2MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 37
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mcg102
3HG1B 2E9BA 4GAGH 2C3HA 3G6AA 4AL8L 2OL3L 4ZFZB 1JWSA 2EIZA 1F3JA 3JWOC 3T0EA 4NQUA 1UM5H 4HZLA 5DA0B 5HI4C 5LVEA 1YN7A 1VEOA 4MXVE 4R4BB 1AGEB 4PRHE 2XV6B 4AG4H 2EDNA 5ANMA 1JV5A 1GAFL 4FQ1L 3S35H 1IAII 2BSTB 5DGQA 5IMKB 1X4XA 4JY5H 1BJ8A 3D2UB 4N9OB 4DGYH 1S5IH 4U1MB 3F12B 3QISA 4DTGH 3MRKA 1XGQA 2CUIA 2DIBA 1JPGB 4QEGA 3S3JA 3L9RA 4C56D 1YPZF 2GSIB 3CLEL 3P4NB 4KKCD 2DF3A 1QFUH 4JPVL 2R1YA 4JM4H 4IRJD 2IALA 1F3JB 4K3GA 5CBEB 1A22B 1JGEB 1FJ1A 1J11A 4XP1L 3QEQA 4XWOC 3RWIA 4DCQA 5IVNA 3DUSB 1CD8A 1WWBX 4LKXA 5DFTA 5SV3A 2HFEB 2V7HA 2HG5B 5FHBL 4PRIE 3TO4C 5CZXD 4XCEA 1T7YA 1VADA 3MJ9L 4Z7VB 4X0KB 1DSFH 1IC5H 4HXBL 1A7RL 1U8HA 5JW3L 4XNXL 2XTJE 4Y5YA 1MCOL 5GRZA 1KN4L 2PYEA 2ZSWB 1CTOA 3CVHB 3HTLX 4Y5VB 3AGVA 3WLBA 1C1EL 3NCYS 2P5EA 3WFBH 2NXYB 2BJML 4ZODA 4G3YH 3K8LA 3S37X 5IW6B 4NM8L 2DL2A 4YGAB 2IH3A 4JM2C 4QHKI 2VR9A 4PJAA 2W65B 2VOTA 4U7KA 3WFEH 5IJVB 4QXUH 4G8IB 3ZYJA 3VXRD 4NC1E 1A5FH 1ZT1A 3BP6A 4HUUA 5C0DB 2YWYA 3TJEL 1IEHA 4XVJH 3LCYA 4NNYA 3K2UL 1WZ1L 1AHWA 5CIPA 4FNLL 4TUJA 5BZWB 4K7PH 5IQ9B 1MI5D 3VFGL 4BSWB 2ZCLL 2AJ3A 2BVOA 1L4IA 1E6OL 1DL7H 3ZZ1A 5CLWA 3SKNA 1CFVL 2F54E 4IJ3B 4OF8A 2QEJA 4BH7B 5L2KA 1Q9LA 3PHOA 2PKDA 3T2NH 4G9DA 1B90A 4I3SL 3EOTL 2R4RH 4GKNA 1TLKA 5FV1L 2Y7QB 2VRAA 5D1XB 2FO4A 1NBVL 5AYQA 1CU4H 5JIHA 4F33B 4MAYD 5FYKL 3SKJL 2O61A 1EMTH 3T1FB 3ZT5A 5JW4R 2WANA 4JG1L 3UC0L 1BQSA 2RGSA 1C5BL 5GSVA 5GRXG 2EH8L 3QZWG 4KDVA 3LKNA 5FYKH 3SKJH 1NC4D 1AR2A 1T20B 3SKNB 3D85D 4P57A 3RJDA 5H2BB 4P49A 1RJCA 4XNQA 1FC1A 3O9WB 4A6YH 1B9ZA 1L7IL 5FFLA 2Z91A 3P0YL 3T2OA 5FXCH 3OJDA 4WTXA 1S7QB 4M7ZC 2HJKB 3VGGA 1G7QB 2BNRD 1Q8MA 4K7FA 2NXZC 1S7RA 3EDKA 1JRHI 4LSQH 5I1DA 2ZCLH 4JY4B 5ACLA 3V7AG 1HQ4B 2DQUL 2R29L 1OTUC 1YMMD 5I1EL 4PY8J 5FUCC 4QXGL 1FVDB 1GGTA 4XXCA 3MRDA 4LVOC 1T3FA 3UXFA 1CI5A 5IW3A 1NAKL 3BYTA 4O5LL 4JN2B 1DBKH 2ID5A 2NY4C 5GGTL 1LILA 2EDRA 5MEQB 1AHWC 4ODTH 4IM8A 1FV1A 4D0CB 4JG0H 5GJSL 5EBLB 4YK4B 3NVQA 1XGRA 5HHVL 4L3EE 2NW3B 2IMMA 3S36X 1JZ3A 3RHWK 1Q9OA 3HRZA 4PLKC 5KSBF 2PYFA 5HSFA 1IEAB 2D0GA 3UJIH 2N4IA 1Y18B 1JPST 1I1RA 2AJZA 3PWUB 4X6BA 1A1NB 3VRIB 2AKRA 1GOHA 35C8L 3UX9B 3MTRA 3C8HA 4FQXD 2YD4A 1OWWA 2ZG3A 4YHIA 3ARTA 3IT8D 4YH6A 2VQ1B 4LVEA 3IDXL 2Y72A 1WFOA 2PETA 4H26A 5FM5M 5L9DH 1M4KA 5DEZA 5F88B 3UYPA 5EZOH 3BW9A 3S6CA 1QSEB 5AZ2H 3LEVH 5J6GB 1MCHA 2L0DA 4XAKD 3OTTA 3L6FB 1RZ7H 3O81A 1CGYA 5C86A 4KKLC 1XGPA 2NXYC 4HS8L 3C2AH 5BVPH 3FB8A 1LWRA 3OBAA 3K81A 2CDEB 1Z3GL 1H3PL 4EN3B 4Q9RH 1OCWH 4QRUA 4BQ6A 3FAXA 3B5GA 1UVQA 2VUYA 4KKAD 5C9KA 4J2XA 1JHKL 4OCSH 3TVMC 1G0YR 5CUSL 5KAQG 2HA1A 5E8NA 3D9AL 2AXHA 1HXMB 4K23L 2OYPA 1WBXA 4H8WL 4KWUA 5AD0B 3UTQB 2DS4A 3HNVH 2B20A 3DGCR 1BIIB 1EZVY 2VC2H 3IGAA 3IDJB 1VACA 2UZXB 3KPOA 3PP4L 5CGYC 1DFBH 5L8JB 3JBG7 1EX0A 4E42B 1YC7A 3TN0A 5I8KL 5AZEL 3T0EC 4JCMA 4YHLL 4PJHE 4XC3H 1ORQA 2H2PD 1BQUA 3VD7A 2DICA 3EAKA 5ACZA 2VDPH 2EDWA 5EUOB 2AK4D 3SCMC 4JFYA 2PCPA 1IT9L 2VZSA 4XVTH 4G9DB 1JTTA 4AM0A 1JYWA 4Z7VF 2VXUL 1KYOK 5H8DA 3DI2B 1H8NA 3OXRB 5GZND 4JHAL 5EZJA 3RTQD 3B2VL 5JMRA 2HWZH 3K46A 2HP4A 3MV8D 4MJ5B 4X5XA 3RGHA 1BZ7B 2ICES 4M3JA 2DYPD 4XPAL 4MXWH 4LEXH 2ITCB 3G6JF 3UTSA 3AY4A 4XP9L 4RWYH 2OTUB 4ZDHB 3MA9L 2EYRB 1ORQB 1ZT4B 1RJZA 1T7XA 2UYLA 1WIOA 1JL8A 3V4PL 4R96A 4BQ9A 1A1OA 2UWEE 1H3UA 3PF2A 3O9WA 4G6KL 5EG6C 1YECH 1S9YA 4TVPE 5TE4L 1IAIM 3UTSE 1OPGL 3BISA 4HCRH 1IFHL 4N1EA 1XMWA 2UWEB 2YPLB 4NRYA 3KPPA 5DJDB 4F8QA 2FLBT 5E6ID 2VDNH 5CJXC 3CXDL 2KQNA 3UTSB 3WUWG 3DX8B 4ZFGL 2VLJE 4R2GC 1BWMA 4GW5A 2APFA 3JVGA 3MBXH 3QDMD 4PG9B 3RWFB 3SGDH 3EYUL 3KNBB 3R06A 2Q6WB 3O2VH 4HGKC 5EORL 5ESQB 3Q3GB 4CMMA 3UAJC 3F7PC 2BVQB 3GO1L 3O8XD 1A0QL 4KRNA 4UU9A 3OKEA 4YGVA 5C0GA 1CFBA 4GSDH 3IDGB 5JQ6H 3RA7H 2Y5TA 4Y4FA 1Z6JT 1EEQA 3MSPA 5IW1A 1NC4A 3C5SA 4DZBB 2Q7YB 4OTXL 1KFAL 3KPPB 4XGZB 3TIDA 1IEAA 2C1OA 2CXKA 1MCCA 3WNOA 4D0BA 5GIRB 3ZDZF 3KXFE 4XHJD 4P5TD 2YC1A 3AREB 1RZKL 1F8TL 1OAXL 3NH7H 5GQBA 4EJ1C 4I2XA 1RZ8A 1S7XB 5C9JB 1AO7E 3MBXL 1A7NH 3FN0L 3BRGC 1KB5H 1MVFA 4M48H 3VGDA 2VH5L 1Z9LA 1WITA 3CXDH 3TBVA 1TVBA 2D9CA 1S5HB 4RIRA 3PL6A 1A3RL 2E9JA 3G04A 3SDCA 3MUHL 3F6IA 1U8LA 2C5DC 3S8WA 1FZOA 1FYTE 2G5BB 5KTEL 1J0HA 1AD0B 1N2RB 3RL2B 1G7MA 1WBZA 3RDTA 3SPVB 5EFIA 1UZ8A 3HAEA 3TBYA 5JHDD 1KC5H 4I0KA 4AMKL 3RZCB 5IEHB 3AREC 1G9NL 1UZ6F 4XCCL 3BEVB 3RWDB 4LRIA 4MSWB 4GRLB 2NTFA 3UMTA 4AEEA 2A83A 3ARWA 2QSQA 2DM7A 1NGYA 3WFHA 1NCUA 3DUSA 2FWOB 3BP7B 4WO4B 3MACL 1HK6A 1QOKA 1HHIA 3HE7B 3VXME 3AMLA 3SE8H 2YXFA 3TYGH 4WFHD 3VFPB 4WI4A 5DDHB 3WD5L 3I75B 5D1ZB 1ZS8B 3V0WH 2XWBB 3IU3A 1I1AB 2J3SA 2F58H 2XQBH 3SQOH 3SDAC 1IGCH 1U8PB 2QHRH 4ZUTA 4XZUB 3ZHKA 4PRNA 5I8KH 3V2AR 4LLWA 3RX7A 2R56L 2NZ9D 4WI7A 5INCB 1NGZA 1IGFH 2R69H 1O7VA 3OR6A 3U0WL 1ZA6B 5IVZB 4PRPA 1T04B 1ED3B 1N8ZA 2IPKA 3CJJA 1KCRH 1QHPA 4JO4H 3P4OA 4J23A 4NYLA 1FL5B 1AGCB 3D39D 3IJSB 3FT4B 4IMKC 2CK2A 5GHWL 