2MSBA

Structure of a c-type mannose-binding protein complexed with an oligosaccharide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
b'KFFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEVTEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-BINDING PROTEIN-A
publication title Structure of a C-type mannose-binding protein complexed with an oligosaccharide.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Lectin
total genus 32
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 2msbA00
2E3XB 1X2WB 5FFSA 1DV8A 1UV0A 3P5IA 3KMB1 5KTIA 4QKGA 3CDGE 1SB2A 2BPDA 2CL8A 3GPRA 3PARA 1MUQA 1V7PB 1FIHA 1JWIA 1CWVA 1T8DA 2C6UA 1KG0C 4J6KA 1V4LA 1UOSB 1OZ7A 1RDI1 4WQQA 1K9IA 3G8KA 4EZMG 1RJHA 3RS1A 1WK1A 2KMB1 4C16A 2GO0A 1G1RA 1KWUA 1O7BT 1AFD1 5F2QA 1R14A 4IOPA 3L9JC 1X2TB 1GZ2A 3K7BA 1KZD1 5LGKE 3WWKA 1RDO1 4ZRVA 1X2WA 3WHDA 1BYFA 1U0OB 4WR9A 3BDWB 2GGUA 1KX0A 1RDJ1 1V7PA 1JA3A 4PP8A 3M9ZA 3VPPA 3P5DA 1F02I 1UOSA 1YPUA 5K8YA 4DN8A 1V4LB 2ZQKA 1B08A 1J34B 3ALTA 1MPUA 1WMYA 3WBPA 1FVUA 1UMRA 1K9JA 3PAQA 4GJXA 4M17A 3VLGA 1X2TA 1TLGA 3FD4A 4IOPB 4KZVA 1TDQB 4PDCA 1UEXB 1KWZA 1U0OA 3BDWA 3WWKB 1J35B 1KWTA 2VRPB 1FM5A 1BJ3B 3CADA 1XARA 2XR5A 2OX9A 3P7HA 4N37A 2PY2A 1J34A 3ALUA 3C8KD 5B1WA 4MTHA 1YPQA 4WREA 3T3AA 4GKOG 1T8CA 4WRCA 5B1RA 1FVUB 1KMB1 1AFB1 1U0NB 1BCH1 2VUVA 3GPRD 1HTNA 3P5GA 1B6EA 2RIDA 1HUPA 1YPOA 1UEXA 3CFWA 1RDK1 3P7GA 4J6PA 1P1ZD 4M18A 4J6MA 1J35A 4WUWA 4J6NA 4N34A 3CDGF 2VRPA 4S0UA 2E3XC 1P4LD 1E87A 5J6GG 1BJ3A 1RTM1 1IJKC 2M94A 3WSRA 4KZWA 2XR6A 1KWXA 1E8IA 4UXMA 3CCKA 1SL5A 2IT6A 1UKMB 2H2RA 1BUUA 1KZC1 2H2TB 3FF9A 1LITA 1XPHA 4C9FA 2I83A 3IKNA 2VUZA 2OX8A 3C8JA 5B1XA 1WT9B 1RDN1 3VYJA 2KV3A 1YXKA 4LQFA 3WBQA 1IXXA 4N35A 2RIBA 3WH2A 2AFPA 1PWBA 3G83A 1Y17B 1YTTA 4WCOA 2RIEA 3DBZA 3P7FA 4GI0A 1IODB 1EGGA 3NCWA 1F00I 4KI1E 4WRFA 1JZNA 3UBUB 2BRSA 3WBRA 2IT5A 3ZHGD 1MSBA 4N36A 1DY0A 2BPHA 4N38A 5M62A 1WMZA 1C3AB 1G1TA 1UKMA 3VYKA 1HYRA 3GPRC 4KMB1 1DY2A 1TN3A 4J6QA 2N40A 1KOEA 1G1SA 1ESLA 3FF7C 1IJKB 4WUXA 4N32A 4G9AA 2MTIA 4QKIA 3ALSA 1WT9A 2RICA 3WH3A 5FFRA 1KWYA 4ZRWA 1KZE1 3BX4A 1FIFA 