2NXSA

Structural and kinetic effects of hydrophobic mutations in the active site of human carbonic anhydrase ii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGFGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Speeding Up Proton Transfer in a Fast Enzyme: Kinetic and Crystallographic Studies on the Effect of Hydrophobic Amino Acid Substitutions in the Active Site of Human Carbonic Anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords carbonic anhydrase 2
total genus 74
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2nxsA00
2CBEA 4K13A 3S8XA 3CAJA 4TWLA 5FNGA 1I90A 2FNKA 3U7CA 3S76A 3HS4A 3RYYA 3TMJA 2QOAA 1CNCA 5FL4A 1I9OA 2GEHA 3D0NA 1FQMA 3MNIA 2GD8A 4CQ0A 9CA2A 2NNSA 5JGSB 5J8ZA 3OYSA 1TG3A 5DSMA 3KOIA 4KNIA 3DD8A 1G53A 4MDMA 2NWPA 4HF3A 3RZ7A 4FVNA 2EU3A 1HUGA 3V2JA 1CVHA 4R59A 3KWAA 3MNAA 5CA2A 4PYYA 1IF6A 1F2WA 1KEQA 5G01A 1BZMA 4G0CA 4YHAA 5SZ2A 2NWYA 4ZWXA 4Q6EA 4WL4A 1IF5A 3N0NA 4KAPA 4X5SA 2NNVA 3K2FA 2H15A 3DC3A 4K0TA 5FLSA 5EKMA 2NXRA 4JSZA 1TH9A 3TVOX 3M5TA 3Q31A 2NNOA 4ZWYA 3B4FA 1THKA 5EHWA 1CAMA 3RYXB 3NJ9A 3OILA 4M2RA 3IBNA 5JQ0A 1I9PA 4YYTA 1CCSA 4XIWA 1ZSAA 5SZ1A 1UGCA 1T9NA 1UGFA 4MO8A 4YGNA 1YO2A 1RAZA 1G3ZA 4KUWA 4HT0A 3OYQA 3F7BA 3KNEA 3N2PA 3RYZA 3EFIA 2NWZA 4Z1KA 1YO1A 1FQLA 4WUPA 3M40A 1UGDA 4Q7SA 1XPZA 2Q1QA 2AX2A 3T5ZA 5BNLA 4Q8XA 5EHEA 2ZNCA 4E3GA 4E3HA 4YX4A 1UGAA 2WEJA 2FMZA 3IEOA 5AMDA 3T83A 4Q81A 1BNMA 1BNWA 1BNNA 4QJWA 5JEGB 1CAYA 1I9NA 2HFWA 2QP6A 4ITPA 3MNJA 4L5WA 4QEFA 3VBDA 5SZ4A 4QJPA 5EZTX 4Q8YA 1Z97A 1EOUA 1XEVA 1XQ0A 3DAZA 1JCZA 4QSIA 1ZH9A 4KP5A 1G4JA 3B1BA 5FDIA 3CYUA 1BN3A 3W6IA 2CBDA 1CRAA 1OKNA 4DZ7A 1ZE8A 4Q06A 1G4OA 2O4ZA 1UGBA 3DBUA 1CRMA 3S77B 4R5BA 4YXUA 4Q09A 1ZSCA 5L3OA 3RZ8A 3D93A 3UYNA 3MNHA 5DSOA 3V3HB 4WUQA 5FLPA 5SZ0A 1HUHA 2AW1A 4RUXA 4Q7WA 4HEYA 4KNNA 4CNVA 5SZ6A 5E2RA 3NI5A 3OKVA 1RZEA 1CVEA 3M14A 4M2VA 3MHLA 5DSLA 4YXIA 4Q99A 2OSMA 4CNWA 3CA2A 4LU3A 5DOHA 4QY3A 2X7UA 3MDZA 1UGGA 5JEPB 2HL4A 1CANA 3RZ0B 3IBUA 3MNKA 1CNGA 3T85A 1ZNCA 2FOQA 2NWOA 3T82A 4WR7A 5JDVB 4ZAOA 3IBLA 4YGLA 3DC9A 2NN1A 1G46A 3MMFA 3M5SA 2FOVA 5LMDA 5C8IA 5SZ5A 2Q38A 5EH8A 1CINA 4Q9YA 1BN4A 1MOOA 4ETQC 4LHIA 1FR7A 4C3TA 3DCSA 4Y0JA 3F8EA 5FNHA 3RGEA 5FNJA 1RJ6A 2ABEA 4XIXA 1JV0A 4N16A 1ZGEA 5FL6A 4Q87A 3S9TA 1CVAA 1TTMA 4ZWZA 1CNJA 2NXSA 3S74B 2POVA 1CVDA 3M1JA 4PQ7A 4CNRA 1I91A 4XFWA 1HEAA 3HKNA 3DD0A 4FIKA 2H4NA 1LZVA 3M04A 4ITOA 4PZHA 3SAXA 3HKTA 1I9MA 1YDCA 3V5GA 1TBTX 3W6HA 1FSQA 4QK3A 1CNBA 1LG6A 5DVXA 4BCWA 3M1QA 2FOSA 1CCTA 4KNMA 3GZ0A 1KWQA 3MYQA 1H9NA 3MHMA 1DMYA 1YO0A 5FNIA 1IF9A 3ML5A 1G48A 5AMLA 4Z1EA 4FU5A 1RZAA 3P4VA 1ZFKA 4RUZA 3OIKA 3DCWA 1CVBA 3U47A 1DCBA 2CA2A 4WW6A 1KOPA 4ZWIA 1HECA 1ZFQA 1AM6A 2HD6A 5DSPA 4UOVA 3N4BA 3PYKA 4Q7PA 4QSAA 1CNIA 1RZDA 3SBHA 1IF7A 1J9WA 1TEQX 1ZSBA 3BL0A 1HEDA 3JXHC 3KIGA 3P58A 4L5VA 5SZ7A 4CACA 2WD3A 7CA2A 2POWA 5E2MA 4E9OX 4YGKA 4HBAA 4R5AA 5E5UA 3T84A 2IT4A 3M2NA 5EOIA 3IGPA 1OKMA 3SBIA 3MZCA 1I9LA 5G0CA 2QO8A 1CALA 3V3FA 2FOYA 4RFCA 2NMXA 4QIYA 3KOKA 3FE4A 1G0EA 4MDLA 3UYQA 3C7PA 3HKUA 3U3AX 4K1QA 1FLJA 1YDAA 3N3JA 12CAA 4YXOA 5JQTA 1RAYA 3TVNX 3CZVA 4Z1NA 1CNKA 1KWRA 3KS3A 1LGDA 4HT2A 5AMGA 1RZCA 1G52A 4FL7A 1BN1A 4PYXA 5G03A 3RYJB 4YWPA 3M98A 4ZX0A 5EH7A 4QJXA 3M2ZA 2HNCA 1RJ5A 2VVBX 2EZ7A 3HLJA 3M2YA 5E5RA 3M1WA 1CVFA 4CA2A 4XE1A 4FVOA 4RN4A 4Q49A 4KP8A 5FNMA 1BNVA 1LG5A 5DSNA 5JG5B 5E2KA 3SAPA 4E5QA 3HFPA 4KNJA 1CNYA 2ILIA 4Q8ZA 5BRUA 5JG3B 3DV7A 1DCAA 4K0SA 1CA2A 1KOQA 5G0BA 3P55A 1A42A 2NN7A 4QK1A 3P44A 3QYKA 1HEBA 4HU1A 5E2SA 2W2JA 3OY0A 