1CFQA 2JJSA 3MRGA 4LP4A 5LQBL 32C2A 1CFTB 3P11H 3D9AH 3D69A 4PJBB 3BRDA 3BGFB 2H2SD 4L9LB 5EZIL 3TIEB 3RY4A 3OAUL 2HKFL 3FO9B 4QF1A 4RBPH 3D85A 4FFYL 4JFHD 3VI3F 1OAYH 2AQ2A 2BFVL 3TPUB 5IF0B 3DRTB 2SEBA 3W9EB 3BPCA 1QUNA 3NPSB 4P4KB 2ZZUT 1J0ZA 2XKSA 4XVUC 2FIKB 3JUZA 2BMKA 4NKOA 5KSAA 32C2B 4G8EB 4QRQB 3EZ8A 4LLVB 4WGVB 1TETH 4U3HA 1FO0A 5FO7B 3O8XA 3GMPA 1WGOA 2D03H 4OCNC 2DWDB 5FIEA 4R7NB 3T4YA 3A67L 4FABH 5JO5B 3UJTH 4KVCH 4PGCA 3SGJA 1T2QH 3QEQE 3H3BC 4CW1B 5BJTA 1T5XB 2APVA 5CWSA 5ERWA 2LABA 5T1DH 1KIUA 2OTWA 1Y0LA 2JB5L 1UQSA 4KZEL 2H3NA 5J7CC 5D2LE 1U41A 3NTCL 3DVNB 5MHSE 4X5XB 1R24B 1NCWL 1TQCB 3DVGB 1TJIL 3NFSL 5ITFB 3ARDB 2HVKA 3CFKA 1FGNH 4MQTB 4JLRB 4XCFH 5IGXL 4F57L 4NHUB 1J10A 2BY1A 1T1WA 3GSUB 3INUL 4KI5C 1FG2B 4NRZB 4XP4L 2NXZB 5EC2A 4MDIA 4JGMA 1A2YA 5BV7B 3BRFA 1IC4H 4EI6A 3MBEA 3ZYZA 1XGYH 1NAKH 1BFSA 4FRWA 2NNAA 3DXAD 3DX7A 4NO3B 2HTLC 4CBPA 4EDWH 3ARBB 4ZSOE 4ELME 4QTHA 4Y19D 5EULV 1HKLH 3CGTA 5DRWA 4HG4K 1V3MA 3D39B 5ILTL 2DDQH 1PW3A 4WUKL 2EO1A 2DTSA 1WBXB 2EIBA 3IAQA 4H8WC 1AGDA 1PAMA 4MDIB 2LU3A 3SGDI 2VDMH 1JWMA 4H20L 1QSED 2CUHA 2R15A 1GZPB 1QA9B 3E0GA 4X5WA 3GGWA 4ZFZA 3RIAF 3HCVA 1RSFA 1BD2A 1FE8H 3QDJB 3TN0B 4KK8D 3CFDB 1RULH 2EEDA 4WI8A 5EZLA 1MLCB 4Y4HD 3H9SD 3U4BH 5F1IB 3D6GA 5DJ2B 4ZS6C 1RU9H 4HSQA 4ZXBD 3FN9A 2MKLC 1DVFB 1OGAD 3O6KL 4KQ3L 4Z7WE 5I8EA 3AROA 3BVNB 5GZOD 2GK0B 1V8HA 2IH1A 2CLVB 2QSCH 4ZUTB 3S9DB 1QSZA 2XA8H 2J8UF 4YXLL 4DN3H 4NC2B 1ZTXH 4FNLH 4YLQT 4GMSL 3K2UH 3P3YA 1LP9A 3PWPA 4F37F 5C3LD 5I76B 3KJ4C 4BK5A 4Q6IA 1CVRA 2FL5B 4MD0B 5EBWA 1OQXA 3QUXB 2WWKO 4CGTA 3JTTB 4YXHH 3QUMH 1R5WB 1NFIB 1IEBA 4MNHB 1AH1A 5ID1B 3G9VA 4XCEB 2PTTB 2AK4B 2EEBA 1MFAH 2FGWH 4KJYA 3FQWB 3TIEA 3Q5YA 3W39B 1W72B 4DAGH 3BH8B 1J9CT 5IHBA 1RV6X 5A2LH 5F3BA 2A83B 2NCMA 5F9WB 1UCBL 3H3PL 3FCTB 2MMXA 1QO3A 1NBZB 2NR6C 3B83A 2LU4A 2VITA 5HHPA 1MCKA 4PJCE 4N8CH 5EU4A 2WQRA 1HSBB 1Z0MA 1EK3A 4X6DA 1YPZE 1MEXL 3GJFK 1AR1C 5KSVB 3WKMH 1U95B 1FSKC 1MRCH 1BAFH 2J6EH 5TF1L 3BKYH 5IB1A 4KJYB 3IDMA 3O4LA 3ARGC 5EU3B 3WNKA 4PJFA 4J3WA 3HNSL 3NIFF 5TH2B 1SYSA 2JTDA 4G9FE 1ETZB 1P9MA 2VJXA 1YNLH 4JO1H 4L3EB 3NAAL 5IIEB 2GT9A 5I1HH 2GQHA 2WP3T 4ENED 3SGKC 3UTSD 4RMSA 4BUHA 1T0PB 5CSZA 4NGHH 2AI0H 4YX2H 1NCWH 3F58H 1IJ9A 2BP3A 4HUNB 1RZIB 5FYJE 5F96H 3LKPA 5KOVC 3S35L 1X5LA 4M93B 4KZEH 1XGRB 2Q20A 1ZLVH 3SGJC 1BFVL 1S9WB 4OCWH 4NQSA 3X3FH 4YHKH 4QXTB 3V8OA 4YDVA 1QQDA 4HWUA 4R8WH 1AJ7H 2QLVB 3MR9B 3RVXC 2IMNA 3WLWD 3NN8B 1X5HA 2ZUWA 3SDYL 4Q9CA 4G6AC 3GI9L 5LCVL 4HC1A 3V95A 4MXQD 4HKJB 1S3KH 4NWTH 1HWGB 3GMOA 3EDFA 2XZCL 2H2PC 2B4CL 3S4SG 4OD2A 1KTLB 3WHE1 3GUTB 3EYQC 3OKOB 1BFTA 1AXSA 1N64H 2D31A 1PKQB 1BX2B 3NFPA 1BJ1H 4WV1C 5BW7A 4F7MB 5CIPH 5E4EC 4JHWL 2VSCA 5JO5A 2MOVA 4M1GL 5DJYB 2WSKA 1KELH 2CPCA 3V8CA 1CXHA 2AXJA 1NC2D 4QHLA 5ABDE 3C6LB 4MQ7A 3E2HB 3HC0B 2VLKA 5HYJE 4RFNC 5EWIL 4BQCA 5JHDB 1CF8L 4PJ5A 2PNDA 3BMWA 3D2UD 1OM3H 2ENYA 1JGUL 1DR9A 3D0LB 1KCVH 4LPWA 2E6JA 4P2YA 4WU7B 4GRLD 2NY0B 1OLZA 3RAJL 3L5XH 4OZFH 4WIQA 4X6CE 1HH6A 2R56H 1KNOB 4F2MB 4WUUB 3DV4B 3ZT7A 4DKFL 4M7JH 3MX0A 5BO1L 3NIGE 3TA3B 3WD5H 1FL3A 1H3WM 3VFVB 4PP1C 3PWVA 2DQGH 4PV9B 5E5MA 4ZUUA 1XR8A 2YWZA 1I7RB 4OBSA 1CZ8H 3BW9B 5DURB 3C5ZA 5JNYB 2W91A 4LPXA 4YJZL 4LGPB 2GFBA 1U3HC 4X7EC 1MRDL 4TPRH 2EDLA 4JRXA 2HYMA 4OV5A 4JFQB 3RDTC 1JWUA 3PWNB 4PJ9A 4BH8B 1FL6B 4TUJB 5BZWA 1YEDB 4XPFL 2VXTL 5A43C 5L0QB 4H1LG 2KUTA 2JIXD 1NGQH 5TQ2H 1K4CB 1MHCB 4ERSL 2WBJD 4YDLC 4GBXC 2V5RA 1JHLH 3PGCB 4ZFOL 4UIKL 4OUUB 4C4KO 3H7BA 5HYJA 1K85A 4MJID 4MNQB 4JAMA 3BDYL 1ZVYA 2IAMD 4BQBA 4P48A 5MENB 4Q74A 3GSVA 2VH5H 3BT2H 4G8GD 3QJFB 5CINL 1A7NL 3MRGB 4YWGL 4LLQA 1J18A 4NN7B 3IDJA 5F89A 2AV1A 1SMAA 2X4NB 4L4TE 5CJ5A 2VSDA 1C08A 3WEXB 5JXAH 4N0FA 4XMPL 3U9PL 5J1SC 1CGWA 1D5MA 3BIKA 1FPTH 2FJGB 3SE4C 2C3WA 4P9HH 1UB6A 1CT8A 4HEPG 4FXGA 5DRZA 3GMMB 3R1GH 1NFIA 1J87A 1G7LB 4RMWA 3MNZB 3ULVC 4FFZL 3BPCB 4LSPL 3FFDA 2DLFL 4MQSB 2ZKHL 5I16B 5DJCA 1CD1A 4U3CA 4KI1A 1KEGL 4OFIA 1FLTX 1I3GH 3DO7B 4LQ1A 5F70A 2A6KA 2E6PA 4WFED 1NMCB 1HEZB 2DMBA 3GMNB 5IB2B 4V2BA 3MV8E 4M5ZH 4OZGA 2O5YL 3O41A 1ZHKA 4KK8C 1RK0A 3VGAC 3BQUA 2W59A 1S9XA 1TZHB 5F7HA 1UJ3C 1UEYA 5HHOD 4NWUH 3DXAB 1I1YB 2CLRA 5TE4H 3OR7A 1WWAX 4PRIB 4Z7OF 1SJEA 3F7YB 4G6KH 4X6DF 3TO2B 3ARBD 1HHHB 1S8DA 4EDXB 2XZZA 4Y5XA 3SOBL 3WXWH 4Z7VE 1QP1A 3BYYA 1X9QA 4V1DE 4TVPD 4I9WD 1WZLA 1DQQA 4DGIH 3WE6A 4FQLL 1FZMA 3FTGB 1CBVL 2Y1VA 4ZAKB 1QRKA 3RWDA 1CE1L 1T0MB 2GUOB 3R0NA 1KYOJ 1A21A 3KPLB 5GGQH 3QG7H 2CDGB 3TBTA 2VDLH 3BGMB 3O3DB 1U93B 2AV7A 1WEJL 3QI9A 2FH8A 4D94A 2IEPA 3C5SB 4DZBA 3QNXB 3CFEB 2VABA 3UDWC 1MJJB 4HULB 3W2DH 3L3HA 1SHMA 1IE5A 4YHLH 2FBJL 3BAEL 1B0RB 1J8HD 1MHHB 4YHYC 1RUPH 4FFVD 3CZFB 3G5ZA 3K7UA 2ICWB 3LDBB 1RJYB 3K4DA 5C9JA 3OAYH 1CXEA 5HDLA 3LSOB 2ADJB 2E7CA 2Y06L 2PXYA 1YEJH 1FDLL 3EYFA 1S5HA 4RIRB 1LNUA 4D0DB 4U1HA 1DEDA 2UZIH 3QNXA 4AT6B 1M7XA 2YD8A 3MODH 3MV01 1NLBL 1FHGA 3VFOA 5L8KB 1OGTA 1XAUA 1U95A 5BXFB 4IDJL 1AFVL 1PJ9A 3EHBC 1OCWL 