3P5HA 2ORKA 1SL6A 4ZESA 4M1GA 3IKRA 1EGIA 1IXXB 1Y17A 1KZA1 2YHFA 2PF5A 1YXJA 1IODA 1HQ8A 1RDL1 1BNLA 3UBUA 3WWKC 1E5UI 1QO3C 1AFA1 2GGXA 3IKPA 2BPEA 1DY1A 1C3AA 1O7CT 3FF8C 4E52A 1SL4A 1KX1A 1QDDA 4GJ0A 4LU5A 1H8UA 1R13A 1KWVA 2MSBA 4GK1A 3PAKA 1KZB1 3P5FA 2ZIBA 5KTHA 1G1QA 1SB2B 5FFTA 3GPRB 2RIAA 4YMDA 1KCGA 2OS9A 1JWIB 3G84A 4ZETA 3C22A 3IKQA 1UMRC 1U0NC 1RDM1 3BX4B 4AK8A 4G96A 1OZ7B 4N33A 1BCJ1 4QKHA 2ORJA 3KQGA 3PBFA 3ZHGA 3P5EA 3G8LA 3NCXA 4J6JA 1KWWA 4QKJA 4CSYA 4J6LA 4UWWA 3G81A 2ZWKA 1PW9A 2LS8A 4YLIA 1BV4A 3HUPA 4CAJA
chains in the Genus database with same CATH superfamily
2E3XB 1X2WB 5FFSA 1DV8A 1UV0A 3P5IA 3KMB1 5KTIA 4QKGA 3CDGE 1SB2A 2BPDA 2CL8A 3GPRA 3PARA 1MUQA 1V7PB 1FIHA 1JWIA 1CWVA 1T8DA 2C6UA 1KG0C 4J6KA 1V4LA 1UOSB 1OZ7A 1RDI1 4WQQA 1K9IA 3G8KA 4EZMG 1RJHA 3RS1A 1WK1A 2KMB1 4C16A 2GO0A 1G1RA 1KWUA 1O7BT 1AFD1 5F2QA 1R14A 4IOPA 3L9JC 1X2TB 1GZ2A 3K7BA 1KZD1 5LGKE 3WWKA 1RDO1 4ZRVA 1X2WA 3WHDA 1BYFA 1U0OB 4WR9A 3BDWB 2GGUA 1KX0A 1RDJ1 1V7PA 1JA3A 4PP8A 3M9ZA 3VPPA 3P5DA 1F02I 1UOSA 1YPUA 5K8YA 4DN8A 1V4LB 2ZQKA 1B08A 1J34B 3ALTA 1MPUA 1WMYA 3WBPA 1FVUA 1UMRA 1K9JA 3PAQA 4GJXA 4M17A 3VLGA 1X2TA 1TLGA 3FD4A 4IOPB 4KZVA 1TDQB 4PDCA 1UEXB 1KWZA 1U0OA 3BDWA 3WWKB 1J35B 1KWTA 2VRPB 1FM5A 1BJ3B 3CADA 1XARA 2XR5A 2OX9A 3P7HA 4N37A 2PY2A 1J34A 3ALUA 3C8KD 5B1WA 4MTHA 1YPQA 4WREA 3T3AA 4GKOG 1T8CA 4WRCA 5B1RA 1FVUB 1KMB1 1AFB1 1U0NB 1BCH1 2VUVA 3GPRD 1HTNA 3P5GA 1B6EA 2RIDA 1HUPA 1YPOA 1UEXA 3CFWA 1RDK1 3P7GA 4J6PA 1P1ZD 4M18A 4J6MA 1J35A 4WUWA 4J6NA 4N34A 3CDGF 2VRPA 4S0UA 2E3XC 1P4LD 1E87A 5J6GG 1BJ3A 1RTM1 1IJKC 2M94A 3WSRA 4KZWA 2XR6A 1KWXA 1E8IA 4UXMA 3CCKA 1SL5A 2IT6A 1UKMB 2H2RA 1BUUA 1KZC1 2H2TB 3FF9A 1LITA 1XPHA 4C9FA 2I83A 3IKNA 2VUZA 2OX8A 3C8JA 5B1XA 1WT9B 1RDN1 3VYJA 2KV3A 1YXKA 4LQFA 3WBQA 1IXXA 4N35A 2RIBA 3WH2A 2AFPA 1PWBA 3G83A 1Y17B 1YTTA 4WCOA 2RIEA 3DBZA 3P7FA 4GI0A 1IODB 1EGGA 3NCWA 1F00I 4KI1E 4WRFA 1JZNA 3UBUB 2BRSA 3WBRA 2IT5A 3ZHGD 1MSBA 4N36A 1DY0A 2BPHA 4N38A 5M62A 1WMZA 1C3AB 1G1TA 1UKMA 3VYKA 1HYRA 3GPRC 4KMB1 1DY2A 1TN3A 4J6QA 2N40A 1KOEA 1G1SA 1ESLA 3FF7C 1IJKB 4WUXA 