4RH2A 3V2MA 1CZMA 4Q0LA 4QJ0A 1TB0X 3JXFA 1H4NA 1AZMA 1BNTA 1H9QA 4QJMA 1XEGA 4HEZA 4G7AA 5EH5A 1LUGA 4QSBA 5FLTA 3S75B 1BNUA 4TWMA 2CBCA 3V7XA 3P5LA 5E2NA 3FW3A 3L14A 5DSRA 3V3IB 3RLDA 1TEUX 2WEHA 3P5AA 3M5EA 1TG9A 5FL5A 3IBIA 1G45A 3IAIA 4E49A 4YGFA 5JESB 4COQA 4RFDA 1URTA 3D9ZA 3K34A 1BNQA 1CILA 4FPTA 4JSWA 2WEGA 3K7KA 1HCBA 1I8ZA 2OSFA 5BYIA 3P3HA 4RIUA 4RUYA 3DA2A 2HOCA 3OKUA 1IF8A 2FMGA 4XZ5A 4M2UA 4IDRX 4QIZA 1I9QA 5FLRA 4Q08A 2Q1BA 5IPZA 5FLQA 3M3XA 1CNHA 3RJ7A 2F14A 5FLOA 3KKXA 2NNGA 5SZ3A 4E3FA 1G6VA 1G1DA 1CAIA 3D8WA 3V3GB 1OKLA 1CIMA 1Y7WA 4N0XB 1CNXA 1BCDA 1BICA 2FNMA 4HEWA 1BV3A 3M96A 5DSQA 5L6KA 3V3JA 3NB5A 3RZ1B 5DSKA 4RIVA 1UGEA 4ILXA 4Q07A 4LP6A 3F4XA 1CAOA 3S72B 3MNUA 4JSSA 5BRVA 2FOUA 3T5UA 5FDCA 1CAHA 3S78B 5CLUA 1DMXA 1YDBA 1Z93A 3KONA 4KV0A 3S97A 5HPJA 1HVAA 1FSRA 4Q6DA 5EHVA 2HKKA 2VVAX 3PJJA 3ML2A 3RG4A 8CA2A 1V9IC 4FRCA 3MHOA 5CJFA 4MLXA 4KUVA 2EU2A 5DSJA 3P3JA 3DVBA 4JS6A 1FQRA 3DCCA 3RYVB 2FW4A 1OQ5A 3KLDB 4KUYA 5CACA 3R17B 2WEOA 4JSAA 1V9EA 5EKJA 4MLTA 1Z9YA 5JEHB 3M2XA 4E4AA 5E28A 1RZBA 3LXEA 3JXGA 1AVNA 3FFPX 2CABA 5FNKA 4L5UA 3U45X 5JGTB 4MTYA 3MHCA 3M1KA 2CBBA 3S73B 1CAKA 3BETA 4BF6A 1CAJA 4Q83A 5DSIA 3F7UA 3PO6A 3R16A 4Q90A 5DOGA 4Z1JA 2X7SA 1CVCA 1FQNA 1ZGFA 4QJOA 4QSJA 2NXTA 1IF4A 4IWZA 5A6HA 4DZ9A 3RG3A 4M2WA 4YGJA 1MUAA 5FNLA 1G0FA 3MWOA 1HCAA 4Q7VA 1G54A 5DRSA 4BF1A 1CNWA 5EIJA 4YVYA 2POUA 4QK2A 3DVDA 4QTLA 1CA3A 1CAZA 3RZ5A 3M67A 3DVCA 1TE3X 4K0ZA 4CNXA 4MDGA 3HKQA 2FNNA 4Z0QA 1YDDA 4ZX1A 5BRWA 5EKHA 3S71B 4GL1X 3BL1A 4E3DA 2CBAA 3EFTA 3ZP9A 4Q78A 5A25A 3D92A 4WW8A 2WD2A 1JD0A 4PXXA 6CA2A 1CCUA 3MHIA 3OIMA 3ZNCA 1FR4A 2X7TA 1FSNA
chains in the Genus database with same CATH superfamily
2CBEA 4K13A 3S8XA 3CAJA 4TWLA 5FNGA 1I90A 2FNKA 3U7CA 3S76A 3HS4A 3RYYA 3TMJA 2QOAA 1CNCA 5FL4A 1I9OA 2GEHA 3D0NA 1FQMA 3MNIA 2GD8A 4CQ0A 9CA2A 2NNSA 5JGSB 5J8ZA 3OYSA 1TG3A 5DSMA 3KOIA 4KNIA 3DD8A 1G53A 4MDMA 2NWPA 4HF3A 3RZ7A 4FVNA 2EU3A 1HUGA 3V2JA 1CVHA 4R59A 3KWAA 3MNAA 5CA2A 4PYYA 1IF6A 1F2WA 1KEQA 5G01A 1BZMA 4G0CA 4YHAA 5SZ2A 2NWYA 4ZWXA 4Q6EA 4WL4A 1IF5A 3N0NA 4KAPA 4X5SA 2NNVA 3K2FA 2H15A 3DC3A 4K0TA 5FLSA 5EKMA 2NXRA 4JSZA 1TH9A 3TVOX 3M5TA 3Q31A 2NNOA 4ZWYA 3B4FA 1THKA 5EHWA 1CAMA 3RYXB 3NJ9A 3OILA 4M2RA 3IBNA 5JQ0A 1I9PA 4YYTA 1CCSA 4XIWA 1ZSAA 5SZ1A 1UGCA 1T9NA 1UGFA 4MO8A 4YGNA 1YO2A 1RAZA 1G3ZA 4KUWA 4HT0A 3OYQA 3F7BA 3KNEA 3N2PA 3RYZA 3EFIA 2NWZA 4Z1KA 1YO1A 1FQLA 4WUPA 3M40A 1UGDA 4Q7SA 1XPZA 2Q1QA 2AX2A 3T5ZA 5BNLA 4Q8XA 5EHEA 2ZNCA 4E3GA 4E3HA 4YX4A 1UGAA 2WEJA 2FMZA 3IEOA 5AMDA 3T83A 4Q81A 1BNMA 1BNWA 1BNNA 4QJWA 5JEGB 1CAYA 1I9NA 2HFWA 2QP6A 4ITPA 3MNJA 4L5WA 4QEFA 3VBDA 5SZ4A 4QJPA 5EZTX 4Q8YA 1Z97A 1EOUA 1XEVA 1XQ0A 3DAZA 1JCZA 4QSIA 1ZH9A 4KP5A 1G4JA 3B1BA 5FDIA 3CYUA 1BN3A 3W6IA 2CBDA 1CRAA 1OKNA 4DZ7A 1ZE8A 4Q06A 1G4OA 2O4ZA 1UGBA 3DBUA 1CRMA 3S77B 4R5BA 4YXUA 4Q09A 1ZSCA 5L3OA 3RZ8A 3D93A 3UYNA 3MNHA 5DSOA 3V3HB 4WUQA 5FLPA 5SZ0A 1HUHA 2AW1A 4RUXA 4Q7WA 4HEYA 4KNNA 4CNVA 5SZ6A 5E2RA 3NI5A 3OKVA 1RZEA 1CVEA 3M14A 4M2VA 3MHLA 5DSLA 4YXIA 4Q99A 2OSMA 4CNWA 3CA2A 4LU3A 5DOHA 4QY3A 2X7UA 3MDZA 1UGGA 5JEPB 2HL4A 1CANA 3RZ0B 3IBUA 3MNKA 1CNGA 3T85A 1ZNCA 2FOQA 2NWOA 3T82A 4WR7A 5JDVB 4ZAOA 3IBLA 4YGLA 3DC9A 2NN1A 1G46A 3MMFA 3M5SA 2FOVA 5LMDA 5C8IA 5SZ5A 2Q38A 5EH8A 1CINA 4Q9YA 1BN4A 1MOOA 4ETQC 4LHIA 1FR7A 4C3TA 3DCSA 4Y0JA 3F8EA 5FNHA 3RGEA 5FNJA 1RJ6A 2ABEA 4XIXA 1JV0A 4N16A 1ZGEA 5FL6A 4Q87A 3S9TA 1CVAA 1TTMA 4ZWZA 1CNJA 2NXSA 3S74B 2POVA 1CVDA 3M1JA 4PQ7A 4CNRA 1I91A 4XFWA 1HEAA 3HKNA 3DD0A 4FIKA 2H4NA 