2MADL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
124
structure length
123
Chain Sequence
b'VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
molecule tags Oxidoreductase(chnh2(d)-deaminating)
source organism Paracoccus versutus
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
total genus 29
structure length 123
sequence length 124
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2madL00
1MAFL 2I0RD 2I0SD 3PXTC 3SWSC 1MG2B 4FA5C 1MDAL 2HJ4D 2MADL 2MTAL 4Y5RC 3L4MC 2OIZD 2GC4B 2AGLD 2IUVD 2J55L 2OK4D 3SVWC 4L1QC 2AH0D 3RLMC 2AGYD 2I0TD 3ORVC 4FA1C 4FAVC 2BBKL 2H47B 2Q7QD 3PXWC 1MAEL 2GC7B 3PXSC 3SXTC 2OK6D 4L3GC 4FA9C 2HKMD 2AH1D 1MG3B 3SLEC 3C75L 2J57K 2HJBD 3RN1C 3RN0C 4FANC 2HXCD 3RMZC 4FB1C 4FA4C 2OJYD 2AGZD 2IUPD 2H3XB 4K3IC 4L3HC 2AGXD 2IURD 3L4OC 3SJLC 2HKRD 2AGWD 2IAAB 2J56L 4O1QC 2IUQD
chains in the Genus database with same CATH superfamily
1MAFL 2I0RD 2I0SD 3PXTC 3SWSC 1MG2B 4FA5C 1MDAL 2HJ4D 2MADL 2MTAL 4Y5RC 3L4MC 2OIZD 2GC4B 2AGLD 2IUVD 2J55L 2OK4D 3SVWC 4L1QC 2AH0D 3RLMC 2AGYD 2I0TD 3ORVC 4FA1C 4FAVC 2BBKL 2H47B 2Q7QD 3PXWC 1MAEL 2GC7B 3PXSC 3SXTC 2OK6D 4L3GC 4FA9C 2HKMD 2AH1D 1MG3B 3SLEC 3C75L 2J57K 2HJBD 3RN1C 3RN0C 4FANC 2HXCD 3RMZC 4FB1C 4FA4C 2OJYD 2AGZD 2IUPD 2H3XB 4K3IC 4L3HC 2AGXD 2IURD 3L4OC 3SJLC 2HKRD 2AGWD 2IAAB 2J56L 4O1QC 2IUQD
chains in the Genus database with same CATH topology
1MAFL 2I0RD 2I0SD 3PXTC 3SWSC 1MG2B 4FA5C 1MDAL 2HJ4D 2MADL 2MTAL 4Y5RC 3L4MC 2OIZD 2GC4B 2AGLD 2IUVD 2J55L 2OK4D 3SVWC 4L1QC 2AH0D 3RLMC 2AGYD 2I0TD 3ORVC 4FA1C 4FAVC 2BBKL 2H47B 2Q7QD 3PXWC 1MAEL 2GC7B 3PXSC 3SXTC 2OK6D 4L3GC 4FA9C 2HKMD 2AH1D 1MG3B 3SLEC 3C75L 2J57K 2HJBD 3RN1C 3RN0C 4FANC 2HXCD 3RMZC 4FB1C 4FA4C 2OJYD 2AGZD 2IUPD 2H3XB 4K3IC 4L3HC 2AGXD 2IURD 3L4OC 3SJLC 2HKRD 2AGWD 2IAAB 2J56L 4O1QC 2IUQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAF L;  2I0R D;  2I0S D;  3PXT C;  3SWS C;  1MG2 B;  4FA5 C;  1MDA L;  2HJ4 D;  2MAD L;  2MTA L;  4Y5R C;  3L4M C;  2OIZ D;  2GC4 B;  2AGL D;  2IUV D;  2J55 L;  2OK4 D;  3SVW C;  4L1Q C;  2AH0 D;  3RLM C;  2AGY D;  2I0T D;  3ORV C;  4FA1 C;  4FAV C;  2BBK L;  2H47 B;  2Q7Q D;  3PXW C;  1MAE L;  2GC7 B;  3PXS C;  3SXT C;  2OK6 D;  4L3G C;  4FA9 C;  2HKM D;  2AH1 D;  1MG3 B;  3SLE C;  3C75 L;  2J57 K;  2HJB D;  3RN1 C;  3RN0 C;  4FAN C;  2HXC D;  3RMZ C;  4FB1 C;  4FA4 C;  2OJY D;  2AGZ D;  2IUP D;  2H3X B;  4K3I C;  4L3H C;  2AGX D;  2IUR D;  3L4O C;  3SJL C;  2HKR D;  2AGW D;  2IAA B;  2J56 L;  4O1Q C;  2IUQ D; 
#chains in the Genus database with same CATH topology
 1MAF L;  2I0R D;  2I0S D;  3PXT C;  3SWS C;  1MG2 B;  4FA5 C;  1MDA L;  2HJ4 D;  2MAD L;  2MTA L;  4Y5R C;  3L4M C;  2OIZ D;  2GC4 B;  2AGL D;  2IUV D;  2J55 L;  2OK4 D;  3SVW C;  4L1Q C;  2AH0 D;  3RLM C;  2AGY D;  2I0T D;  3ORV C;  4FA1 C;  4FAV C;  2BBK L;  2H47 B;  2Q7Q D;  3PXW C;  1MAE L;  2GC7 B;  3PXS C;  3SXT C;  2OK6 D;  4L3G C;  4FA9 C;  2HKM D;  2AH1 D;  1MG3 B;  3SLE C;  3C75 L;  2J57 K;  2HJB D;  3RN1 C;  3RN0 C;  4FAN C;  2HXC D;  3RMZ C;  4FB1 C;  4FA4 C;  2OJY D;  2AGZ D;  2IUP D;  2H3X B;  4K3I C;  4L3H C;  2AGX D;  2IUR D;  3L4O C;  3SJL C;  2HKR D;  2AGW D;  2IAA B;  2J56 L;  4O1Q C;  2IUQ D; 
#chains in the Genus database with same CATH homology
 1MAF L;  2I0R D;  2I0S D;  3PXT C;  3SWS C;  1MG2 B;  4FA5 C;  1MDA L;  2HJ4 D;  2MAD L;  2MTA L;  4Y5R C;  3L4M C;  2OIZ D;  2GC4 B;  2AGL D;  2IUV D;  2J55 L;  2OK4 D;  3SVW C;  4L1Q C;  2AH0 D;  3RLM C;  2AGY D;  2I0T D;  3ORV C;  4FA1 C;  4FAV C;  2BBK L;  2H47 B;  2Q7Q D;  3PXW C;  1MAE L;  2GC7 B;  3PXS C;  3SXT C;  2OK6 D;  4L3G C;  4FA9 C;  2HKM D;  2AH1 D;  1MG3 B;  3SLE C;  3C75 L;  2J57 K;  2HJB D;  3RN1 C;  3RN0 C;  4FAN C;  2HXC D;  3RMZ C;  4FB1 C;  4FA4 C;  2OJY D;  2AGZ D;  2IUP D;  2H3X B;  4K3I C;  4L3H C;  2AGX D;  2IUR D;  3L4O C;  3SJL C;  2HKR D;  2AGW D;  2IAA B;  2J56 L;  4O1Q C;  2IUQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...