4N32A 4G9AA 2MTIA 4QKIA 3ALSA 1WT9A 2RICA 3WH3A 5FFRA 1KWYA 4ZRWA 1KZE1 3BX4A 1FIFA 3P5HA 2ORKA 1SL6A 4ZESA 4M1GA 3IKRA 1EGIA 1IXXB 1Y17A 1KZA1 2YHFA 2PF5A 1YXJA 1IODA 1HQ8A 1RDL1 1BNLA 3UBUA 3WWKC 1E5UI 1QO3C 1AFA1 2GGXA 3IKPA 2BPEA 1DY1A 1C3AA 1O7CT 3FF8C 4E52A 1SL4A 1KX1A 1QDDA 4GJ0A 4LU5A 1H8UA 1R13A 1KWVA 2MSBA 4GK1A 3PAKA 1KZB1 3P5FA 2ZIBA 5KTHA 1G1QA 1SB2B 5FFTA 3GPRB 2RIAA 4YMDA 1KCGA 2OS9A 1JWIB 3G84A 4ZETA 3C22A 3IKQA 1UMRC 1U0NC 1RDM1 3BX4B 4AK8A 4G96A 1OZ7B 4N33A 1BCJ1 4QKHA 2ORJA 3KQGA 3PBFA 3ZHGA 3P5EA 3G8LA 3NCXA 4J6JA 1KWWA 4QKJA 4CSYA 4J6LA 4UWWA 3G81A 2ZWKA 1PW9A 2LS8A 4YLIA 1BV4A 3HUPA 4CAJA
chains in the Genus database with same CATH topology
2E3XB 1X2WB 5FFSA 1DV8A 1UV0A 3P5IA 3KMB1 5KTIA 4QKGA 3CDGE 1SB2A 2BPDA 2CL8A 3GPRA 3PARA 1MUQA 1V7PB 1FIHA 1JWIA 1CWVA 1T8DA 2C6UA 1KG0C 4J6KA 1V4LA 1UOSB 1OZ7A 1RDI1 4WQQA 1K9IA 3G8KA 4EZMG 1RJHA 3RS1A 1WK1A 2KMB1 4C16A 2GO0A 1G1RA 1KWUA 1O7BT 1AFD1 5F2QA 1R14A 4IOPA 3L9JC 1X2TB 1GZ2A 3K7BA 1KZD1 5LGKE 3WWKA 1RDO1 4ZRVA 1X2WA 3WHDA 1BYFA 1U0OB 4WR9A 3BDWB 2GGUA 1KX0A 1RDJ1 1V7PA 1JA3A 4PP8A 3M9ZA 3VPPA 3P5DA 1F02I 1UOSA 1YPUA 5K8YA 4DN8A 1V4LB 2ZQKA 1B08A 1J34B 3ALTA 1MPUA 1WMYA 3WBPA 1FVUA 1UMRA 1K9JA 3PAQA 4GJXA 4M17A 3VLGA 1X2TA 1TLGA 3FD4A 4IOPB 4KZVA 1TDQB 4PDCA 1UEXB 1KWZA 1U0OA 3BDWA 3WWKB 1J35B 1KWTA 2VRPB 1FM5A 1BJ3B 3CADA 1XARA 2XR5A 2OX9A 3P7HA 4N37A 2PY2A 1J34A 3ALUA 3C8KD 5B1WA 4MTHA 1YPQA 4WREA 3T3AA 4GKOG 1T8CA 4WRCA 5B1RA 1FVUB 1KMB1 1AFB1 1U0NB 1BCH1 2VUVA 3GPRD 1HTNA 3P5GA 1B6EA 2RIDA 1HUPA 1YPOA 1UEXA 3CFWA 1RDK1 3P7GA 4J6PA 1P1ZD 4M18A 4J6MA 1J35A 4WUWA 4J6NA 4N34A 3CDGF 2VRPA 4S0UA 2E3XC 1P4LD 1E87A 5J6GG 1BJ3A 1RTM1 1IJKC 2M94A 3WSRA 4KZWA 2XR6A 1KWXA 1E8IA 4UXMA 3CCKA 1SL5A 2IT6A 1UKMB 2H2RA 1BUUA 1KZC1 2H2TB 3FF9A 1LITA 1XPHA 4C9FA 2I83A 3IKNA 2VUZA 2OX8A 3C8JA 5B1XA 1WT9B 1RDN1 3VYJA 2KV3A 1YXKA 4LQFA 3WBQA 1IXXA 4N35A 2RIBA 3WH2A 2AFPA 1PWBA 3G83A 1Y17B 1YTTA 4WCOA 2RIEA 3DBZA 3P7FA 4GI0A 1IODB 1EGGA 3NCWA 1F00I 4KI1E 4WRFA 1JZNA 3UBUB 2BRSA 3WBRA 2IT5A 3ZHGD 1MSBA 4N36A 1DY0A 2BPHA 4N38A 5M62A 1WMZA 1C3AB 1G1TA 1UKMA 3VYKA 