1LZVA 3M04A 4ITOA 4PZHA 3SAXA 3HKTA 1I9MA 1YDCA 3V5GA 1TBTX 3W6HA 1FSQA 4QK3A 1CNBA 1LG6A 5DVXA 4BCWA 3M1QA 2FOSA 1CCTA 4KNMA 3GZ0A 1KWQA 3MYQA 1H9NA 3MHMA 1DMYA 1YO0A 5FNIA 1IF9A 3ML5A 1G48A 5AMLA 4Z1EA 4FU5A 1RZAA 3P4VA 1ZFKA 4RUZA 3OIKA 3DCWA 1CVBA 3U47A 1DCBA 2CA2A 4WW6A 1KOPA 4ZWIA 1HECA 1ZFQA 1AM6A 2HD6A 5DSPA 4UOVA 3N4BA 3PYKA 4Q7PA 4QSAA 1CNIA 1RZDA 3SBHA 1IF7A 1J9WA 1TEQX 1ZSBA 3BL0A 1HEDA 3JXHC 3KIGA 3P58A 4L5VA 5SZ7A 4CACA 2WD3A 7CA2A 2POWA 5E2MA 4E9OX 4YGKA 4HBAA 4R5AA 5E5UA 3T84A 2IT4A 3M2NA 5EOIA 3IGPA 1OKMA 3SBIA 3MZCA 1I9LA 5G0CA 2QO8A 1CALA 3V3FA 2FOYA 4RFCA 2NMXA 4QIYA 3KOKA 3FE4A 1G0EA 4MDLA 3UYQA 3C7PA 3HKUA 3U3AX 4K1QA 1FLJA 1YDAA 3N3JA 12CAA 4YXOA 5JQTA 1RAYA 3TVNX 3CZVA 4Z1NA 1CNKA 1KWRA 3KS3A 1LGDA 4HT2A 5AMGA 1RZCA 1G52A 4FL7A 1BN1A 4PYXA 5G03A 3RYJB 4YWPA 3M98A 4ZX0A 5EH7A 4QJXA 3M2ZA 2HNCA 1RJ5A 2VVBX 2EZ7A 3HLJA 3M2YA 5E5RA 3M1WA 1CVFA 4CA2A 4XE1A 4FVOA 4RN4A 4Q49A 4KP8A 5FNMA 1BNVA 1LG5A 5DSNA 5JG5B 5E2KA 3SAPA 4E5QA 3HFPA 4KNJA 1CNYA 2ILIA 4Q8ZA 5BRUA 5JG3B 3DV7A 1DCAA 4K0SA 1CA2A 1KOQA 5G0BA 3P55A 1A42A 2NN7A 4QK1A 3P44A 3QYKA 1HEBA 4HU1A 5E2SA 2W2JA 3OY0A 4RH2A 3V2MA 1CZMA 4Q0LA 4QJ0A 1TB0X 3JXFA 1H4NA 1AZMA 1BNTA 1H9QA 4QJMA 1XEGA 4HEZA 4G7AA 5EH5A 1LUGA 4QSBA 5FLTA 3S75B 1BNUA 4TWMA 2CBCA 3V7XA 3P5LA 5E2NA 3FW3A 3L14A 5DSRA 3V3IB 3RLDA 1TEUX 2WEHA 3P5AA 3M5EA 1TG9A 5FL5A 3IBIA 1G45A 3IAIA 4E49A 4YGFA 5JESB 4COQA 4RFDA 1URTA 3D9ZA 3K34A 1BNQA 1CILA 4FPTA 4JSWA 2WEGA 3K7KA 1HCBA 1I8ZA 2OSFA 5BYIA 3P3HA 4RIUA 4RUYA 3DA2A 2HOCA 3OKUA 1IF8A 2FMGA 4XZ5A 4M2UA 4IDRX 4QIZA 1I9QA 5FLRA 4Q08A 2Q1BA 5IPZA 5FLQA 3M3XA 1CNHA 3RJ7A 2F14A 5FLOA 3KKXA 2NNGA 5SZ3A 4E3FA 1G6VA 1G1DA 1CAIA 3D8WA 3V3GB 1OKLA 1CIMA 1Y7WA 4N0XB 1CNXA 1BCDA 1BICA 2FNMA 4HEWA 1BV3A 3M96A 5DSQA 5L6KA 3V3JA 3NB5A 3RZ1B 5DSKA 4RIVA 1UGEA 4ILXA 4Q07A 4LP6A 3F4XA 1CAOA 3S72B 3MNUA 4JSSA 5BRVA 2FOUA 3T5UA 5FDCA 1CAHA 3S78B 5CLUA 1DMXA 1YDBA 1Z93A 3KONA 4KV0A 3S97A 5HPJA 1HVAA 1FSRA 4Q6DA 5EHVA 2HKKA 2VVAX 3PJJA 3ML2A 3RG4A 8CA2A 1V9IC 4FRCA 3MHOA 5CJFA 4MLXA 4KUVA 2EU2A 5DSJA 3P3JA 3DVBA 4JS6A 1FQRA 3DCCA 3RYVB 2FW4A 1OQ5A 3KLDB 4KUYA 5CACA 3R17B 2WEOA 4JSAA 1V9EA 5EKJA 4MLTA 1Z9YA 5JEHB 3M2XA 4E4AA 5E28A 1RZBA 3LXEA 3JXGA 1AVNA 3FFPX 2CABA 5FNKA 4L5UA 3U45X 5JGTB 4MTYA 3MHCA 3M1KA 2CBBA 3S73B 1CAKA 3BETA 4BF6A 1CAJA 4Q83A 5DSIA 3F7UA 3PO6A 3R16A 4Q90A 5DOGA 4Z1JA 2X7SA 1CVCA 1FQNA 1ZGFA 4QJOA 4QSJA 2NXTA 1IF4A 4IWZA 5A6HA 4DZ9A 3RG3A 4M2WA 4YGJA 1MUAA 5FNLA 1G0FA 3MWOA 1HCAA 4Q7VA 1G54A 5DRSA 4BF1A 1CNWA 5EIJA 4YVYA 2POUA 4QK2A 3DVDA 4QTLA 1CA3A 1CAZA 3RZ5A 3M67A 3DVCA 1TE3X 4K0ZA 4CNXA 4MDGA 3HKQA 2FNNA 4Z0QA 1YDDA 4ZX1A 5BRWA 5EKHA 3S71B 4GL1X 3BL1A 4E3DA 2CBAA 3EFTA 3ZP9A 4Q78A 5A25A 3D92A 4WW8A 2WD2A 1JD0A 4PXXA 6CA2A 1CCUA 3MHIA 3OIMA 3ZNCA 1FR4A 2X7TA 1FSNA
chains in the Genus database with same CATH topology
2CBEA 4K13A 3S8XA 3CAJA 4TWLA 5FNGA 1I90A 2FNKA 3U7CA 3S76A 3HS4A 3RYYA 3TMJA 2QOAA 1CNCA 5FL4A 1I9OA 2GEHA 3D0NA 1FQMA 3MNIA 2GD8A 4CQ0A 9CA2A 2NNSA 5JGSB 5J8ZA 3OYSA 1TG3A 5DSMA 3KOIA 4KNIA 3DD8A 1G53A 4MDMA 2NWPA 4HF3A 3RZ7A 4FVNA 2EU3A 1HUGA 3V2JA 1CVHA 4R59A 3KWAA 3MNAA 5CA2A 4PYYA 1IF6A 1F2WA 1KEQA 5G01A 1BZMA 4G0CA 4YHAA 5SZ2A 2NWYA 4ZWXA 4Q6EA 4WL4A 1IF5A 3N0NA 4KAPA 4X5SA 2NNVA 3K2FA 2H15A 3DC3A 4K0TA 5FLSA 5EKMA 2NXRA 4JSZA 1TH9A 3TVOX 3M5TA 3Q31A 2NNOA 4ZWYA 3B4FA 1THKA 5EHWA 1CAMA 3RYXB 3NJ9A 3OILA 4M2RA 3IBNA 5JQ0A 1I9PA 4YYTA 1CCSA 4XIWA 1ZSAA 5SZ1A 1UGCA 1T9NA 1UGFA 4MO8A 4YGNA 1YO2A 1RAZA 1G3ZA 4KUWA 4HT0A 3OYQA 3F7BA 3KNEA 3N2PA 3RYZA 