3ZE0F 1F4XL 5D1XA 1HHKA 3V4VH 1T4KA 1G7PA 2NYYC 4C56E 1HCFX 3T2PA 4CL7A 2A77H 1P7QB 3SKUD 3HLAB 2ZUYA 5F7DA 1ZV5A 2Q8AH 4RFNB 2FX7H 5FKPB 1XZ0A 1AQDB 1H9VA 4CNIB 2AGJH 2Y23A 3QH3B 3I6GB 1YEKL 2FBJH 3U4EA 3SBWC 1BAFL 1BOGA 1CG9A 4YAQA 3V4UL 5ICYB 4GW1B 2R1WA 3WN5C 1BPVA 1EEZA 4IRSD 8FABB 3L3OB 3HI1B 2IH3B 1HYSD 4NDMB 5MI0B 3G5XA 4YHZL 4GAYA 3HMWH 3MV7D 2F5AL 5DC4B 3MQIA 5E08H 1ZT1B 3BP6B 1XCTA 1J5OH 1RAMA 1M05B 3VFUA 1MCPH 1XT5A 1UB5B 5GGQL 4U0RC 1UB6B 4U05A 4AK1A 3HLAA 3QG6A 3VDAA 5IBUG 2C3VA 5INCA 5HYQA 3O3EA 4PV8B 2FX8H 1DDHA 1BZ9A 4X6CA 1PDKA 1QFWM 3PQYA 3JUYA 1QR1A 5T5NF 4FP8L 1FNGA 3DVIA 1H3TA 5ALBL 2P5WB 3NCBB 1N4XL 5GJSH 4YXHL 3FT2B 3ESVF 3S3PA 2EDJA 2VDKL 3B8YA 5CAYB 1WCQA 2CXGA 4V2CB 4UMGA 2AK1H 4Y0GA 2QTEA 3MBED 3KAAA 2WLZA 3B6SB 3GM0A 4P2RD 3SE9L 2Y9RT 4PRAB 4U1KB 3P73A 5ESQA 3ULUH 1LHZA 5K9QG 3ULVH 4TYUA 5IP4A 1OTSD 2VYRE 3GHBL 5F21B 3BN9C 3CSYB 4G5ZH 5JOEA 3MJ7A 2OP4L 2ZOKA 3QAZB 4HJJH 1GGYA 4PP2B 4DKDC 3IF1A 4BFEA 5JW4Q 4KHTL 3BGAA 4W4OA 1V7NH 4HUMB 3T2QA 3AAZB 3F12A 5SX4I 3D18B 5JA9A 2NPLX 5IMMA 5C6TL 1GYAA 1JFQL 2XKUA 1T03H 3L5JA 3C9NB 4M61A 1KSRA 1FPTL 2J6EA 3HC4H 1EVUA 1OAQL 1NCBH 4XWGH 4XHJC 2XZAH 1A9EB 1DBJL 3ME0A 1Y0LB 3MLRH 5CZVH 1I85C 3P2TA 3EOTH 1NC2B 4I3GA 4IRJA 4OCRH 3QEQD 4U1GC 4EXKA 1DL7L 3GMRA 2GSGA 1J88A 4LSRL 1JNNH 1HKLL 1G6RA 5IG7A 3WSQL 2FATL 2O93L 4GKSA 1KCLA 5GGRA 4LKCB 2J88H 1FL5A 4WFFE 4M4RA 4D9LL 1RZJH 3KVQA 3BEVA 5HYFA 3EO0B 1XGYL 2JB6A 1GIGH 1FBIH 3CH8A 3PWPD 4XP4H 4DZ8A 1ZE3C 3S5LB 2BRQA 2LAGB 5ESVA 5TE7H 4WUUD 1I9JH 3I6LE 3QUMA 1JZ5A 4OZHF 5J89A 1NC2A 1TJIH 4Q6IB 2PTVA 3F7YA 5JR1H 4PLJC 3ZHLA 2DQTH 2V2XA 1LE5B 2YSSB 3SO3C 2W38A 2EC9U 1MRDH 3LQAL 3VFPA 3WFBL 2GI7A 5E2VL 2IADB 4RFOH 4GRMB 5IQ7H 5D2NA 4MZ2A 1AGDB 5E5UB 3MO1A 4HJGB 5GS0H 4P5KA 2X41A 2HKHL 5BRZA 1P4BH 1WZMA 4M7LH 3VFMA 3LEYL 3PV6A 3OSKA 3EW3B 2ZG2A 2AV7B 1RUAH 1KENH 1ZWIB 2GEEA 5L2KD 1JCKA 5D2NE 1J1XL 4ZQKB 1OAKL 1QFHA 4ORZC 1NFDE 2MNUA 3OZ9L 4YUEL 2FYYA 3ARFB 4MNGA 1MCWM 4XRCB 1TJHH 3O45B 1ZVSB 3G5XB 5H37H 4QWWC 4GS7B 5TGBA 1MRFL 3QNZB 5D2NB 2Z31B 4Q2ZA 1FCCA 2V2TA 3MYJB 3PIQB 1HXYA 3H9SE 1QFUL 4JPVH 4LCIL 5DJCB 4MNQD 1FNAA 1MFCH 3G5ZB 1SJVA 4HHAA 5EU7C 5EU7E 1AQKL 1CF8H 2IAMB 4NIKB 4A6YA 2DQCL 3HN3A 1BVLA 4OZ4B 3GBMH 4DK3A 3RU8L 4M6ML 3WIIH 5TFSL 4MYWB 4J3TA 2XWJA 43CAB 1AQKH 4LVHC 5B8CB 2VKWA 4JFYB 4NJ9L 3CVIH 4YPGB 4L4TD 4QYOA 4Z7UB 1UM5L 3GI8H 5IJVA 2OQJB 3L1OL 4IS6B 4H1LB 4JFEB 2MCPH 3QFJA 2A0LC 1PG7L 1I85A 5IEKB 2B2XH 5I1DB 1N3NA 3KDMB 3HA0A 1S7WA 4AQOA 3ZE1E 3MLTA 5B38A 2R39A 1E6JH 4F9PC 3WDHA 2CSPA 2MHAA 1I8LA 1EAPB 3OF6A 3WE6B 4FS0A 4KJPD 5CD3A 1JK8A 3V5HA 2F9BT 4W4OC 1VFBA 5DRZB 4QT5A 1A3LH 3Q5TA 3LKOA 4PJEF 5I75C 5CMAA 1KIRA 4QCIB 1HILB 3TBTB 1N6QH 5IQ7L 1JMZA 4GXUN 1BFVH 1Q9OB 1JIBA 4E0RB 4XBEL 2C4XA 2NMSA 5C09A 1KLFA 2CRZA 5BV7H 4JFXB 2RJMA 4KY1H 1L9NA 5EN2B 4P46C 4TULH 1KJ2L 3TWCH 2R4SL 4XTRC 4AMKH 1KC5L 2XOTA 5C07B 2OJZL 4JGUA 4X6CB 4P2RA 1A1NA 3VRIA 1ZANL 2NXYD 1VFBB 2R1XB 3KS0H 2A0LD 1M71B 3VFSB 2ADJA 3HNSH 1TJHL 5ECJE 4OLVL 4M3KB 4JRWA 3BKMH 4I77H 4Y5VA 3D2UA 5D5MB 1JGLL 3H9ZA 3VXRB 4BUGA 2D2OA 4WNQA 4MD0A 1MPAH 4F7CA 1FFPA 1RUAL 1XF5B 3WKML 3VXTB 1SVCP 1BBDL 1KGCE 2VNCA 2JB6B 1MVUA 5FF6B 4P2OD 4LPVA 4U1NB 1GOGA 2NR6D 3QUKA 4HUVB 4S1QL 3BD5A 4QTIL 1CLCA 1OAZH 4JO3H 2ZOKB 3IB4A 4AH2B 2B1AL 1AIFA 1YN6B 4NQDE 1J8HB 4QRSB 1CL7L 4HQQL 5DJ2A 4DAGL 1MCIA 3OQ3B 5BRZE 1AXSB 4K3JH 3B3IA 5A16A 3N1PC 4JFOB 3HPJA 3MLYL 4LOUD 4PFEA 2CK0L 3DIFB 3PHSA 12E8H 1V7NL 1I7TA 4UI2A 2UY6A 1E4XL 4OI7A 3KPSD 1Q94A 1J8HE 3NGBC 1GPOL 4BZ2H 5BRZB 2PTUA 1UCTA 4JFQA 1NUFA 3VGAB 2VDRH 1UA6H 4R7DA 4G5ZL 1YEDA 3BHBA 4IMLA 2D7MA 5DD0H 4D9LH 4UIMA 1A6TA 4XXDA 5E8EB 3VRLE 3VXNB 1R5VA 1DVFD 1JZ7A 3D85B 3GJFA 4EEEA 3VGEA 3CIQA 3OB0H 5DXWA 5K59E 4LSRH 3QT2A 3LZFL 1CXIA 3P77A 5E6ZA 4NJAH 3T0EB 2A6IB 4HUUB 1YEGL 3WJLC 3JWDC 4QHNB 4TSAL 5JMOC 5HYJD 4HKZB 4RMVA 2VDKH 5H2BA 1W72H 2PXYC 5E94B 1GGBL 1MCLA 3RTQA 3ZKXB 3V4PH 4FP8H 5FUZL 3DECA 4ODSL 3MA9H 4UV4H 4MXVF 5ICXB 1QO3B 1T03L 4PJ7A 4EQ3A 5E8OA 1YNKL 2ATKA 3DYPA 4UIMB 1IAKB 2PO6A 4LEXL 2VN4A 1I3RB 2ZUQC 1AP2A 3O4OC 4PGZA 2HAZA 4R96B 2ARJB 3VE0B 2V2XB 1LE5A 3ILQD 1G7LA 1S78D 5LGHL 2NY2B 5E9DD 1GGCL 5GS1A 1F4AA 4OLWH 4D3CH 2BY3A 4GKNB 5GISL 3VXMD 5IMLA 1UM6L 4L8BB 3WIHL 1KPUA 4NRYB 4FQXC 2NY2C 4S1DD 4JM2F 2NW2B 2HG5A 5DD1L 3HI6L 4M1CD 5D96B 3CFCH 1I8KB 4PJ7B 5KSUB 2P7TB 2HT2D 4W6XB 1V3LA 3FO9A 4LAJH 4MGXA 3WHXA 4NKMB 5HHOA 1EPFA 1RZIA 2IANE 3T3PF 3G6DL 1S7UB 4LQFH 3GRWH 1OP9A 4TSBL 1F4XH 5C09D 4ZUWB 1XIWD 1OTTC 2DN7A 5I6XC 1EERB 1S7RB 5CJOH 5GZOC 4DEPC 4U1JB 4O02H 4PJXF 3NTCH 5CEXA 3FONA 4YBHA 3MUZ1 4P3DA 3WMSA 1IM9B 1JF6A 2OZ4H 4UDUA 3TBWA 3FZUD 3GSQA 1EVTC 4PGDA 1YEJL 2JK5A 4ZPVA 1QD0A 4M03A 4IBLT 4IRZL 3AMKA 1S7XA 4KVCL 4XWOD 1MWAL 1IAMA 3L9RB 3UJTL 5ADPL 2VAAB 1QRNE 3VU2A 5FHAH 1MLBA 4NFDA 4RGOL 4OCYL 3H9HB 1NCCL 1A6UH 4TTGA 3VFVA 5L9DL 5AG8A 2NY3B 3KLAB 2VLRE 1QEWB 4WEBH 3W2DL 1YEFL 2GTZB 2FLRT 1EJOH 2VL5A 4PJCA 4XMLH 1A7QL 5HVHC 