1HYRA 3GPRC 4KMB1 1DY2A 1TN3A 4J6QA 2N40A 1KOEA 1G1SA 1ESLA 3FF7C 1IJKB 4WUXA 4N32A 4G9AA 2MTIA 4QKIA 3ALSA 1WT9A 2RICA 3WH3A 5FFRA 1KWYA 4ZRWA 1KZE1 3BX4A 1FIFA 3P5HA 2ORKA 1SL6A 4ZESA 4M1GA 3IKRA 1EGIA 1IXXB 1Y17A 1KZA1 2YHFA 2PF5A 1YXJA 1IODA 1HQ8A 1RDL1 1BNLA 3UBUA 3WWKC 1E5UI 1QO3C 1AFA1 2GGXA 3IKPA 2BPEA 1DY1A 1C3AA 1O7CT 3FF8C 4E52A 1SL4A 1KX1A 1QDDA 4GJ0A 4LU5A 1H8UA 1R13A 1KWVA 2MSBA 4GK1A 3PAKA 1KZB1 3P5FA 2ZIBA 5KTHA 1G1QA 1SB2B 5FFTA 3GPRB 2RIAA 4YMDA 1KCGA 2OS9A 1JWIB 3G84A 4ZETA 3C22A 3IKQA 1UMRC 1U0NC 1RDM1 3BX4B 4AK8A 4G96A 1OZ7B 4N33A 1BCJ1 4QKHA 2ORJA 3KQGA 3PBFA 3ZHGA 3P5EA 3G8LA 3NCXA 4J6JA 1KWWA 4QKJA 4CSYA 4J6LA 4UWWA 3G81A 2ZWKA 1PW9A 2LS8A 4YLIA 1BV4A 3HUPA 4CAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3X B;  1X2W B;  5FFS A;  1DV8 A;  1UV0 A;  3P5I A;  3KMB 1;  5KTI A;  4QKG A;  3CDG E;  1SB2 A;  2BPD A;  2CL8 A;  3GPR A;  3PAR A;  1MUQ A;  1V7P B;  1FIH A;  1JWI A;  1CWV A;  1T8D A;  2C6U A;  1KG0 C;  4J6K A;  1V4L A;  1UOS B;  1OZ7 A;  1RDI 1;  4WQQ A;  1K9I A;  3G8K A;  4EZM G;  1RJH A;  3RS1 A;  1WK1 A;  2KMB 1;  4C16 A;  2GO0 A;  1G1R A;  1KWU A;  1O7B T;  1AFD 1;  5F2Q A;  1R14 A;  4IOP A;  3L9J C;  1X2T B;  1GZ2 A;  3K7B A;  1KZD 1;  5LGK E;  3WWK A;  1RDO 1;  4ZRV A;  1X2W A;  3WHD A;  1BYF A;  1U0O B;  4WR9 A;  3BDW B;  2GGU A;  1KX0 A;  1RDJ 1;  1V7P A;  1JA3 A;  4PP8 A;  3M9Z A;  3VPP A;  3P5D A;  1F02 I;  1UOS A;  1YPU A;  5K8Y A;  4DN8 A;  1V4L B;  2ZQK A;  1B08 A;  1J34 B;  3ALT A;  1MPU A;  1WMY A;  3WBP A;  1FVU A;  1UMR A;  1K9J A;  3PAQ A;  4GJX A;  4M17 A;  3VLG A;  1X2T A;  1TLG A;  3FD4 A;  4IOP B;  4KZV A;  1TDQ B;  4PDC A;  1UEX B;  1KWZ A;  1U0O A;  3BDW A;  3WWK B;  1J35 B;  1KWT A;  2VRP B;  1FM5 A;  1BJ3 B;  3CAD A;  1XAR A;  2XR5 A;  2OX9 A;  3P7H A;  4N37 A;  2PY2 A;  1J34 A;  3ALU A;  3C8K D;  5B1W A;  4MTH A;  1YPQ A;  4WRE A;  3T3A A;  4GKO G;  1T8C A;  4WRC A;  5B1R A;  1FVU B;  1KMB 1;  1AFB 1;  1U0N B;  1BCH 1;  2VUV A;  3GPR D;  1HTN A;  3P5G A;  1B6E A;  2RID A;  1HUP A;  1YPO A;  1UEX A;  3CFW A;  1RDK 1;  3P7G A;  4J6P A;  1P1Z D;  4M18 A;  4J6M A;  1J35 A;  4WUW A;  4J6N A;  4N34 A;  3CDG F;  2VRP A;  4S0U A;  2E3X C;  1P4L D;  1E87 A;  5J6G G;  1BJ3 A;  1RTM 1;  1IJK C;  2M94 A;  3WSR A;  4KZW A;  2XR6 A;  1KWX A;  1E8I A;  4UXM A;  3CCK A;  1SL5 A;  2IT6 A;  1UKM B;  2H2R A;  1BUU A;  1KZC 1;  2H2T B;  3FF9 A;  1LIT A;  1XPH A;  4C9F A;  2I83 A;  3IKN A;  2VUZ A;  2OX8 A;  3C8J A;  5B1X A;  1WT9 B;  1RDN 1;  3VYJ A;  2KV3 A;  1YXK A;  4LQF A;  3WBQ A;  1IXX A;  4N35 A;  2RIB A;  3WH2 A;  2AFP A;  1PWB A;  3G83 A;  1Y17 B;  1YTT A;  4WCO A;  2RIE A;  3DBZ A;  3P7F A;  4GI0 A;  1IOD B;  1EGG A;  3NCW A;  1F00 I;  4KI1 E;  4WRF A;  1JZN A;  3UBU B;  2BRS A;  3WBR A;  2IT5 A;  3ZHG D;  1MSB A;  4N36 A;  1DY0 A;  2BPH A;  4N38 A;  5M62 A;  1WMZ A;  1C3A B;  1G1T A;  1UKM A;  3VYK A;  1HYR A;  3GPR C;  4KMB 1;  1DY2 A;  1TN3 A;  4J6Q A;  2N40 A;  1KOE A;  1G1S A;  1ESL A;  3FF7 C;  1IJK B;  4WUX A;  4N32 A;  4G9A A;  2MTI A;  4QKI A;  3ALS A;  1WT9 A;  2RIC A;  3WH3 A;  5FFR A;  1KWY A;  4ZRW A;  1KZE 1;  3BX4 A;  1FIF A;  3P5H A;  2ORK A;  1SL6 A;  4ZES A;  4M1G A;  3IKR A;  1EGI A;  1IXX B;  1Y17 A;  1KZA 1;  2YHF A;  2PF5 A;  1YXJ A;  1IOD A;  1HQ8 A;  1RDL 1;  1BNL A;  3UBU A;  3WWK C;  1E5U I;  1QO3 C;  1AFA 1;  2GGX A;  3IKP A;  2BPE A;  1DY1 A;  1C3A A;  1O7C T;  3FF8 C;  4E52 A;  1SL4 A;  1KX1 A;  1QDD A;  4GJ0 A;  4LU5 A;  1H8U A;  1R13 A;  1KWV A;  2MSB A;  4GK1 A;  3PAK A;  1KZB 1;  3P5F A;  2ZIB A;  5KTH A;  1G1Q A;  1SB2 B;  5FFT A;  3GPR B;  2RIA A;  4YMD A;  1KCG A;  2OS9 A;  1JWI B;  3G84 A;  4ZET A;  3C22 A;  3IKQ A;  1UMR C;  1U0N C;  1RDM 1;  3BX4 B;  4AK8 A;  4G96 A;  1OZ7 B;  4N33 A;  1BCJ 1;  4QKH A;  2ORJ A;  3KQG A;  3PBF A;  3ZHG A;  3P5E A;  3G8L A;  3NCX A;  4J6J A;  1KWW A;  4QKJ A;  4CSY A;  4J6L A;  4UWW A;  3G81 A;  2ZWK A;  1PW9 A;  2LS8 A;  4YLI A;  1BV4 A;  3HUP A;  4CAJ A; 
#chains in the Genus database with same CATH topology