3EFIA 2NWZA 4Z1KA 1YO1A 1FQLA 4WUPA 3M40A 1UGDA 4Q7SA 1XPZA 2Q1QA 2AX2A 3T5ZA 5BNLA 4Q8XA 5EHEA 2ZNCA 4E3GA 4E3HA 4YX4A 1UGAA 2WEJA 2FMZA 3IEOA 5AMDA 3T83A 4Q81A 1BNMA 1BNWA 1BNNA 4QJWA 5JEGB 1CAYA 1I9NA 2HFWA 2QP6A 4ITPA 3MNJA 4L5WA 4QEFA 3VBDA 5SZ4A 4QJPA 5EZTX 4Q8YA 1Z97A 1EOUA 1XEVA 1XQ0A 3DAZA 1JCZA 4QSIA 1ZH9A 4KP5A 1G4JA 3B1BA 5FDIA 3CYUA 1BN3A 3W6IA 2CBDA 1CRAA 1OKNA 4DZ7A 1ZE8A 4Q06A 1G4OA 2O4ZA 1UGBA 3DBUA 1CRMA 3S77B 4R5BA 4YXUA 4Q09A 1ZSCA 5L3OA 3RZ8A 3D93A 3UYNA 3MNHA 5DSOA 3V3HB 4WUQA 5FLPA 5SZ0A 1HUHA 2AW1A 4RUXA 4Q7WA 4HEYA 4KNNA 4CNVA 5SZ6A 5E2RA 3NI5A 3OKVA 1RZEA 1CVEA 3M14A 4M2VA 3MHLA 5DSLA 4YXIA 4Q99A 2OSMA 4CNWA 3CA2A 4LU3A 5DOHA 4QY3A 2X7UA 3MDZA 1UGGA 5JEPB 2HL4A 1CANA 3RZ0B 3IBUA 3MNKA 1CNGA 3T85A 1ZNCA 2FOQA 2NWOA 3T82A 4WR7A 5JDVB 4ZAOA 3IBLA 4YGLA 3DC9A 2NN1A 1G46A 3MMFA 3M5SA 2FOVA 5LMDA 5C8IA 5SZ5A 2Q38A 5EH8A 1CINA 4Q9YA 1BN4A 1MOOA 4ETQC 4LHIA 1FR7A 4C3TA 3DCSA 4Y0JA 3F8EA 5FNHA 3RGEA 5FNJA 1RJ6A 2ABEA 4XIXA 1JV0A 4N16A 1ZGEA 5FL6A 4Q87A 3S9TA 1CVAA 1TTMA 4ZWZA 1CNJA 2NXSA 3S74B 2POVA 1CVDA 3M1JA 4PQ7A 4CNRA 1I91A 4XFWA 1HEAA 3HKNA 3DD0A 4FIKA 2H4NA 1LZVA 3M04A 4ITOA 4PZHA 3SAXA 3HKTA 1I9MA 1YDCA 3V5GA 1TBTX 3W6HA 1FSQA 4QK3A 1CNBA 1LG6A 5DVXA 4BCWA 3M1QA 2FOSA 1CCTA 4KNMA 3GZ0A 1KWQA 3MYQA 1H9NA 3MHMA 1DMYA 1YO0A 5FNIA 1IF9A 3ML5A 1G48A 5AMLA 4Z1EA 4FU5A 1RZAA 3P4VA 1ZFKA 4RUZA 3OIKA 3DCWA 1CVBA 3U47A 1DCBA 2CA2A 4WW6A 1KOPA 4ZWIA 1HECA 1ZFQA 1AM6A 2HD6A 5DSPA 4UOVA 3N4BA 3PYKA 4Q7PA 4QSAA 1CNIA 1RZDA 3SBHA 1IF7A 1J9WA 1TEQX 1ZSBA 3BL0A 1HEDA 3JXHC 3KIGA 3P58A 4L5VA 5SZ7A 4CACA 2WD3A 7CA2A 2POWA 5E2MA 4E9OX 4YGKA 4HBAA 4R5AA 5E5UA 3T84A 2IT4A 3M2NA 5EOIA 3IGPA 1OKMA 3SBIA 3MZCA 1I9LA 5G0CA 2QO8A 1CALA 3V3FA 2FOYA 4RFCA 2NMXA 4QIYA 3KOKA 3FE4A 1G0EA 4MDLA 3UYQA 3C7PA 3HKUA 3U3AX 4K1QA 1FLJA 1YDAA 3N3JA 12CAA 4YXOA 5JQTA 1RAYA 3TVNX 3CZVA 4Z1NA 1CNKA 1KWRA 3KS3A 1LGDA 4HT2A 5AMGA 1RZCA 1G52A 4FL7A 1BN1A 4PYXA 5G03A 3RYJB 4YWPA 3M98A 4ZX0A 5EH7A 4QJXA 3M2ZA 2HNCA 1RJ5A 2VVBX 2EZ7A 3HLJA 3M2YA 5E5RA 3M1WA 1CVFA 4CA2A 4XE1A 4FVOA 4RN4A 4Q49A 4KP8A 5FNMA 1BNVA 1LG5A 5DSNA 5JG5B 5E2KA 3SAPA 4E5QA 3HFPA 4KNJA 1CNYA 2ILIA 4Q8ZA 5BRUA 5JG3B 3DV7A 1DCAA 4K0SA 1CA2A 1KOQA 5G0BA 3P55A 1A42A 2NN7A 4QK1A 3P44A 3QYKA 1HEBA 4HU1A 5E2SA 2W2JA 3OY0A 4RH2A 3V2MA 1CZMA 4Q0LA 4QJ0A 1TB0X 3JXFA 1H4NA 1AZMA 1BNTA 1H9QA 4QJMA 1XEGA 4HEZA 4G7AA 5EH5A 1LUGA 4QSBA 5FLTA 3S75B 1BNUA 4TWMA 2CBCA 3V7XA 3P5LA 5E2NA 3FW3A 3L14A 5DSRA 3V3IB 3RLDA 1TEUX 2WEHA 3P5AA 3M5EA 1TG9A 5FL5A 3IBIA 1G45A 3IAIA 4E49A 4YGFA 5JESB 4COQA 4RFDA 1URTA 3D9ZA 3K34A 1BNQA 1CILA 4FPTA 4JSWA 2WEGA 3K7KA 1HCBA 1I8ZA 2OSFA 5BYIA 3P3HA 4RIUA 4RUYA 3DA2A 2HOCA 3OKUA 1IF8A 2FMGA 4XZ5A 4M2UA 4IDRX 4QIZA 1I9QA 5FLRA 4Q08A 2Q1BA 5IPZA 5FLQA 3M3XA 1CNHA 3RJ7A 2F14A 5FLOA 3KKXA 2NNGA 5SZ3A 4E3FA 1G6VA 1G1DA 1CAIA 3D8WA 3V3GB 1OKLA 1CIMA 1Y7WA 4N0XB 1CNXA 1BCDA 1BICA 2FNMA 4HEWA 1BV3A 3M96A 5DSQA 5L6KA 3V3JA 3NB5A 3RZ1B 5DSKA 4RIVA 1UGEA 4ILXA 4Q07A 4LP6A 3F4XA 1CAOA 3S72B 3MNUA 4JSSA 5BRVA 2FOUA 3T5UA 5FDCA 1CAHA 3S78B 5CLUA 1DMXA 1YDBA 1Z93A 3KONA 4KV0A 3S97A 5HPJA 1HVAA 1FSRA 4Q6DA 5EHVA 2HKKA 2VVAX 3PJJA 3ML2A 3RG4A 8CA2A 1V9IC 4FRCA 3MHOA 5CJFA 4MLXA 4KUVA 2EU2A 5DSJA 3P3JA 3DVBA 4JS6A 1FQRA 3DCCA 3RYVB 2FW4A 1OQ5A 3KLDB 4KUYA 5CACA 3R17B 2WEOA 4JSAA 1V9EA 5EKJA 4MLTA 1Z9YA 5JEHB 3M2XA 4E4AA 5E28A 1RZBA 3LXEA 3JXGA 1AVNA 3FFPX 2CABA 5FNKA 4L5UA 3U45X 5JGTB 4MTYA 3MHCA 3M1KA 2CBBA 3S73B 1CAKA 3BETA 4BF6A 1CAJA 4Q83A 5DSIA 3F7UA 3PO6A 3R16A 4Q90A 5DOGA 4Z1JA 2X7SA 1CVCA 1FQNA 1ZGFA 