3S5LG 3CFKB 2Q8AL 2V17L 2R8SL 3VG0L 3BZEB 4JR9L 5LWYL 3UTQA 5CJQH 1Q0XL 2CIIB 1KJVA 4LLMA 3G6JE 3RQ3A 2HLFC 2YOCA 1MHPH 4OV5B 1T21B 2AEPH 1BBJA 5JW5B 2F74A 5T3ZD 5IFAL 4B53A 4XBPB 1CGVA 3ZE2F 4L1HA 3PWPB 3DUHA 3MODL 2I25N 3P9MA 4PTUA 1LGVA 3ARRA 4HFWB 1T89A 3NMEA 2UUDH 3DYOA 3TH4T 2CRIA 1IZJA 3SOBH 4LVNB 2JJTA 5I2IB 3PNWB 1FN4B 5EN2A 3LQZB 3PWPE 5EO9A 4LEOB 4RWHA 3BZFB 3S98A 3PL6D 5I1JL 4O5LH 1LK2A 3FQWA 3SDCD 1L0XA 4R3SA 1QBLH 1FL3B 4PUBH 1RUPL 1A6TB 4XXDB 3BH8A 3OL2A 4M43H 5HHXH 5E99H 2C4FT 3BH9A 4LSVH 5IB4A 4LLYA 4HK0A 3VRLF 2OTUA 3NACL 4LCCC 4L29B 3V6FB 1YDPA 3FT3A 4U7SA 3EYSH 3H8NA 4P3CH 1CG9B 2HT3D 3WIHH 2P42B 1XFPA 5D2LA 3SEPA 15C8L 3ETBF 3WV0A 5L2KB 1G7MB 2CUMA 3TT1H 3VDBA 3VD5A 4Z95L 3HZVB 3MACH 1PG7W 4UB0H 5D9SB 4LSPH 2ZNWA 2JKXA 5ALCH 1S7SA 3B5HA 1ZGLM 2EYTA 2ATKB 4K8RD 1WT5A 2HFTA 1UB5A 1JJUA 3I2CH 3R1GL 4XI5D 1YNKH 1YUHB 2W07A 3FRUB 2NZ9C 5EO1A 1EHAA 5T5FL 5D2LF 1EH9A 1RMFH 3U9PH 1CK0L 1W72L 5IR1B 5JXAL 4L8BA 1JZ6A 1U6AL 2G9HB 4HIIA 4P59H 4GBXD 2V2WB 5HI4D 3GB7A 5TJWK 1YEGH 4BFIA 4UINH 1VFAA 1GL4B 3DX9B 4YGVB 1HE7A 2EIEA 2JIXB 3IDGA 4ZSOA 5HPMB 2QJDA 3C6SA 1ZS8A 1R3HB 1BZQK 4P5TB 5E6IC 1JYXA 1S7SB 3N85L 4K3DL 3Q1SH 3HE6C 4UT7H 4UIKH 3T65A 1B4RA 4PRNB 3QDGA 3EGSB 1BVZA 3BUYA 3K1KC 4RZCA 3NN8A 2Z8VC 1XZ0B 4U6YA 1T5XA 3MV8A 3IXAA 4LLUA 2EXYD 4NN6B 4L3CB 1D9KD 3VH8G 2OTWB 3BZDA 1IMHC 2V9QA 1A14H 2BXZA 3RNKB 3IKCA 2ZKHH 1QG3A 1MWAB 3ROOA 4BJLA 1B6UA 3QIUD 2GAZB 4YDJA 4LOUC 4JQXA 1A47A 5C0BA 1GZQA 1YY9C 4D9RE 4H1LA 4MJ2A 4N90E 2J8UA 1CZ8L 4F33A 2LTQB 1E4JA 3T65B 3TT3H 2RBLA 1MCJA 5KSAD 1CGUA 3VE0A 2W0PA 4JJ5A 2OTPA 1TQCC 4HXBH 4PJHB 1K3IA 2YPVL 1HHGA 1C16A 4G7VL 4L8SA 3LIZH 3MV7E 5JORB 5SWQB 4H25B 1OAUL 3F5WB 1MPAL 3FQTA 3LKNB 1L9MA 4CU8A 2HRPH 1SJEB 1X3DA 4L4VB 3VFWB 4U31A 5M95B 4KTYA 1RJLA 1D5IL 1T22A 2H8PA 4NZRH 4OLVH 4Y5XC 1IM3B 3KHQA 4R9HA 4RAUB 1IFHH 1J8KA 3DIFA 3KPRA 2WBWB 3UZQA 1X5JA 2VISA 3PJSA 5IHLB 5IWLC 3SDDA 3CX2A 5TQ2L 3FTGA 4ERSH 1DE4A 1WZKA 4WUUA 3VWKC 1RMFL 4FZ8L 1QACA 5DJ0B 4HEME 3PHQB 1HHJB 4G7YH 3T3ME 3CDCA 4KMLB 4KVNL 4P2OB 2CKBL 2QSTA 3ARGA 5I0DA 1YEIL 3KPSA 2XY2A 3LHPH 2ZOLA 5CEXB 3NIDE 4PJGA 3VWJD 3IJHB 1CE6B 5KSBB 2BNQB 3H9SA 4Z95H 3QIBD 3CMGA 4KH2A 3LRHA 1V05A 4KJQC 2OZ4A 1C5DB 5CGYD 3DHMA 2Y36H 1XF5A 4KRPD 4GJTB 5DJDA 1RY7B 2B4CH 2HFFB 5HI3C 1U3HD 3BH9B 5IB4B 4NM4L 4CMHB 5DJ0A 2A2QT 1PLGH 5HDQH 1NEZA 1NGYB 5AUMB 3WFHB 2VZ3A 4DEPB 1EIBA 1MCQA 2B2XL 3MRHA 1RUMH 5DEGA 5E2TH 4BSVA 4D8PA 4G6JL 2JLLA 3FMGL 1FORH 1UWEL 1EHNA 2AABL 3I9GL 3QFDB 4U6VL 1OM3L 4HS6B 3NZ8A 3WIFB 4K23H 4OIAA 5J6GA 1J05B 5EBMA 3CFJB 5C0FB 1CD9B 5FDYA 2NQCA 4FQPA 3Q48A 4LLWB 1I9EA 4R7DB 3HZKB 5CEZH 4NZTL 3GJEA 1NJ9A 3Q6FB 4GBXA 5FO9A 2H9GA 5IB5B 2EO9A 1MHPL 4QRUB 1MQKL 5CD5D 4TOYH 5C08E 4Z7WA 2EXYC 3O4LE 5MEPA 3HUJB 3VFRB 4ZUUB 4M6NL 1CLOH 4CW1A 5BJTB 2OLDA 1OY3B 5C2UB 4JKPH 2D7NA 4WI3A 5AZ2L 2E9WA 1OAKH 3QFJB 2H26A 4R3SB 1J1XH 1PG7X 5FM4A 1IAIH 3QXVA 4K2UL 3IF1B 3QG6B 3RTQB 2EKJA 1I7ZA 1FNSL 1J0KA 3MV8B 2H9GB 5FCUH 2MHAB 4JLRA 5C2BH 3CDGB 1D6VL 4WHYH 1MREL 1FG2A 2JK5B 4NRZA 4R0LC 5HGGS 3X3FL 3MRNA 4CJ0A 4WW2A 1NCDL 3FT2A 4C55A 3OKEB 5AAWA 1Y6MR 3EJZD 3ZL4H 4WHTB 1CICC 4Y4KA 3GSRB 2F8VA 1X6LA 4J1UA 2V9RA 2HN7B 3F58L 4I48B 1RD6A 4YX2L 4JM2D 3WHE0 4JG0L 4OFVA 2PW2B 4UDTB 1XIWB 1WTGT 4HX1B 3MRMA 5CILH 3JWDH 4Z7WF 4OD1H 1RPQA 3IRPX 2YC1B 3MBEC 3O3AA 5T1KD 3ROLA 4P2RE 1FZMB 1ZT4A 4PLJD 1CCZA 4DN3L 4WVRA 2BY0A 1I9RH 4ZAKA 2R29H 43CAA 5MERA 2E7LA 1C8PA 3RJQB 2D0FA 3BPOC 5C08A 1FLRH 4LSTH 2H8PB 3KPLA 5FDWA 1NGZB 1JNNL 1DQTA 1OGAB 4KQ3H 4PRDA 3I3BA 2Q87A 5D5MA 1NEZG 3KLHD 4NQDB 5KBNC 2NYYD 1JPFB 4HPOH 1A2YB 2OBGA 1U9KA 4N8CL 4R2GB 3U2SA 2VMFA 1NCBL 1YZZA 3GZKA 5C0BD 5CBAA 2NY3D 5LGHH 5CJBA 3ES6A 3DX6A 1XF3A 2Q3ZA 4JZNA 3D3VA 4X6DE 3PHQA 1B0RA 1PFCA 3W5MA 1W8NA 2EE6A 4G6FB 4P9ML 1MCSA 2Z92A 5DRWB 4ZO8A 1A6VL 4FHBD 1ZLUK 3QUXD 1TZHA 4UUJB 4MMXC 3MGOB 3IDYB 4JFOA 2IGFH 4Y16B 4LGSB 5GPRA 5SWSD 1YQVL 5GGRB 1UXSB 2HTKD 4QRRB 1X5FA 5A2KH 3WDIA 2ITDB 3MLSH 2W9EL 1VHPA 1BF8A 1U8MB 4JFDD 4JFXA 1M6OB 1M7DB 1MCEA 1SJHA 1ZTXL 4XHQA 4LLVA 4NN7C 3OMZA 5H35A 4CAGA 3OKMA 2EYTB 4K8RL 3SE9H 4LASH 4LLMB 4AIOA 4NQCE 4E5XB 1NFKA 1WZ1H 4ZUVA 2IQ9L 4PRPD 3V0VB 2E7LC 5BS0B 1IILE 4OZHE 1INDH 3INUH 4CNIA 1B4JL 1RU9L 5CILL 4XCFL 3SO5A 2IPKB 1FGNL 2A1WL 4MA7H 1P1ZB 4HIXL 4JRXD 3FQNA 1TTGA 4NHCH 1VB9A 3UTTE 1IGTB 1FE8L 1NANI 2FX8L 4JDVB 1BJ1J 3HE7D 5DZNA 3PV6B 5EO9B 4L3ED 1XCQA 4E42A 5ADOH 5CSGA 1VKXB 5DA4A 1YPZA 4ZXBA 2VXQL 1MY5A 5J06A 4H20H 2EKSB 1YEHL 2CRYA 3VFTB 1I8MB 1S7VA 1MREH 5E9DA 3P0VL 1FFNA 4MSWA 4JDTH 2NNAB 5JTWA 2X09A 4FFWC 4GG8B 4WCYL 5ID0A 1DSFL 3FL7A 4N8VG 5DHYB 2ADGA 3TEUA 4CVZA 3U30C 5IMLB 4A2MA 3U0PA 1FNFA 2J4WL 4HZLB 1KEMH 3MJ9A 5E1AA 4WI2A 3F7VB 4NQDD 3ZTNL 1T5WA 3LS5H 4N5ED 2IAMA 5FGCB 5ANMB 2EE3A 4PB0L 4YDJB 4HMCA 3N06B 5HDBE 2YUWA 1CLOL 4X80H 4XNZB 5GJTH 4XCYB 3BP4B 4WWKA 1T4KB 3D87B 5FO7A 4HDIA 4JM4L 4XPBL 5IB3B 1ZANH 4XT1C 2EDTA 3V4VL 3FRUA 5MEOB 3W5NA 1NCTA 1UFUA 3DRQB 5HVHB 1NKOA 