 2E3X B;  1X2W B;  5FFS A;  1DV8 A;  1UV0 A;  3P5I A;  3KMB 1;  5KTI A;  4QKG A;  3CDG E;  1SB2 A;  2BPD A;  2CL8 A;  3GPR A;  3PAR A;  1MUQ A;  1V7P B;  1FIH A;  1JWI A;  1CWV A;  1T8D A;  2C6U A;  1KG0 C;  4J6K A;  1V4L A;  1UOS B;  1OZ7 A;  1RDI 1;  4WQQ A;  1K9I A;  3G8K A;  4EZM G;  1RJH A;  3RS1 A;  1WK1 A;  2KMB 1;  4C16 A;  2GO0 A;  1G1R A;  1KWU A;  1O7B T;  1AFD 1;  5F2Q A;  1R14 A;  4IOP A;  3L9J C;  1X2T B;  1GZ2 A;  3K7B A;  1KZD 1;  5LGK E;  3WWK A;  1RDO 1;  4ZRV A;  1X2W A;  3WHD A;  1BYF A;  1U0O B;  4WR9 A;  3BDW B;  2GGU A;  1KX0 A;  1RDJ 1;  1V7P A;  1JA3 A;  4PP8 A;  3M9Z A;  3VPP A;  3P5D A;  1F02 I;  1UOS A;  1YPU A;  5K8Y A;  4DN8 A;  1V4L B;  2ZQK A;  1B08 A;  1J34 B;  3ALT A;  1MPU A;  1WMY A;  3WBP A;  1FVU A;  1UMR A;  1K9J A;  3PAQ A;  4GJX A;  4M17 A;  3VLG A;  1X2T A;  1TLG A;  3FD4 A;  4IOP B;  4KZV A;  1TDQ B;  4PDC A;  1UEX B;  1KWZ A;  1U0O A;  3BDW A;  3WWK B;  1J35 B;  1KWT A;  2VRP B;  1FM5 A;  1BJ3 B;  3CAD A;  1XAR A;  2XR5 A;  2OX9 A;  3P7H A;  4N37 A;  2PY2 A;  1J34 A;  3ALU A;  3C8K D;  5B1W A;  4MTH A;  1YPQ A;  4WRE A;  3T3A A;  4GKO G;  1T8C A;  4WRC A;  5B1R A;  1FVU B;  1KMB 1;  1AFB 1;  1U0N B;  1BCH 1;  2VUV A;  3GPR D;  1HTN A;  3P5G A;  1B6E A;  2RID A;  1HUP A;  1YPO A;  1UEX A;  3CFW A;  1RDK 1;  3P7G A;  4J6P A;  1P1Z D;  4M18 A;  4J6M A;  1J35 A;  4WUW A;  4J6N A;  4N34 A;  3CDG F;  2VRP A;  4S0U A;  2E3X C;  1P4L D;  1E87 A;  5J6G G;  1BJ3 A;  1RTM 1;  1IJK C;  2M94 A;  3WSR A;  4KZW A;  2XR6 A;  1KWX A;  1E8I A;  4UXM A;  3CCK A;  1SL5 A;  2IT6 A;  1UKM B;  2H2R A;  1BUU A;  1KZC 1;  2H2T B;  3FF9 A;  1LIT A;  1XPH A;  4C9F A;  2I83 A;  3IKN A;  2VUZ A;  2OX8 A;  3C8J A;  5B1X A;  1WT9 B;  1RDN 1;  3VYJ A;  2KV3 A;  1YXK A;  4LQF A;  3WBQ A;  1IXX A;  4N35 A;  2RIB A;  3WH2 A;  2AFP A;  1PWB A;  3G83 A;  1Y17 B;  1YTT A;  4WCO A;  2RIE A;  3DBZ A;  3P7F A;  4GI0 A;  1IOD B;  1EGG A;  3NCW A;  1F00 I;  4KI1 E;  4WRF A;  1JZN A;  3UBU B;  2BRS A;  3WBR A;  2IT5 A;  3ZHG D;  1MSB A;  4N36 A;  1DY0 A;  2BPH A;  4N38 A;  5M62 A;  1WMZ A;  1C3A B;  1G1T A;  1UKM A;  3VYK A;  1HYR A;  3GPR C;  4KMB 1;  1DY2 A;  1TN3 A;  4J6Q A;  2N40 A;  1KOE A;  1G1S A;  1ESL A;  3FF7 C;  1IJK B;  4WUX A;  4N32 A;  4G9A A;  2MTI A;  4QKI A;  3ALS A;  1WT9 