4QJOA 4QSJA 2NXTA 1IF4A 4IWZA 5A6HA 4DZ9A 3RG3A 4M2WA 4YGJA 1MUAA 5FNLA 1G0FA 3MWOA 1HCAA 4Q7VA 1G54A 5DRSA 4BF1A 1CNWA 5EIJA 4YVYA 2POUA 4QK2A 3DVDA 4QTLA 1CA3A 1CAZA 3RZ5A 3M67A 3DVCA 1TE3X 4K0ZA 4CNXA 4MDGA 3HKQA 2FNNA 4Z0QA 1YDDA 4ZX1A 5BRWA 5EKHA 3S71B 4GL1X 3BL1A 4E3DA 2CBAA 3EFTA 3ZP9A 4Q78A 5A25A 3D92A 4WW8A 2WD2A 1JD0A 4PXXA 6CA2A 1CCUA 3MHIA 3OIMA 3ZNCA 1FR4A 2X7TA 1FSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBE A;  4K13 A;  3S8X A;  3CAJ A;  4TWL A;  5FNG A;  1I90 A;  2FNK A;  3U7C A;  3S76 A;  3HS4 A;  3RYY A;  3TMJ A;  2QOA A;  1CNC A;  5FL4 A;  1I9O A;  2GEH A;  3D0N A;  1FQM A;  3MNI A;  2GD8 A;  4CQ0 A;  9CA2 A;  2NNS A;  5JGS B;  5J8Z A;  3OYS A;  1TG3 A;  5DSM A;  3KOI A;  4KNI A;  3DD8 A;  1G53 A;  4MDM A;  2NWP A;  4HF3 A;  3RZ7 A;  4FVN A;  2EU3 A;  1HUG A;  3V2J A;  1CVH A;  4R59 A;  3KWA A;  3MNA A;  5CA2 A;  4PYY A;  1IF6 A;  1F2W A;  1KEQ A;  5G01 A;  1BZM A;  4G0C A;  4YHA A;  5SZ2 A;  2NWY A;  4ZWX A;  4Q6E A;  4WL4 A;  1IF5 A;  3N0N A;  4KAP A;  4X5S A;  2NNV A;  3K2F A;  2H15 A;  3DC3 A;  4K0T A;  5FLS A;  5EKM A;  2NXR A;  4JSZ A;  1TH9 A;  3TVO X;  3M5T A;  3Q31 A;  2NNO A;  4ZWY A;  3B4F A;  1THK A;  5EHW A;  1CAM A;  3RYX B;  3NJ9 A;  3OIL A;  4M2R A;  3IBN A;  5JQ0 A;  1I9P A;  4YYT A;  1CCS A;  4XIW A;  1ZSA A;  5SZ1 A;  1UGC A;  1T9N A;  1UGF A;  4MO8 A;  4YGN A;  1YO2 A;  1RAZ A;  1G3Z A;  4KUW A;  4HT0 A;  3OYQ A;  3F7B A;  3KNE A;  3N2P A;  3RYZ A;  3EFI A;  2NWZ A;  4Z1K A;  1YO1 A;  1FQL A;  4WUP A;  3M40 A;  1UGD A;  4Q7S A;  1XPZ A;  2Q1Q A;  2AX2 A;  3T5Z A;  5BNL A;  4Q8X A;  5EHE A;  2ZNC A;  4E3G A;  4E3H A;  4YX4 A;  1UGA A;  2WEJ A;  2FMZ A;  3IEO A;  5AMD A;  3T83 A;  4Q81 A;  1BNM A;  1BNW A;  1BNN A;  4QJW A;  5JEG B;  1CAY A;  1I9N A;  2HFW A;  2QP6 A;  4ITP A;  3MNJ A;  4L5W A;  4QEF A;  3VBD A;  5SZ4 A;  4QJP A;  5EZT X;  4Q8Y A;  1Z97 A;  1EOU A;  1XEV A;  1XQ0 A;  3DAZ A;  1JCZ A;  4QSI A;  1ZH9 A;  4KP5 A;  1G4J A;  3B1B A;  5FDI A;  3CYU A;  1BN3 A;  3W6I A;  2CBD A;  1CRA A;  1OKN A;  4DZ7 A;  1ZE8 A;  4Q06 A;  1G4O A;  2O4Z A;  1UGB A;  3DBU A;  1CRM A;  3S77 B;  4R5B A;  4YXU A;  4Q09 A;  1ZSC A;  5L3O A;  3RZ8 A;  3D93 A;  3UYN A;  3MNH A;  5DSO A;  3V3H B;  4WUQ A;  5FLP A;  5SZ0 A;  1HUH A;  2AW1 A;  4RUX A;  4Q7W A;  4HEY A;  4KNN A;  4CNV A;  5SZ6 A;  5E2R A;  3NI5 A;  3OKV A;  1RZE A;  1CVE A;  3M14 A;  4M2V A;  3MHL A;  5DSL A;  4YXI A;  4Q99 A;  2OSM A;  4CNW A;  3CA2 A;  4LU3 A;  5DOH A;  4QY3 A;  2X7U A;  3MDZ A;  1UGG A;  5JEP B;  2HL4 A;  1CAN A;  3RZ0 B;  3IBU A;  3MNK A;  1CNG A;  3T85 A;  1ZNC A;  2FOQ A;  2NWO A;  3T82 A;  4WR7 A;  5JDV B;  4ZAO A;  3IBL A;  4YGL A;  3DC9 A;  2NN1 A;  1G46 A;  3MMF A;  3M5S A;  2FOV A;  5LMD A;  5C8I A;  5SZ5 A;  2Q38 A;  5EH8 A;  1CIN A;  4Q9Y A;  1BN4 A;  1MOO A;  4ETQ C;  4LHI A;  1FR7 A;  4C3T A;  3DCS A;  4Y0J A;  3F8E A;  5FNH A;  3RGE A;  5FNJ A;  1RJ6 A;  2ABE A;  4XIX A;  1JV0 A;  4N16 A;  1ZGE A;  5FL6 A;  4Q87 A;  3S9T A;  1CVA A;  1TTM A;  4ZWZ A;  1CNJ A;  2NXS A;  3S74 B;  2POV A;  1CVD A;  3M1J A;  4PQ7 A;  4CNR A;  1I91 A;  4XFW A;  1HEA A;  3HKN A;  3DD0 A;  4FIK A;  2H4N A;  1LZV A;  3M04 A;  4ITO A;  4PZH A;  3SAX A;  3HKT A;  1I9M A;  1YDC A;  3V5G A;  1TBT X;  3W6H A;  1FSQ A;  4QK3 A;  1CNB A;  1LG6 A;  5DVX A;  4BCW A;  3M1Q A;  2FOS A;  1CCT A;  4KNM A;  3GZ0 A;  1KWQ A;  3MYQ A;  1H9N A;  3MHM A;  1DMY A;  1YO0 A;  5FNI A;  1IF9 A;  3ML5 A;  1G48 A;  5AML A;  4Z1E A;  4FU5 A;  1RZA A;  3P4V A;  1ZFK A;  4RUZ A;  3OIK A;  3DCW A;  1CVB A;  3U47 A;  1DCB A;  2CA2 A;  4WW6 A;  1KOP A;  4ZWI A;  1HEC A;  1ZFQ A;  1AM6 A;  2HD6 A;  5DSP A;  4UOV A;  3N4B A;  3PYK A;  4Q7P A;  4QSA A;  1CNI A;  1RZD A;  3SBH A;  1IF7 A;  1J9W A;  1TEQ X;  1ZSB A;  3BL0 A;  1HED A;  3JXH C;  3KIG A;  3P58 A;  4L5V A;  5SZ7 A;  4CAC A;  2WD3 A;  7CA2 A;  2POW A;  5E2M A;  4E9O X;  4YGK A;  4HBA A;  4R5A A;  5E5U A;  3T84 A;  2IT4 A;  3M2N A;  5EOI A;  3IGP A;  1OKM A;  3SBI A;  3MZC A;  1I9L A;  5G0C A;  2QO8 A;  1CAL A;  3V3F A;  2FOY A;  4RFC A;  2NMX A;  4QIY A;  3KOK A;  3FE4 A;  1G0E A;  4MDL A;  3UYQ A;  3C7P A;  3HKU A;  3U3A X;  4K1Q A;  1FLJ A;  1YDA A;  3N3J A;  12CA A;  4YXO A;  5JQT A;  1RAY A;  3TVN X;  3CZV A;  4Z1N A;  1CNK A;  1KWR A;  3KS3 A;  1LGD A;  4HT2 A;  5AMG A;  1RZC A;  1G52 A;  4FL7 A;  1BN1 A;  4PYX A;  5G03 A;  3RYJ B;  4YWP A;  3M98 A;  4ZX0 A;  5EH7 A;  4QJX A;  3M2Z A;  2HNC A;  1RJ5 A;  2VVB X;  2EZ7 A;  3HLJ A;  3M2Y A;  5E5R A;  3M1W A;  1CVF A;  4CA2 A;  4XE1 A;  4FVO A;  4RN4 A;  4Q49 A;  4KP8 A;  5FNM A;  1BNV A;  1LG5 A;  5DSN A;  5JG5 B;  5E2K A;  3SAP A;  4E5Q A;  3HFP A;  4KNJ A;  1CNY A;  2ILI A;  4Q8Z A;  5BRU A;  5JG3 B;  3DV7 A;  1DCA A;  4K0S A;  1CA2 A;  1KOQ A;  5G0B A;  3P55 A;  1A42 A;  2NN7 A;  4QK1 A;  3P44 A;  3QYK A;  1HEB A;  4HU1 A;  5E2S A;  2W2J A;  3OY0 A;  4RH2 A;  3V2M A;  1CZM A;  4Q0L A;  4QJ0 A;  1TB0 X;  3JXF A;  1H4N A;  1AZM A;  1BNT A;  1H9Q A;  4QJM A;  1XEG A;  4HEZ A;  4G7A A;  5EH5 A;  1LUG A;  4QSB A;  5FLT A;  3S75 B;  1BNU A;  4TWM A;  2CBC A;  3V7X A;  3P5L A;  5E2N A;  3FW3 A;  3L14 A;  5DSR A;  3V3I B;  3RLD A;  1TEU X;  2WEH A;  3P5A A;  3M5E A;  1TG9 A;  5FL5 A;  3IBI A;  1G45 A;  3IAI A;  4E49 A;  4YGF A;  5JES B;  4COQ A;  4RFD A;  1URT A;  3D9Z A;  3K34 A;  1BNQ A;  1CIL A;  4FPT A;  4JSW A;  2WEG A;  3K7K A;  1HCB A;  1I8Z A;  2OSF A;  5BYI A;  3P3H A;  4RIU A;  4RUY A;  3DA2 A;  2HOC A;  3OKU A;  1IF8 A;  2FMG A;  4XZ5 A;  4M2U A;  4IDR X;  4QIZ A;  1I9Q A;  5FLR A;  4Q08 A;  2Q1B A;  5IPZ A;  5FLQ A;  3M3X A;  1CNH A;  3RJ7 A;  2F14 A;  5FLO A;  3KKX A;  2NNG A;  5SZ3 A;  4E3F A;  1G6V A;  1G1D A;  1CAI A;  3D8W A;  3V3G B;  1OKL A;  1CIM A;  1Y7W A;  4N0X B;  1CNX A;  1BCD A;  1BIC A;  2FNM A;  4HEW A;  1BV3 A;  3M96 A;  5DSQ A;  5L6K A;  3V3J A;  3NB5 A;  3RZ1 B;  5DSK A;  4RIV A;  1UGE A;  4ILX A;  4Q07 A;  4LP6 A;  3F4X A;  1CAO A;  3S72 B;  3MNU A;  4JSS A;  5BRV A;  2FOU A;  3T5U A;  5FDC A;  1CAH A;  3S78 B;  5CLU A;  1DMX A;  1YDB A;  1Z93 A;  3KON A;  4KV0 A;  3S97 A;  5HPJ A;  1HVA A;  1FSR A;  4Q6D A;  5EHV A;  2HKK A;  2VVA X;  3PJJ A;  3ML2 A;  3RG4 A;  8CA2 A;  1V9I C;  4FRC A;  3MHO A;  5CJF A;  4MLX A;  4KUV A;  2EU2 A;  5DSJ A;  3P3J A;  3DVB A;  4JS6 A;  1FQR A;  3DCC A;  3RYV B;  2FW4 A;  1OQ5 A;  3KLD B;  4KUY A;  5CAC A;  3R17 B;  2WEO A;  4JSA A;  1V9E A;  5EKJ A;  4MLT A;  1Z9Y A;  5JEH B;  3M2X A;  4E4A A;  5E28 A;  1RZB A;  3LXE A;  3JXG A;  1AVN A;  3FFP X;  2CAB A;  5FNK A;  4L5U A;  3U45 X;  5JGT B;  4MTY A;  3MHC A;  3M1K A;  2CBB A;  3S73 B;  1CAK A;  3BET A;  4BF6 A;  1CAJ A;  4Q83 A;  5DSI A;  3F7U A;  3PO6 A;  3R16 A;  4Q90 A;  5DOG A;  4Z1J A;  2X7S A;  1CVC A;  1FQN A;  1ZGF A;  4QJO A;  4QSJ A;  2NXT A;  1IF4 A;  4IWZ A;  5A6H A;  4DZ9 A;  3RG3 A;  4M2W A;  4YGJ A;  1MUA A;  5FNL A;  1G0F A;  3MWO A;  1HCA A;  4Q7V A;  1G54 A;  5DRS A;  4BF1 A;  1CNW A;  5EIJ A;  4YVY A;  2POU A;  4QK2 A;  3DVD A;  4QTL A;  1CA3 A;  1CAZ A;  3RZ5 A;  3M67 A;  3DVC A;  1TE3 X;  4K0Z A;  4CNX A;  4MDG A;  3HKQ A;  2FNN A;  4Z0Q A;  1YDD A;  4ZX1 A;  5BRW A;  5EKH A;  3S71 B;  4GL1 X;  3BL1 A;  4E3D A;  2CBA A;  3EFT A;  3ZP9 A;  4Q78 A;  5A25 A;  3D92 A;  4WW8 A;  2WD2 A;  1JD0 A;  4PXX A;  6CA2 A;  1CCU A;  3MHI A;  3OIM A;  3ZNC A;  1FR4 A;  2X7T A;  1FSN A; 