1V3JA 3MOAL 2ZCKL 1H15B 2GJJA 3OAUH 1E27B 2DJSA 3R0MA 5DMIH 5EZIH 1JYVA 5KS9B 4RQQA 4Y8DC 4H1LH 1GAFH 4FQ1H 5FM8A 1INQA 1OTSC 2JB5H 3B2UD 3T09A 5DZLA 3L3OA 3QEHB 1JWUB 3PWNA 4C59B 4MJIA 1U58A 1NAMH 4UQ2B 4UDUB 3TBWB 3NFPB 1NJ9B 3KPRE 2HVKB 1KPVB 3FMGH 3KYKH 1YNTA 1BJMA 2W9LA 4OAWA 5HGHB 3C6LD 4OGXH 4YFDB 3ZE1F 5IVXF 1IGFL 2R69L 3WJJC 1AP2B 2FX9L 3U7AA 4WW1B 5IROA 4Z18A 3C60B 3JV6A 3ISWA 4XNQB 3G6AB 3WDJA 4Z7NE 3OAZH 2E8YA 5FB8A 5I1CH 5E4IA 4LBEB 4OFYA 4F3FB 3W0WA 4WFGD 3IDIB 3O3BB 1VGEL 3ARPA 2VZVA 3ZKMC 4MJ6A 5I8CB 3IKCB 4HAGA 4PLOB 1PG7H 2AK4E 1WEJH 4GW4B 5CKGA 1HQ4A 3QJHA 2NW2A 2VDOH 1JGDA 2P8LA 1U3ZA 5EUOE 3CVIL 3TFKC 4DFHA 1HOCA 1DN0B 2Z93B 5ELIA 3LS4L 3MNWB 4OZFG 3LHPL 1CDUA 4PRAA 3RBGA 2J8HA 3JVGC 4OD2B 4F2MA 1OF2B 1VPOL 4PD4K 4DVBB 1ZSDA 2ZUSA 3CSBA 1UWGH 3NCFB 4GLRI 1RHHA 4J4PA 4XC1H 3D25A 2EXWD 2HN7A 3QUZD 5DRXB 1QLRB 2J5LC 2CMRL 3MJ8A 2ED7A 5I73C 1XR8B 3BQUD 1FYHB 3DSFL 4FQIL 3FKUS 1NFDB 1UH2A 1L0QA 3RVUC 1O7SA 3LQZA 3UCRA 5EPMB 5C09E 5IB1B 2J5LB 4N8VA 3C5ZB 2H2SC 5A2IH 1BFOA 4PJIB 1ZEAL 4QXWA 2CR6A 3D48R 1BM3L 3LIZL 3NH7L 1H5BA 3MRFA 4JVPA 5ICZB 4JFPA 3PDDA 2ZSVA 1RZKH 5DRXA 3O8XC 1U3HB 4YHYB 2PYED 3ARDC 1E28B 3V6ZB 3QDJD 1CLZH 1T20A 2R0WH 4Y5XB 1KNOA 3O6ML 4NQXB 4RFOL 3H9SB 2DLIA 4Y2DA 1T66D 2W60A 3GBNL 3QI9D 2NY4B 5D1ZA 3QNYB 3RA7L 4AY0A 4FFVC 1YYLL 4Z0BH 3QIBA 3KYNA 3AM8A 5IJKC 5FA4B 4EI5A 1RIUL 4HKBB 4PS4H 5EO1B 5DTFA 3GSNH 5K9OA 1FH5H 5TPWH 3FCTA 2C3XA 3BGMA 3O3DA 4OFKA 3KXFB 5IR1A 1EGJL 1X5GA 1D6EA 5E8DL 3FFCE 4QHUB 3PDGA 1PKQE 4ODXA 3BDYH 3QQ4B 4XMKH 1INEH 1O0VA 1GC1H 5DD5L 2KQMA 2YD3A 4X8JA 4UZGA 1KLUA 3GSRA 2W60B 4WFFD 5HPMA 3DMMB 1KB5L 5CLTA 3WIFA 2ICEA 1ACYL 1XCTB 2QBWA 2YMXH 4KRMB 4UINL 4P2OC 4PJFB 5H94B 2P43B 3KPQA 1FVCA 2YUVA 4NQTA 3GK8H 2P1YA 3MLRL 1FIGH 3STLB 3O4LD 5HDBF 5CZVL 1ETZA 4L9LC 4MCYA 4XWGL 4HUWB 2BXYA 1IM9A 1FYTB 3PWJB 3GJEB 2B7DT 2XFXA 1KJ2A 2P24B 5DK2A 5T33L 1SEQL 4QHUA 4CUCA 5KVGH 4OTXH 5KVFL 4QHKJ 1JRHH 5LBSH 3QJFA 5E2WL 3E1F1 5BXFA 1G0XA 1A6AB 4QCIA 4KHTH 1WT5C 1AE6H 1BLNB 1DBBL 4TQEH 5D9SA 4EUPB 5C7XL 1QVOA 3DOSA 4P23B 1S9WA 3ZDZE 1CDYA 2RIKA 2AJYH 3X14A 2B5IB 2BZDA 4NQEB 4OZIE 1WC7A 4HIEA 1LDSA 2EDKA 5GGVY 4ZAKD 3QHFH 3C60A 3JV6B 5L88L 1LO0H 4GG8A 1T6VN 4I0PA 2E27L 2VXVL 1FFOA 4EXPX 3P4MA 3X3GH 2P24A 5JORA 3BZEA 1HIMH 4OZGF 1K6QH 3U0PB 3U1SL 1N0XL 1IL1A 4Y19A 2FEDC 4NN5C 4NZUH 5T1KB 3CU7A 4FTVA 4NKQB 1BBJB 5J13C 1M71A 3VFSA 3VXRE 1JGVL 3MUGB 2EE2A 4KROB 4CADA 4ZNEE 4YO0B 1T1XB 2Z4QA 4PJ8A 1QBAA 4LU5H 4WO4C 4XPGL 4F9LC 1UENA 3QI9B 25C8H 2D4DA 1N4XH 4HW6A 1FFQA 1I7UA 5I1GL 3LRGA 3KPOB 3O3EB 5GRVL 4LCUA 2EC9T 4X6EA 1YY8A 4R2GD 3LN9A 4FA8A 5FOJA 2DMCA 1ITCA 1F2XK 3UPAA 1AY1L 1MJ8L 3EFDH 2I9LB 3KHOA 5BOZG 5LWYH 1AGEA 2VDOL 4OCXH 3Q0HA 2FSEA 4RMRA 3WLWC 1UWXH 2F5AH 3K8KA 4ZFFA 1FCGA 3SE3A 3EO1A 3W0WD 5GIRA 5I19H 4WEBL 4HKXB 2JJWA 3OXSA 3MUY1 3SDXA 5HHQB 3FB5B 1YEKH 2AQ3A 4X7FC 4NWTL 4OCYH 2AGJL 2E7HA 2H6PA 1QSFD 3QQ9D 3ZSSA 3MRCB 2FEDD 2EDOA 5F1SA 4KJPC 3GKWH 4OSUH 5LKNA 5CZKA 3S96B 4ZO6A 3OJVC 5I8CA 3Q5OA 3IJYA 4ZOBA 2VABB 4H8WH 3CDYA 1MQ8A 3T8XA 4IHOA 4BK4A 4K94H 1DLFH 2WIIA 1FN4A 2Z8SA 3SJVD 4PRPB 3AB0C 4OM1H 1JHKH 3QNYA 4OCSL 2IPTL 3FFDB 4P23D 1BOGB 5LAXA 1CQKA 4AEFA 3LH2H 1T83C 2IFGA 3FT4A 4YDKL 1GHFH 1BIIA 3B9EA 3PGFH 5FO8B 3DX9A 5GS0C 1JZ2A 1L0YA 3NAAH 3EJYC 1CR9L 3HI1A 1GGUA 5IFHH 4U1NA 1FL6A 4NUJB 1D3CA 4XBGA 2VIRB 4LPCA 5JA8B 2X9YA 4POYA 1SM3L 1DEEA 5I1EH 1OLLA 4HGWA 4JPWH 4JVWA 5F1NB 5C0CD 4JDZB 4UT6H 5KG9B 5LGKA 5J1AB 1CE6A 2YBRA 3UTTD 5HJ3B 3UBXG 5KSBA 3HR6A 1KLUB 4KROD 5DDHA 3I02B 4PJDF 2MTPA 2CO7B 4O51A 1JVKA 3V5DA 4CU6A 1KGCD 5DC0A 4HV8B 4JRYB 3OPZH 4IRSA 3RVXD 5ETUA 5F89B 3SCMA 3QG7L 2ITCA 2D7PA 4YPJA 1UH3A 2FGZA 5EH1A 5IVZA 1JN6A 1WBYA 4IIQB 4PJEE 5F3HA 2XRAH 4Y1AB 5DK2B 3RBSA 4AIZB 2PF6A 1OD9A 2QHLA 3P73B 2NY0C 4JJHA 3VCLB 3ARYA 3MRRB 4JG1H 5I1LB 5FECB 4YHOH 2P4AB 4RGNE 1R6VA 1MJUH 3TO4A 3PXHA 5HHVH 3CVHH 4MD4B 2W9DL 3KPSE 1UXWA 2A1WH 2EXWC 3DJ9A 3MRIB 3WXWL 1TQBC 1JGEA 4EN3C 4UTBH 4I3SH 1DUYA 2B1HL 5K9JL 1KULA 1SYSB 5EA0H 2ERJC 1C7SA 2IQ9H 3LZFH 1KTDB 3L3HB 1OGAE 4X9HA 5C0EB 4KKAC 5IIEA 3HMXH 5IB3A 1BQHG 2VLLA 5HGDA 1IGIH 3G6JB 5F7EL 5GRJL 4WWKD 3HG1A 3NCMA 4KK5D 4DKAA 1WAAF 5DSCB 5CMAB 4PG2A 1YQVH 5I66A 1NLDL 1SYVA 2EDYA 1BEYH 1S9KC 3HNTL 4OT1L 4QY8A 1VFOA 1T1YA 3PGDA 4MAYC 4PJ7F 1JF1B 2ZOLB 3NABL 4UNUA 3STLA 1MJUL 4M7KH 3WO3B 4Y4KD 4HUXA 2I26N 4OLXH 5CSBA 1M1SA 2WUCL 3DX6B 2OCFD 5BZDB 3O6FA 4N9GA 3IU3B 2B1AH 3VMNA 4QKXB 1AC6A 1KJVB 4CMHC 1BQLH 3ULSB 2HJLB 5DSCA 4LSDA 4UUJA 4N68A 3T2NL 4FFWD 5ESVB 1QVOB 1EFQA 1N8ZB 4YWGH 1NEZB 5AUMA 1U91A 3LMJL 1G6VK 1ZA3A 4LPYA 2Q86B 5IVOA 1FLRL 1FZJA 3L95A 1CN4A 2ADIB 4I77L 1HDMB 4KAQL 3UBXA 5DQJA 1KCSH 1U2HA 4XNMA 3HFML 3WO4B 2AJZB 4M1DH 2BVPA 3LV3A 4POUB 3ARGB 4XXCC 4G9FD 4RA0C 3LD8C 4YDKH 1F90H 5IBTH 5FDWB 1CFSA 3TWCL 1DBML 2YR3A 4KY1L 3HPLB 1YA5A 1P4LB 4K3EH 4PGEA 3V6FA 3PQYB 5MP6L 5E00B 4ZQKA 4XBEH 3VI3E 4P46A 4XNUL 5IBLD 1RZJC 5IT2H 1GZPA 1QA9A 2ADIA 5D72H 1CGSH 4D0BB 