A;  2RIC A;  3WH3 A;  5FFR A;  1KWY A;  4ZRW A;  1KZE 1;  3BX4 A;  1FIF A;  3P5H A;  2ORK A;  1SL6 A;  4ZES A;  4M1G A;  3IKR A;  1EGI A;  1IXX B;  1Y17 A;  1KZA 1;  2YHF A;  2PF5 A;  1YXJ A;  1IOD A;  1HQ8 A;  1RDL 1;  1BNL A;  3UBU A;  3WWK C;  1E5U I;  1QO3 C;  1AFA 1;  2GGX A;  3IKP A;  2BPE A;  1DY1 A;  1C3A A;  1O7C T;  3FF8 C;  4E52 A;  1SL4 A;  1KX1 A;  1QDD A;  4GJ0 A;  4LU5 A;  1H8U A;  1R13 A;  1KWV A;  2MSB A;  4GK1 A;  3PAK A;  1KZB 1;  3P5F A;  2ZIB A;  5KTH A;  1G1Q A;  1SB2 B;  5FFT A;  3GPR B;  2RIA A;  4YMD A;  1KCG A;  2OS9 A;  1JWI B;  3G84 A;  4ZET A;  3C22 A;  3IKQ A;  1UMR C;  1U0N C;  1RDM 1;  3BX4 B;  4AK8 A;  4G96 A;  1OZ7 B;  4N33 A;  1BCJ 1;  4QKH A;  2ORJ A;  3KQG A;  3PBF A;  3ZHG A;  3P5E A;  3G8L A;  3NCX A;  4J6J A;  1KWW A;  4QKJ A;  4CSY A;  4J6L A;  4UWW A;  3G81 A;  2ZWK A;  1PW9 A;  2LS8 A;  4YLI A;  1BV4 A;  3HUP A;  4CAJ A; 
#chains in the Genus database with same CATH homology
 2E3X B;  1X2W B;  5FFS A;  1DV8 A;  1UV0 A;  3P5I A;  3KMB 1;  5KTI A;  4QKG A;  3CDG E;  1SB2 A;  2BPD A;  2CL8 A;  3GPR A;  3PAR A;  1MUQ A;  1V7P B;  1FIH A;  1JWI A;  1CWV A;  1T8D A;  2C6U A;  1KG0 C;  4J6K A;  1V4L A;  1UOS B;  1OZ7 A;  1RDI 1;  4WQQ A;  1K9I A;  3G8K A;  4EZM G;  1RJH A;  3RS1 A;  1WK1 A;  2KMB 1;  4C16 A;  2GO0 A;  1G1R A;  1KWU A;  1O7B T;  1AFD 1;  5F2Q A;  1R14 A;  4IOP A;  3L9J C;  1X2T B;  1GZ2 A;  3K7B A;  1KZD 1;  5LGK E;  3WWK A;  1RDO 1;  4ZRV A;  1X2W A;  3WHD A;  1BYF A;  1U0O B;  4WR9 A;  3BDW B;  2GGU A;  1KX0 A;  1RDJ 1;  1V7P A;  1JA3 A;  4PP8 A;  3M9Z A;  3VPP A;  3P5D A;  1F02 I;  1UOS A;  1YPU A;  5K8Y A;  4DN8 A;  1V4L B;  2ZQK A;  1B08 A;  1J34 B;  3ALT A;  1MPU A;  1WMY A;  3WBP A;  1FVU A;  1UMR A;  1K9J A;  3PAQ A;  4GJX A;  4M17 A;  3VLG A;  1X2T A;  1TLG A;  3FD4 A;  4IOP B;  4KZV A;  1TDQ B;  4PDC A;  1UEX B;  1KWZ A;  1U0O A;  3BDW A;  3WWK B;  1J35 B;  1KWT A;  2VRP B;  1FM5 A;  1BJ3 B;  3CAD A;  1XAR A;  2XR5 A;  2OX9 A;  3P7H A;  4N37 A;  2PY2 A;  1J34 A;  3ALU A;  3C8K D;  5B1W A;  4MTH A;  1YPQ A;  4WRE A;  3T3A A;  4GKO G;  1T8C A;  4WRC