#chains in the Genus database with same CATH topology
 2CBE A;  4K13 A;  3S8X A;  3CAJ A;  4TWL A;  5FNG A;  1I90 A;  2FNK A;  3U7C A;  3S76 A;  3HS4 A;  3RYY A;  3TMJ A;  2QOA A;  1CNC A;  5FL4 A;  1I9O A;  2GEH A;  3D0N A;  1FQM A;  3MNI A;  2GD8 A;  4CQ0 A;  9CA2 A;  2NNS A;  5JGS B;  5J8Z A;  3OYS A;  1TG3 A;  5DSM A;  3KOI A;  4KNI A;  3DD8 A;  1G53 A;  4MDM A;  2NWP A;  4HF3 A;  3RZ7 A;  4FVN A;  2EU3 A;  1HUG A;  3V2J A;  1CVH A;  4R59 A;  3KWA A;  3MNA A;  5CA2 A;  4PYY A;  1IF6 A;  1F2W A;  1KEQ A;  5G01 A;  1BZM A;  4G0C A;  4YHA A;  5SZ2 A;  2NWY A;  4ZWX A;  4Q6E A;  4WL4 A;  1IF5 A;  3N0N A;  4KAP A;  4X5S A;  2NNV A;  3K2F A;  2H15 A;  3DC3 A;  4K0T A;  5FLS A;  5EKM A;  2NXR A;  4JSZ A;  1TH9 A;  3TVO X;  3M5T A;  3Q31 A;  2NNO A;  4ZWY A;  3B4F A;  1THK A;  5EHW A;  1CAM A;  3RYX B;  3NJ9 A;  3OIL A;  4M2R A;  3IBN A;  5JQ0 A;  1I9P A;  4YYT A;  1CCS A;  4XIW A;  1ZSA A;  5SZ1 A;  1UGC A;  1T9N A;  1UGF A;  4MO8 A;  4YGN A;  1YO2 A;  1RAZ A;  1G3Z A;  4KUW A;  4HT0 A;  3OYQ A;  3F7B A;  3KNE A;  3N2P A;  3RYZ A;  3EFI A;  2NWZ A;  4Z1K A;  1YO1 A;  1FQL A;  4WUP A;  3M40 A;  1UGD A;  4Q7S A;  1XPZ A;  2Q1Q A;  2AX2 A;  3T5Z A;  5BNL A;  4Q8X A;  5EHE A;  2ZNC A;  4E3G A;  4E3H A;  4YX4 A;  1UGA A;  2WEJ A;  2FMZ A;  3IEO A;  5AMD A;  3T83 A;  4Q81 A;  1BNM A;  1BNW A;  1BNN A;  4QJW A;  5JEG B;  1CAY A;  1I9N A;  2HFW A;  2QP6 A;  4ITP A;  3MNJ A;  4L5W A;  4QEF A;  3VBD A;  5SZ4 A;  4QJP A;  5EZT X;  4Q8Y A;  1Z97 A;  1EOU A;  1XEV A;  1XQ0 A;  3DAZ A;  1JCZ A;  4QSI A;  1ZH9 A;  4KP5 A;  1G4J A;  3B1B A;  5FDI A;  3CYU A;  1BN3 A;  3W6I A;  2CBD A;  1CRA A;  1OKN A;  4DZ7 A;  1ZE8 A;  4Q06 A;  1G4O A;  2O4Z A;  1UGB A;  3DBU A;  1CRM A;  3S77 B;  4R5B A;  4YXU A;  4Q09 A;  1ZSC A;  5L3O A;  3RZ8 A;  3D93 A;  3UYN A;  3MNH A;  5DSO A;  3V3H B;  4WUQ A;  5FLP A;  5SZ0 A;  1HUH A;  2AW1 A;  4RUX A;  4Q7W A;  4HEY A;  4KNN A;  4CNV A;  5SZ6 A;  5E2R A;  3NI5 A;  3OKV A;  1RZE A;  1CVE A;  3M14 A;  4M2V A;  3MHL A;  5DSL A;  4YXI A;  4Q99 A;  2OSM A;  4CNW A;  3CA2 A;  4LU3 A;  5DOH A;  4QY3 A;  2X7U A;  3MDZ A;  1UGG A;  5JEP B;  2HL4 A;  1CAN A;  3RZ0 B;  3IBU A;  3MNK A;  1CNG A;  3T85 A;  1ZNC A;  2FOQ A;  2NWO A;  3T82 A;  4WR7 A;  5JDV B;  4ZAO A;  3IBL A;  4YGL A;  3DC9 A;  2NN1 A;  1G46 A;  3MMF A;  3M5S A;  2FOV A;  5LMD A;  5C8I A;  5SZ5 A;  2Q38 A;  5EH8 A;  1CIN A;  4Q9Y A;  1BN4 A;  1MOO A;  4ETQ C;  4LHI A;  1FR7 A;  4C3T A;  3DCS A;  4Y0J A;  3F8E A;  5FNH A;  3RGE A;  5FNJ A;  1RJ6 A;  2ABE A;  4XIX A;  1JV0 A;  4N16 A;  1ZGE A;  5FL6 A;  4Q87 A;  3S9T A;  1CVA A;  1TTM A;  4ZWZ A;  1CNJ A;  2NXS A;  3S74 B;  2POV A;  1CVD A;  3M1J A;  4PQ7 A;  4CNR A;  1I91 A;  4XFW A;  1HEA A;  3HKN A;  3DD0 A;  4FIK A;  2H4N A;  1LZV A;  3M04 A;  4ITO A;  4PZH A;  3SAX A;  3HKT A;  1I9M A;  1YDC A;  3V5G A;  1TBT X;  3W6H A;  1FSQ A;  4QK3 A;  1CNB A;  1LG6 A;  5DVX A;  4BCW A;  3M1Q A;  2FOS A;  1CCT A;  4KNM A;  3GZ0 A;  1KWQ A;  3MYQ A;  1H9N A;  3MHM A;  1DMY A;  1YO0 A;  5FNI A;  1IF9 A;  3ML5 A;  1G48 A;  5AML A;  4Z1E A;  4FU5 A;  1RZA A;  3P4V A;  1ZFK A;  4RUZ A;  3OIK A;  3DCW A;  1CVB A;  3U47 A;  1DCB A;  2CA2 A;  4WW6 A;  1KOP A;  4ZWI A;  