3NCJL 4AEIL 1PQZB 4C54A 5TDNA 3ECBA 1LEGB 1QLEL 3CH1A 1D6VH 1A3LL 4RMTA 1MH5B 4Q0XL 1ZHLA 3KPNB 1A6ZB 2WQ8A 3ZKNC 1FO0B 2BVUA 3UTTA 3SDXE 1YUHA 1JPSH 2ZG1A 2F74B 1N0LA 4TN9A 3PWJA 3ULUD 2CDGA 5ID0B 1TCRA 2CR3A 2IBZX 5DJAB 5DRNA 3MGAA 3VXQB 4KRPB 4CU7A 3P9MB 4PTUB 4HWBH 2CLZB 3CFEA 5J6HA 3KS0J 3F7VA 4XVSL 4LLAA 1NL0H 4C83A 2R2HB 4O2CA 4OCXL 3UJJH 4Y4KB 3ECBB 3CLEH 1JGUH 1MOEA 4M6AA 1MQKH 3LEXA 3S36H 4DTGL 1XIWC 2AJVL 4Y1AA 5FYLH 1I3RA 3IJYB 1W2KT 2VZTA 3V6BR 3M1BA 4QRSA 4DGYL 2Z0BA 1HNGA 1IKFH 2ATPB 2WIIB 1X5XA 5FYLL 3P11L 3RIFF 3LKRB 3SO3B 4M1GH 3RUGA 1CD0A 4LU5L 4XPGH 3CC5B 4I4WA 1ZHNA 3SKMA 3N50A 3MRQA 2H26B 1B88A 1EFXD 5DK0A 3ZE0E 1WAAA 1M7IB 4L4VE 2BMKB 1GVIA 3JTSB 1NUDA 4B7LA 3BN3B 2M26A 4KGLA 3HZVA 5L6YH 5IV2B 1P7KB 3QO1B 2Z4QB 5AWNH 1SVZA 2ESVB 3G08A 4L8CB 5D6CA 5A40E 1BF2A 4Z6AT 2BOBA 1G7HB 1PBYA 4OFYD 4Y5YC 1LDPL 3EO0A 5SWZE 3TZVD 3ILPA 2X4UB 3H0TA 1MCFA 2DD8H 2IALB 3SE8L 3S37L 2YD5A 5D7LE 1X5AA 2FHBA 3MJ7B 3IVKB 2YHGA 3J7HA 3N1GC 1WAAE 2DQHL 2X2YA 3PGDB 2CKBA 1CGSL 1G9MH 3CXHK 1AKJB 4PG2C 5DO2D 3BKCH 5LBSL 3NBNA 1CICD 5DHVH 1IC7L 3EJZC 3FHQA 3MV9A 3V6OA 2ZJSL 5TDOA 5FGBC 5KVGL 4EUPA 4RAUA 2GYSA 5DJXA 3RI5K 1AD9A 1B0GB 2AJUL 5DVNA 2E6QA 5AD0A 4S1RL 5EC2B 3Q3GA 4HBQA 1WFTA 2EYSB 4JZOA 1GSMA 3IGAB 2CDFB 4O2EA 3BUYB 4QWWD 4YEEA 1ZLWH 3NFNA 1IGML 4KDWA 5DHVA 2EEAA 2FDBP 3ILPB 4K7PY 4Y5YB 1LO5A 5T3XH 4MB5A 1CFNA 1P4IL 2P48B 4NNXB 3VWKD 2VXSL 4I0PD 4R26H 2AEQL 1IL1B 3QSKB 1NGXB 3X12A 3HS0B 4HJ0D 3KLAA 3MXVH 4JFZL 3W9DA 3ZT6A 1TVHA 1SEBA 5K9KB 1RIVL 5TDOB 5IMKA 3ARZA 4R6UA 5CP7A 3TCLB 3WFCH 4Z78B 1I75A 1TTUA 4OIIH 2O5ZL 1FH5L 5CD5C 5M94B 3QIBC 5HGDB 3NIGF 1IARB 3GMLB 3PDOB 5E2UL 2UVEA 3L6FA 2XN9E 4X4YB 3TP4A 3Q2CA 4LCUB 2I5YL 4GQ9H 5ITBH 4KMQA 1PGRB 4GAJH 5C6TH 4F7MA 1QSFB 3SQBA 4KK6D 2F19H 2ARWA 1UH4A 4HGWB 1KCUH 4WNQB 1R3JA 4M7KL 3B9VA 1CTNA 1TZGH 2YD1A 4R0LB 1AO7B 3O0RH 3RUGE 4ZMAT 4PJAF 4KV5F 3QUML 4CVZB 4X4XB 5H35B 3MNWA 4Z7VA 5KJRH 2OP4H 3O2VL 4ELMA 1NSNH 1WF5A 2IH1B 2HJFB 5C0CA 5D8JH 4S1SL 1MI5E 1KG0A 1ZEAH 1T6WA 5HBBA 3BP5B 1EO8H 4QRRD 1WIUA 3H9HA 1LP9E 4EOWH 2ICCA 4MAYB 2HFGH 1F3RB 4NN6C 2WNGA 3OG6B 2DLGA 2COQA 5JW4M 3G5VB 1OL0A 2DLEA 1CICB 1I1FA 4KUZH 3RPKA 4KI5E 3FFCA 5JDSB 3QNZA 1I4FA 3MNVB 3N1FC 2ARJQ 1NC4B 2ZUUA 4NKDB 1ERNA 1W72A 4CN1A 3DXAE 3LV3B 5BMFL 5C0NC 3WS3A 3JV4B 2D7TH 1R5VB 4K9EL 3L3JA 4RWYL 4PJ9D 3V9FA 4HUWA 1A7OH 2DQIL 3SY0B 1BVLB 4OZ4A 2H41A 4JFPB 3CSPA 4HIHB 4OZIB 4OAWB 1UKTA 3I6GA 3QH3A 1DEEB 4ODHH 3DBXA 3IFLH 3FO2A 3FO0L 3REWB 2HMID 1FZKA 1ND0A 4U49A 1M7IA 2Z35A 1X7QA 4RGMB 5KSVA 3O2DA 3SE3C 4MD5A 3QIWB 1PQZA 4P3CL 4QRTB 4QYOB 4Z7UA 2D31B 3GEWB 3BZFA 1VGEH 1RIHH 3VXMA 5J3HC 3N9GL 1N59B 3NACH 1I4FB 4AENB 1A6ZA 1KCKA 1MHEA 1TJGL 5I18L 1CD1B 3HR5B 4RX4A 2XG5A 3BPNB 4DN4H 4PRBB 4LGRB 2PW2A 4UDTA 5L0QC 1CWVA 1H8OA 1F42A 4J6RH 2FX7L 4U0RB 5EU5A 1OSPH 4L5FL 3C5JB 2DLTA 3UPRB 1Q72H 4P3WA 2DLHA 4ENEC 3S88H 4YZFE 1ZVSA 2ZP0T 4E41A 2NTSP 4LCWA 4FQHB 1NLBH 3MLUL 4QXTA 2UZIL 2BRRH 1PY9A 1Q94B 2FJGA 3G5YA 2AEIT 2OL3B 3BN9D 5BVPL 2C1PB 4JQVA 4O2FB 2DM3A 4XPBH 3RGVA 4X6EB 3B9KA 3EYVA 4Y4HA 4F3FA 5C70A 2R8SH 1S7TB 5F7MC 1K8IB 3QULA 2DQDL 3CSYA 2VLLB 4ISVB 4MJ6B 4PB0H 3GM8A 3LEVL 4WW2B 4YBLB 1EUTA 2I27N 4PP2A 3BAEH 2MQ3A 5DMGC 1AXIB 1VA9A 1JMXA 3PL6B 4OBRA 5EU3A 4RGOH 3MRLA 1DQLH 5I19L 4L8CA 3GSUA 3TZVC 1Z5LA 2XZQL 4UNVA 4M9PA 3UO1L 1EXUB 1A4JA 2Y6SC 3RL2A 1M6OA 1HKFA 3MROA 1KTKE 3WFDL 2XG4A 4PJ9B 4BH8A 4DGVH 2QKIA 2DBJA 3CH1B 4ODHL 2M8XA 1EAPA 3UJIL 1J0YA 1PZUB 4S2SA 4P2OA 4J3UA 4MHHG 5DT1L 3U7WH 1UJ3B 1EUUA 4WHDA 1SY6H 1W0YT 3MLUH 1RVFH 4K9EH 5JHDA 3D39A 4LRNH 3T04D 4GRLA 1YC8A 3ARGD 4JKLA 1G6RB 5IG7B 1DZBA 3SN6N 4JFFE 4N8VB 1U91B 3S88L 4ZTOH 3R8QA 3BKJH 4DKEH 1ULVA 5BVJA 1DBKL 4ELMB 4HZAA 1EXUA 3A0OA 3OAZK 5CP3H 1JNHB 3VXUD 2XPGB 4NZUL 5AEAA 4MAUL 4G43B 4QRQA 1MI5A 4K71B 3D39E 1JTOA 4NO2A 3ELAT 5C1MB 3CX5K 5J0BA 3F5WA 3FQTB 2IANB 3QCTH 5BQ7B 1NUGA 1UJ3A 3KWWB 4LLDA 3X12B 1E28A 5D1ZC 2HT4C 3GUTA 2FSEB 2ICWI 2DYPB 4HS3A 1OSZA 2ZPKH 2FB4H 5DF0A 5KJRL 4HKXA 4HS6A 4HFUL 1MF2H 3GHEL 1I3GL 4TVSa 5JNYA 2A73A 5I8EB 5ANME 3P4OB 2N7BA 4NYLB 4O4YL 5I1KL 3QDJE 4RGNB 2YPKB 3T3PE 4BFIB 1L7TL 4ETQB 1TZGL 2DLFH 4JPIB 5J13B 1WSST 4DWHA 2A9MH 2ORBH 5ETUB 5D7JB 5DTFB 3MRCA 2PYEB 2ZSWA 3LDBC 2HLAA 4X9GA 4F7TB 2DTML 5ESAB 4ODSH 3O2WL 4NC0B 3CXHJ 4Z7WB 2I5YH 3QIWC 3EDEA 4NUGH 4QOKA 4EN3D 2Z35B 3VFOB 3TPKA 4UU9B 2P8MA 1R5WA 3D0LA 4IOFD 4M62H 2DKMA 2NY6D 1RZFH 4F8TA 3WXVH 3I50H 4GLRH 4PRIA 2BC4B 5DD5H 1FO0L 4FTVB 2E9IA 4DW2H 3RY5A 3NA9H 4ETYA 2HLAB 5C0EA 4M48L 1NBZA 5I74B 4R97C 5DVLA 1P4IH 3TA3A 3CPLB 4R90L 2VLRA 3GSNL 2IBZY 5HI5D 5E5MB 3JWDL 4QXUL 1RIUH 1Q9WA 3W81A 4YC2C 4DVRH 4BZ2L 5B8CA 1GPOH 3EFFB 3LKRA 4LBEA 4YQXH 4NDMA 4FN0A 1S9YB 3T0WA 5DFVD 1X4ZA 1Z9SA 3ESUF 2X1QA 4YHNA 4O51B 1FNEB 2FRGP 1FRGL 5KANG 3ZLQC 4QHNA 4YZFF 4K3JL 4GMTH 3TO4D 4Y19E 5F72S 4GAJL 5JQ6L 5DQ9B 2J12B 3SY0A 1P7KA 3QO1A 4QTIH 4XNXH 5IROC 4TTDD 3RZWA 4OZIF 4PGBB 4C57C 3C5ZC 5FCUL 3VXSB 4PJIE 3BPLC 