A;  5B1R A;  1FVU B;  1KMB 1;  1AFB 1;  1U0N B;  1BCH 1;  2VUV A;  3GPR D;  1HTN A;  3P5G A;  1B6E A;  2RID A;  1HUP A;  1YPO A;  1UEX A;  3CFW A;  1RDK 1;  3P7G A;  4J6P A;  1P1Z D;  4M18 A;  4J6M A;  1J35 A;  4WUW A;  4J6N A;  4N34 A;  3CDG F;  2VRP A;  4S0U A;  2E3X C;  1P4L D;  1E87 A;  5J6G G;  1BJ3 A;  1RTM 1;  1IJK C;  2M94 A;  3WSR A;  4KZW A;  2XR6 A;  1KWX A;  1E8I A;  4UXM A;  3CCK A;  1SL5 A;  2IT6 A;  1UKM B;  2H2R A;  1BUU A;  1KZC 1;  2H2T B;  3FF9 A;  1LIT A;  1XPH A;  4C9F A;  2I83 A;  3IKN A;  2VUZ A;  2OX8 A;  3C8J A;  5B1X A;  1WT9 B;  1RDN 1;  3VYJ A;  2KV3 A;  1YXK A;  4LQF A;  3WBQ A;  1IXX A;  4N35 A;  2RIB A;  3WH2 A;  2AFP A;  1PWB A;  3G83 A;  1Y17 B;  1YTT A;  4WCO A;  2RIE A;  3DBZ A;  3P7F A;  4GI0 A;  1IOD B;  1EGG A;  3NCW A;  1F00 I;  4KI1 E;  4WRF A;  1JZN A;  3UBU B;  2BRS A;  3WBR A;  2IT5 A;  3ZHG D;  1MSB A;  4N36 A;  1DY0 A;  2BPH A;  4N38 A;  5M62 A;  1WMZ A;  1C3A B;  1G1T A;  1UKM A;  3VYK A;  1HYR A;  3GPR C;  4KMB 1;  1DY2 A;  1TN3 A;  4J6Q A;  2N40 A;  1KOE A;  1G1S A;  1ESL A;  3FF7 C;  1IJK B;  4WUX A;  4N32 A;  4G9A A;  2MTI A;  4QKI A;  3ALS A;  1WT9 A;  2RIC A;  3WH3 A;  5FFR A;  1KWY A;  4ZRW A;  1KZE 1;  3BX4 A;  1FIF A;  3P5H A;  2ORK A;  1SL6 A;  4ZES A;  4M1G A;  3IKR A;  1EGI A;  1IXX B;  1Y17 A;  1KZA 1;  2YHF A;  2PF5 A;  1YXJ A;  1IOD A;  1HQ8 A;  1RDL 1;  1BNL A;  3UBU A;  3WWK C;  1E5U I;  1QO3 C;  1AFA 1;  2GGX A;  3IKP A;  2BPE A;  1DY1 A;  1C3A A;  1O7C T;  3FF8 C;  4E52 A;  1SL4 A;  1KX1 A;  1QDD A;  4GJ0 A;  4LU5 A;  1H8U A;  1R13 A;  1KWV A;  2MSB A;  4GK1 A;  3PAK A;  1KZB 1;  3P5F A;  2ZIB A;  5KTH A;  1G1Q A;  1SB2 B;  5FFT A;  3GPR B;  2RIA A;  4YMD A;  1KCG A;  2OS9 A;  1JWI B;  3G84 A;  4ZET A;  3C22 A;  3IKQ A;  1UMR C;  1U0N C;  1RDM 1;  3BX4 B;  4AK8 A;  4G96 A;  1OZ7 B;  4N33 A;  1BCJ 1;  4QKH A;  2ORJ A;  3KQG A;  3PBF A;  3ZHG A;  3P5E A;  3G8L A;  3NCX A;  4J6J A;  1KWW A;  4QKJ A;  4CSY A;  4J6L A;  4UWW A;  3G81 A;  2ZWK A;  1PW9 A;  2LS8 A;  4YLI A;  1BV4 A;  3HUP A;  4CAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...