5OA 4J6GA 5KXCA 2ZS6B 1X36A 1S0FA 3HAGA 4QGLA 3RYKA 1MQTC 1RUF2 1PO11 3OYWB 4YG0A 1G8WA 3B01A 1J3RA 4PIYA 2D3SA 1VIWB 1S0EA 3W58A 2XJQA 1LJ7A 1SLLA 1W39A 4CEYB 4LO4B 2EAKA 4WZFA 1CAVA 1ZZBA 2CWSA 2QDRA 1LGCA 2QZ2A 3A0KA 2YXSA 2WSVA 1QH6A 4LBQB 3EO6A 1U5XA 2CGOA 4IEVA 3D0JA 2QCSB 2Z5WA 4L99A 3SH4A 3ZXLA 2HWC2 3GF6A 3AMNA 1OOPA 4UBHA 2QKDA 4XW3A 1OOPC 1HRI3 1R1A3 3WT3A 3NAPB 1FMD3 4N7UA 1XNBA 4XIKA 2XPJA 3H9AA 2RE9A 3DPRA 4K9SA 3O0VA 3LGRA 4FOQA 3N36A 4PLMA 4QPIB 5FQ0B 3B7MA 3KCYA 3DPRC 2XVGA 1OQDA 5FOJB 4L2NA 3ZFGA 2D44A 1POV3 2GZWA 2HKXA 4K40A 1WMEA 3AJZA 4K1YA 5T50A 4FTSA 3V0BA 4I30A 2A3XA 1CR7A 4GXLA 1NCQA 1LESA 2R30A 2RS11 3ROUA 4FO9A 1NCQC 3TB0A 1R092 5GM0A 1HIXA 5T5LA 4BIFA 2AREA 3FBMA 1QMJA 1QH7A 3ATGA 4R9BA 5T52A 1W6QB 3M3OA 4B4QA 5L7OA 1TMF2 1WLDA 3AYEA 2WT0A 1V6KA <