3IFNH 3KNBA 3R06B 1G7JA 2GJZB 4ELKA 4NP4H 4Y19B 3MRRA 2DI9A 5J3HD 5F9AC 3BEWB 4IOIB 5DWUH 2XTLA 3VWJB 1PEZA 1IKNA 3QXUA 5SX4H 2X4RA 5FHBH 3CNKA 3DXAA 3RZCD 1IBGL 2XICA 2OI9B 4QTHB 5K93A 5A3IC 4PTTA 2KPNA 3P9LA 2DKUA 2DM4A 5I1IL 5C09B 1LEKB 3VWKB 3DNKA 2X4TA 1ZLUH 4PJDE 3DROA 3K4AA 4E41D 2YZ8A 4I1NB 4FQCL 5D7JD 4KTDL 5HYIA 3ZYIA 2L4OA 1J1PH 4X4XA 4PJAB 2PXYD 2P7TA 4PGBA 4QHMA 1F45A 3VDCA 5EU6B 3RHWF 2R4SH 2YN3A 4NZTH 4OJFL 5C0ND 3OG4B 3QP3A 4NCC1 4TULL 1S5IL 5GGUB 2AJUH 1KTLA 5D7IB 43C9B 5B4MD 2IAMC 4DZ8B 1MFNA 1ZA6A 2YA2A 2VIRA 5I6XB 4HBCH 5EU6E 2ZSVB 2H1PL 3SDXB 3I9GH 3VXRA 4PP1D 1W8OA 1ZLVK 3AAZA 3W11C 3G5VA 4XVSH 2DD8L 1DE4B 1JGDB 2P8LB 1F58L 2NY3C 1I1FB 2YD7A 3MLXH 1A02N 4Z78A 4N9GB 2DQFB 1OHQA 2XKNA 2ZUXA 3BXNB 5HDQL 3KJ4B 1S9VA 4UILH 1VDGA 1QBMH 1J8HA 2VQ1A 4XB8A 4ZPTB 1Z9MA 5K9OB 4U6YB 5FO9B 3D25B 3BZ4B 3L1OH 1AI1H 1F4HA 1ORSB 5GZNC 3HNVL 1WWCA 1HHIB 1VFUA 3HE7A 2AEWA 4HH9B 3TO4B 3P9WB 1NAMB 1ROWA 2FNBA 4QRPA 2I07B 5GXBB 4NO0D 1EHXA 1F6AB 3VJ6B 3BHBB 3LKSA 3TF7C 3HI5H 3QUMB 1E4KC 3GBML 2AXGB 3QZWA 4GUPA 2Q1EA 4HHAB 4PRBA 3SJVB 5C0RL 3MOAH 2OR9L 1I7ZB 4KTDH 1V5JA 5D93C 2VZOA 3TYFA 4JREB 3I02A 1KCSL 4X80L 3IAPA 1HZHL 3AXLB 4KAQH 4QRRA 1P6FA 4RX4D 2R1WB 1IBGH 4HGMA 5DI8B 3DO3A 1C12A 2Y07L 5I9QC 4L8SC 5DMKB 3BKYL 2X44D 4Y2DB 3OKNB 1MRCL 1NMAH 5T1MA 2J4WH 3L5WB 1GH7A 5FYJD 5DWUL 2VAJA 4Z7NF 1WBYB 1HWHB 1JPSL 5DS8B 4S11A 1QFPA 3CX5J 4HXAL 3ZHDA 4LMQI 1RJYA 1I1AD 2AVGA 1MFDL 4WI9A 2DYPA 4HS3B 4Q0XH 2DI8A 2KZWA 3LKQB 3P0VH 4Y4FD 2HKHH 5SWZA 1KN2L 2FYYB 5GS0L 1YEHH 4LVNC 3VXQA 2SEBB 3QRFM 4MCZA 1CGXA 5FYKU 1KIQA 4IJ3C 5ADOL 3C08L 5FK9B 1FNEA 5D93B 2WUCH 3HC0A 1HXYB 2JELL 3CK0H 3GSVB 4P57B 1JP5A 4WV1B 4K3EL 4PJ5B 2HJLA 3ULUE 4L4TA 5KVDL 1DBMH 3U36A 5JR1L 5JDJA 5C0BB 4RRPG 1MAKA 3QIUA 2H45A 3VXSA 1R3IH 4U1MA 1RJZB 2A74A 1VGKB 5KW9H 5E6IA 3WHXB 5E8PB 1A4JB 4FQ2L 3GMMA 3RVTC 4XP5H 1AQDA 3Q1SL 3ARFC 2EC8A 1RURL 3NA9L 2ADGB 3SDXF 2P46B 4DUVA 5B3JF 1KIQB 4DW2L 4Y16C 1NGPH 3MJGX 5ICYA 2H3NB 2A6DA 4Z8FL 1LEKA 1GJIA 1R24A 3O6KH 1GGIH 4QGYA 2DAVA 4OZGE 4LSUH 4LCWE 4WW2C 2BSSA 3M07A 1CK0H 2NX5E 2VKXA 3DGGA 4WHCA 3RX8A 3CPLA 3SDDB 1PSKL 3QEUA 4X7DC 4LF3A 3T0EE 5F9OL 1VGKA 3D18A 2BHYA 3GFUA 1IKNC 4OZGB 3MV9D 1GC1C 5C08B 1ZT7A 3OKLA 4WTWA 5B39B 2VDQL 3DHJA 5J12B 4TNWK 4LNVA 3FN3A 4P5TC 4EIZC 3MJ8B 3BPOB 2FJHA 4ZUVB 4G8FA 1UACL 3U2SB 2GSGB 3GMRB 4HPOL 1NGWB 5FV2A 1U58B 1BVKB 1ZHBB 4NSKA 1IAOA 5TGBB 2JCCB 1BQHA 1E6OH 2D3VA 3W82A 1UYWH 2AW2A 3S3SA 1I7UB 2P49B 4M43L 5HHXL 5D7JA 2XTJB 3OKLB 1D5ZA 3RDTD 1R3KB 1SMOA 1I8IB 4BZ1L 4GRWF 3MFFB 1WLHA 4MAUH 4MS8D 4Y16A 1F4WH 1T1ZB 2VQTA 5EA0L 1U93A 3VD3A 5I1JH 3U6RA 5ESAA 5IOPA 2X89A 4QRPD 3VFTA 1I8MA 2PR4H 5E00A 5DEGB 4DKEL 2XA3A 4OD3L 2EICA 2IAND 2YBRB 5HYEA 1SEBB 5ALBH 5K9KA 2MJWA 2QADC 4LEOA 4K94C 2VISB 3QIUC 3LKSB 1RHFA 3QIBB 4M7ZB 2JELH 3MC0A 4H88H 5SWSA 4MVBC 1NCDH 2VLME 5T1DL 4G43A 4U6XB 4WJ5A 4WU5A 1A7PL 3E6HA 4AEHL 3EKCA 3M17B 3MCLH 3WFDH 1MCPL 3X17A 2BX5A 4GW5B 1Q1JH 5DMYA 4OZIA 4LAQH 3GIVA 3GKWL 4DUXA 5F7UA 1FAKT 4PBWD 1YDPB 3FT3B 2VWEC 5MEND 3IXTB 3TNMB 3TN0D 4X6FA 3BJLA 1ZHKB 1FVEB 1F97A 1IAIL 2KL6A 5CS7A 5GS2D 3S35X 4QRTA 3FB6B 4UBDD 1T66C 3ORJA 4ZXBB 2EDDA 5DVKA 3OF6D 4JKPL 2Q7YA 1B6DA 4JKKA 5I0ZA 2VLRD 1CGTA 3B5TA 1LE9B 2C3GA 5KSAC 1I9IL 1UKQA 3RWGA 4O58L 4Z7QF 5EDXA 3MV9B 1UZ6E 1C08B 2YK1H 4MA8L 5IFHL 4IOFC 1HCVA 1D9KA 3IS1X 1HINH 3GMOB 2RB8A 4WFEE 5CEZL 3RVVD 1DANT 4HH9A 3QCUL 4JDZA 1A1OB 3MRNB 3MV11 3T1WA 4TNVK 1U0QA 3F7QA 1EO5A 3CLFL 1ONQB 2IADA 3O2DH 5IBLC 5IK3B 4J1UB 1E4KA 1YQ2A 3JWOH 1SYVB 5E8OB 1WVZA 1EJ6A 1A4KB 2PYFB 4U1JA 1MJJA 2IC2A 4JRYA 1NDGB 4HKBA 5E95B 5E8PA 2ZCHH 4BSJA 4OSUL 2C1PA 4IMKA 3I6LD 5B38B 1ZGLB 3O4OB 4J6RL 1G9MC 4X7TB 3KYOB 1N5YH 4S10A 2DQJL 4FQXA 1HEZA 2RQ8A 4ZTOL 1ZWIA 5BS0E 3QUZB 2E27H 1LO0L 4YDIL 4FZEH 4PR5A 1BD2E 1YY9D 4X4YA 5SWZD 1KT2A 5D7IF 1P53A 4OF3A 3LSOA 3MXWL 4HLJA 3ILQC 1CDBA 4HLZG 2XWTA 3HAEG 3EOYG 4WU7A 4D3CL 5C7XH 4ZS6D 4K7FB 3AVEA 1KIPA 3FO0H 4EBQL 4WEUD 4EZMA 1QRNA 1NDGA 1B0WA 1UWXK 2X4OB 3EIFA 4P2QD 4A6YB 4K8RC 2DQIH 4JFFB 2OX5A 4B41A 1C16B 5I71B 2CKBH 1XCQB 3QPXL 5I1GH 3D3VE 4NCC2 3C5JA 4R4NC 3EHBD 4LARL 2AP2A 4Y4HC 2OR8A 3P30H 2YEZA 5F7DB 5F7WC 2R23B 3PQYE 4ZPTA 5FGRA 4OI8A 1I7RA 3QQ3B 5ICZA 1JGVH 1TITA 3BPNC 1FAIL 4NN5B 5D70H 1DN0A 2VLJA 2Z93A 3PJSB 1OTTD 4KZDL 4G80A 4XX1G 1FZOB 4NZRL 2Q76B 4EOWL 2YRZA 4XCNA 3X3GL 5CCKL 3DLQR 3U7YL 2BDNH 4JANB 3U0TB 2VAAA 3ALWA 3RNQB 1UADC 5DD0L 1LO3H 3DURB 4KHXH 5DURD 4NPYB 4QOKE 4NKDA 2APWA 1RK1B 1XF4B 4MDJA 3KLHC 1CXLA 7FABH 2AJYL 5HI5C 5DJ6B 4E5XA 2XN9D 4JZJC 1QZ1A 4P2CG 4QNPF 1OSZB 1KEGH 5EB9A 4MB4A 5E5RB 2QQLH 4APQA 2MKWA 5GGSB 3W9EA 2CK0H 4HWEL 3GBNH 1D6EB 4LKCA 4X4MA 4K7PX 1KFAH 4HCRA 1FNGB 1FZJB 4HQQH 4OQTA 1X7QB 5SWSB 1CLZL 2R0WL 4BYHA 5CEZD 2X42A 4P9HL 1OAZL 4OLZL 1XF3B 4JZNB 4LFHD 3WEXA 1N59A 5DJ8A 1NEUA 3GO1H 1YNTB 4ZDHA 1OB1B 4CVUA 3T4YB 1MCBA 3DETD 4GXVH 2YMXL 3O6LH 5B8CC 4MJIE 3WN5B 5KS9F 5KG9A 4KHXL 5SWZB 3BT2L 4NQXA 2VWEE 3RVVC 3T0XA 2YRPA 3QWRD 5DFWH 2BDNL 2XFXB 5CCKH 1NBYB 5D1QA 1ES0B 3MV7B 1KOAA 5FK9A 2V9TA 5I16A 3UZEA 3FB5A 3L3IA 2AEQH 4HCRL 1CFQB 5D70L 3WXVL 4NKIH 5IM7B 2CMRH 4KI5D 5IV2A 1LO4H 4LNRA 2X1OA 4P23A 4NZDA 2BERA 1LEIA 4XPFH 3AFLA 4Y2DD 4NUGL 4L29A 4Y7MA 3RWJB 4GOSA 3O2WH 3T77A 1YYLH 4Z0BL 5IVXA 3VCLA 3WCYA 2DTMH 3QHZL 5FEBA 1QR4A 3QIWA 5I8OH 3D0VB 3AUVA 1EHLL 3IFPA 4KKBD 5HDOA 2DIAA 1G9ML 3TV3L 3MOBL 4R4BA 5I1KH 3GHEH 4ODUB 1BMGA 1MSPA 1JV5B 3AU1B 3K4ZA 4ZFOB 4CADB 3E6HB 1HSAB 1VERA 3RRQA 3STZB 3GIVB 2R2CA 2VR5A 3SKOB 3HB3D 1P84K 2H32B 1G0DA 4PR5B 4FXKA 4FXGB 3DUUA 5DHVB 4FQQA 5JW5A 2FX9H 2WBJB 1EBPA 5B38G 3BDBA 2GY5A 3WUWA 3VW3H 1DUZA 1XH3A 2APXA 1NFDF 3LPWA 2GITB 5I66B 5HGBA 4JFEA 1ZHNB 1UQSB 3MLPA 4D9QD 3IFOA 3RVWC 1I1CA 4LHUA 4NQEA 4HV8A 1N3NB 3KDMA 2MQCA 1OT1A 5E94A 3DO7A 3PNWA 1B2WL 1HI6A 3CLFH 3WIIL 4ODVH 1VPOH 1IKFL 3EYVB 3NZHL 5CEYB 1JZ4A 2VLKD 3IDUA 5AG9A 4JREC 5C0JB 2IQAA 5K33A 5FOBB 2E5EA 3DSNA 4OKVB 3KYNB 2H32A 4JFEE 2DWEA 3V5HB 1OARL 1H3PH 4Q9RL 2AEPL 2Q7NA 1P5VA 1MI5B 4MD4A 2OK0H 1A9BB 4JR9H 5IK3A 3C60D 3NIDF 3AS0A 1OGAA 2Z8WC 1LP9B 3UO1H 5BQ7A 3MRLB 1HHHA 2Q86A 3QWQB 1DQLL 4UAOC 3MR9A 4RISH 1TENA 2A38A 4XCNB 5GS1C 4PJGB 5EZOL 2GTZA 1PZ5B 3REVB 4JANA 2XZCH 4YNYA 3U0TA 1F5WA 1P84J 3NOIA 4HPYL 2MPAH 5H37G 1JF5A 3PABA 2YZ1A 2Q8BL 3MRJB 4OGXL 5F7NC 1R0AH 4LAQL 4JPIA 2CGRL 4XP6L 4APQD 2Y4SA 5C0CB 1QLEH 5M7QA 4R8WL 4NT6B 3RTQC 3O6FD 1N5AA 4MA3A 1ZXQA 3VXOA 2VXQH 1BX2A 5D72L 4OCWL 1QPXA 1PX3A 4DFIA 2XTJD 3GSXA 4PB9L 1SBBA 1UC6A 1HYRC 1NCAL 1NGXA 4PYGA 2BVOB 1FP5A 2YUXA 4JQVC 3VGFA 3VXTA 4NHCL 4C58B 3MLZL 1HH9A 2JIXA 4P46D 1ZHBA 4HIXH 1HOCB 2ZCKH 3MCG1 5TQ0L 1IQDA 4TSBH 1B4JH 1L6XA 3IS0X 1RUKL 4B5EA 1NQBA 2K9UA 2YEZB 4IRSB 2CH8A 1G7IA 2GJ6D 3DVFA 4QXGH 4JCLA 4LLYB 3RVUD 3B3IB 3ARFD 4YFLI 5A16B 3EYFB 5FYJL 3LD8B 1QSFA 3LPFA 5IFJB 1SQ2N 3ZTNH 1P1ZA 2X6MA 3E3QC 4DN4L 3CFIC 3AXLA 1KEML 2YPKA 2R0ZH 1NFDA 4KTEH 5DYOA 2BSRA 1RIHL 4KU1A 1MEXH 3VWJC 2HFFA 4CN4A 1UXWB 2AK4A 4LPUA 4A6YL 1BQLL 2XZAL 5K9QI 2YKLL 3FOMB 3H3PH 1OAQH 4U2ZA 1ZLSL 2LTQC 1EV2E 4HH8A 5E8EA 1SY6A 3ZE2E 3CDFA 1JFQH 5C0AD 3BDXA 3LKQA 3H3KA 2P8MB 3HKFA 5EBGA 5FKPA 4P9MH 3RKDC 3ARVA 3MRBB 5FKAA 5DHYA 3VRJB 4FQXB 1MFAL 2FGWL 4X6DB 3UPRA 4NNPH 3BMVA 1PSKH 1CS6A 1NLDH 3RVWD 2C4FU 4FOMA 1A6AA 2BHZA 4TSAH 1JPTL 4RAVA 3MLVH 4X7SH 2ED8A 1CDJA 1CFVH 1NDMA 3MCKA 1U8QA 3S4SA 5EO0B 3ULUL 2M2DA 4YIQA 4QRRE 3TVMD 4PLKD 2NX5B 4W6WB 3TPUA 3QBTB 4PJFF 4XP5L 3MRBA 4LHUD 3O6FB 4FQ2H 4FTVD 2W9EH 5ISZA 3FQUA 5T1LA 3MREB 4OZFB 2CLZA 1YN7B 1JK8B 3RWCB 2OXGA 5D2LB 4PRPE 3WFEL 1WJ3A 3H6JA 3GMQB 2AV1B 3O0RL 1HI6B 1QTYT 1HILA 3ABZA 4NNPL 4BQ8A 3L5WA 3QRGL 1WICA 3PV7A 4N0FB 1QSEA 3LY6A 4YHOL 5LJYH 4JM2A 3L95B 1CL7H 1D5XA 1U3JA 5HHNB 4TVPL 2QQNH 4X99A 5EIIB 2X7LB 4GQ9L 4JN1H 3VWJA 1XGPB 5TF0A 2R1YB 2FHFA 1QLFB 1J5OL 3OPZL 3IDIA 2UY7A 3O3BA 2F8OA 2K1MA 3O6FC 1FNSH 2DQEL 3QWOA 2DDQL 5JHLH 3HS0A 1FV1B 1RJLB 4BKLB 4K2UH 5J1AA 4YXKL 3OR6B 1UT9A 4OGAD 2Y07H 4JRYE 4GRMA 3MXVL 1ORSA 2ESVA 3BKML 4U1SA 4NRXB 5DUMH 4JEGB 1E4XI 3C09B 6CGTA 3QYCA 3MBEB 1SM3H 4XNYL 3GIZL 4WUUE 2IJ0C 1RUKH 4I18A 4IDLA 1BREA 3HZYA 3B9KB 1XGTA 4TOYL 5LG1A 3DWTA 4N0UB 5E7FA 1IZKA 3DV6A 3QULB 4L1DA 4NQVA 1KJ2H 1ZA3B 3KPSB 4R4FL 1TPXC 3SJVA 3MLZH 1AIFB 1YN6A 3HI5L 5I1LA 3E8UH 4BKLA 4OM1L 4YO0A 5EU6D 1G6RL 1G9NC 1BECA 3KPMB 3BXNA 1K3ZA 3L3KB 4ONHB 3V6OC 1UWEH 3EJJX 3W11D 5C2BL 3AS3A 4O2CB 1T0MA 3AB0B 5D96C 2LFGA 3GGWB 5HTSA 5LGJB 2NX5D 2OI9C 1TMCB 4H25A 1Z0NA 2OSLA 1LDPH 2ADFL 4F58H 5EIVA 4NM4H 2PUQT 5D2NC 3QI9C 2XACC 1QBBA 2HT2C 1KLGA 1U8MA 4N90D 4RISL 1X5YA 2JF1A 3MLXL 4IRSC 5AWNL 2XN9A 5CEZE 5L6YL 5CWSB 3NPZB 3U4AA 5HY9B 2VDLL 1ZHLB 2DIJA 5JOPD 1J05A 5EBMB 3QDGD 3WFZA 3MRQB 1MJ8H 3EFDL 2YPLA 3CUPA 3JV4A 3S7GA 3DETC 3NCEB 4EI5B 4GQPH 4PJXB 4L4TB 1CIDA 2Z9TA 1VEPA 4M6MH 3IU4L 5D1XD 5JQHC 2Z31C 2F54D 1XEDA 2QQKH 1GXEA 5D6CB 3KWWA 2Q6WA 4CMMB 5IHUL 3DTXA 3REWA 25C8L 3GKZA 3ULSA 1UG9A 3P40A 6FABH 5CGMA 2ZUQB 5ID1A 3BI9X 1KACB 3TBSB 4IRJC 4R97B 1I1YA 2A9NH 4OGYL 5IESH 3MYJA 3PIQA 4P5MA 3VXUE 5HGAB 1G7PB 5DS8A 3U0WH 4Q97A 1DLHA 4NQDA 1INQB 2WMPA 4HWBL 1E0OB 1K6QL 1D5IH 3QCVH 4KKNA 4PJDB 2FIRT 2ATPA 3BE1H 1T7ZA 1T0NB 5L88H 3QHFL 3KYOA 2X40A 1WCBB 2ENSA 4HKJA 4JN2A 4GXUM 2O5XL 4I0CC 1MJ7L 4HMEA 5FM5O 3TYGL 3MRKB 5A1AA 3G9AB 1Z9OA 3MOBH 3H42H 3HCVB 1P5UA 3TV3H 1ZOXA 5E2WH 4I48A 2PW1A 4JPKL 1EHLH 1JRHL 1DLHB 4KUCF 3LQAH 2RCSL 1FRGH 4CVXB 5L7XH 1PY4A 2Z31D 1JTPA 1U92A 1DQJA 2I60H 2HFEA 3G5YB 4KVNH 4ZD3L 4P23C 5KAQF 2X4OA 4AYFA 4RA3A 1OTUD 3QUXC 4XCCH 3WNMA 4JFFA 4UOJA 2X4SB 5CKAA 2VE6B 3SPVA 2FH6A 1Z2KA 1I9JL 5EOTA 5F3HB 3A6BL 1TZIB 3OGOE 2XXMB 4PJ5D 2IPUK 5KANI 4ISVA 4UQ3A 4PIRF 3RPIB 5T1KA 4NKIL 1F4YL 3B9DA 4ZTPL 1ONQA 1OWRM 4K3DH 1AO7D 5DZOA 1MELA 4UV7L 2F5BL 3WSQH 1MIMH 4HF5H 4WO4A 4F9LA 2BY2A 4U1KA 5D4QA 5E8DH 4XGZA 3ZDXF 3LMJH 4JFED 1JHLL 5DR5H 3I50L 5F7KC 2A6JB 1IEBB 5IKCB 2V7NA 2MSPA 3QO0A 4LCWD 4PS4L 4N0UA 2XKNB 3TT3L 1G7JB 1QFWH 3EOAA 1GCFA 3OJ2C 3A6CL 5DJ6A 5JHDE 4LCCB 4ZD3H 1T21