1HEC A;  1ZFQ A;  1AM6 A;  2HD6 A;  5DSP A;  4UOV A;  3N4B A;  3PYK A;  4Q7P A;  4QSA A;  1CNI A;  1RZD A;  3SBH A;  1IF7 A;  1J9W A;  1TEQ X;  1ZSB A;  3BL0 A;  1HED A;  3JXH C;  3KIG A;  3P58 A;  4L5V A;  5SZ7 A;  4CAC A;  2WD3 A;  7CA2 A;  2POW A;  5E2M A;  4E9O X;  4YGK A;  4HBA A;  4R5A A;  5E5U A;  3T84 A;  2IT4 A;  3M2N A;  5EOI A;  3IGP A;  1OKM A;  3SBI A;  3MZC A;  1I9L A;  5G0C A;  2QO8 A;  1CAL A;  3V3F A;  2FOY A;  4RFC A;  2NMX A;  4QIY A;  3KOK A;  3FE4 A;  1G0E A;  4MDL A;  3UYQ A;  3C7P A;  3HKU A;  3U3A X;  4K1Q A;  1FLJ A;  1YDA A;  3N3J A;  12CA A;  4YXO A;  5JQT A;  1RAY A;  3TVN X;  3CZV A;  4Z1N A;  1CNK A;  1KWR A;  3KS3 A;  1LGD A;  4HT2 A;  5AMG A;  1RZC A;  1G52 A;  4FL7 A;  1BN1 A;  4PYX A;  5G03 A;  3RYJ B;  4YWP A;  3M98 A;  4ZX0 A;  5EH7 A;  4QJX A;  3M2Z A;  2HNC A;  1RJ5 A;  2VVB X;  2EZ7 A;  3HLJ A;  3M2Y A;  5E5R A;  3M1W A;  1CVF A;  4CA2 A;  4XE1 A;  4FVO A;  4RN4 A;  4Q49 A;  4KP8 A;  5FNM A;  1BNV A;  1LG5 A;  5DSN A;  5JG5 B;  5E2K A;  3SAP A;  4E5Q A;  3HFP A;  4KNJ A;  1CNY A;  2ILI A;  4Q8Z A;  5BRU A;  5JG3 B;  3DV7 A;  1DCA A;  4K0S A;  1CA2 A;  1KOQ A;  5G0B A;  3P55 A;  1A42 A;  2NN7 A;  4QK1 A;  3P44 A;  3QYK A;  1HEB A;  4HU1 A;  5E2S A;  2W2J A;  3OY0 A;  4RH2 A;  3V2M A;  1CZM A;  4Q0L A;  4QJ0 A;  1TB0 X;  3JXF A;  1H4N A;  1AZM A;  1BNT A;  1H9Q A;  4QJM A;  1XEG A;  4HEZ A;  4G7A A;  5EH5 A;  1LUG A;  4QSB A;  5FLT A;  3S75 B;  1BNU A;  4TWM A;  2CBC A;  3V7X A;  3P5L A;  5E2N A;  3FW3 A;  3L14 A;  5DSR A;  3V3I B;  3RLD A;  1TEU X;  2WEH A;  3P5A A;  3M5E A;  1TG9 A;  5FL5 A;  3IBI A;  1G45 A;  3IAI A;  4E49 A;  4YGF A;  5JES B;  4COQ A;  4RFD A;  1URT A;  3D9Z A;  3K34 A;  1BNQ A;  1CIL A;  4FPT A;  4JSW A;  2WEG A;  3K7K A;  1HCB A;  1I8Z A;  2OSF A;  5BYI A;  3P3H A;  4RIU A;  4RUY A;  3DA2 A;  2HOC A;  3OKU A;  1IF8 A;  2FMG A;  4XZ5 A;  4M2U A;  4IDR X;  4QIZ A;  1I9Q A;  5FLR A;  4Q08 A;  2Q1B A;  5IPZ A;  5FLQ A;  3M3X A;  1CNH A;  3RJ7 A;  2F14 A;  5FLO A;  3KKX A;  2NNG A;  5SZ3 A;  4E3F A;  1G6V A;  1G1D A;  1CAI A;  3D8W A;  3V3G B;  1OKL A;  1CIM A;  1Y7W A;  4N0X B;  1CNX A;  1BCD A;  1BIC A;  2FNM A;  4HEW A;  1BV3 A;  3M96 A;  5DSQ A;  5L6K A;  3V3J A;  3NB5 A;  3RZ1 B;  5DSK A;  4RIV A;  1UGE A;  4ILX A;  4Q07 A;  4LP6 A;  3F4X A;  1CAO A;  3S72 B;  3MNU A;  4JSS A;  5BRV A;  2FOU A;  3T5U A;  5FDC A;  1CAH A;  3S78 B;  5CLU A;  1DMX A;  1YDB A;  1Z93 A;  3KON A;  4KV0 A;  3S97 A;  5HPJ A;  1HVA A;  1FSR A;  4Q6D A;  5EHV A;  2HKK A;  2VVA X;  3PJJ A;  3ML2 A;  3RG4 A;  8CA2 A;  1V9I C;  4FRC A;  3MHO A;  5CJF A;  4MLX A;  4KUV A;  2EU2 A;  5DSJ A;  3P3J A;  3DVB A;  4JS6 A;  1FQR A;  3DCC A;  3RYV B;  2FW4 A;  1OQ5 A;  3KLD B;  4KUY A;  5CAC A;  3R17 B;  2WEO A;  4JSA A;  1V9E A;  5EKJ A;  4MLT A;  1Z9Y A;  5JEH B;  3M2X A;  4E4A A;  5E28 A;  1RZB A;  3LXE A;  3JXG A;  1AVN A;  3FFP X;  2CAB A;  5FNK A;  4L5U A;  3U45 X;  5JGT B;  4MTY A;  3MHC A;  3M1K A;  2CBB A;  3S73 B;  1CAK A;  3BET A;  4BF6 A;  1CAJ A;  4Q83 A;  5DSI A;  3F7U A;  3PO6 A;  3R16 A;  4Q90 A;  5DOG A;  4Z1J A;  2X7S A;  1CVC A;  1FQN A;  1ZGF A;  4QJO A;  4QSJ A;  2NXT A;  1IF4 A;  4IWZ A;  5A6H A;  4DZ9 A;  3RG3 A;  4M2W A;  4YGJ A;  1MUA A;  5FNL A;  1G0F A;  3MWO A;  1HCA A;  4Q7V A;  1G54 A;  5DRS A;  4BF1 A;  1CNW A;  5EIJ A;  4YVY A;  2POU A;  4QK2 A;  3DVD A;  4QTL A;  1CA3 A;  1CAZ A;  3RZ5 A;  3M67 A;  3DVC A;  1TE3 X;  4K0Z A;  4CNX A;  4MDG A;  3HKQ A;  2FNN A;  4Z0Q A;  1YDD A;  4ZX1 A;  5BRW A;  5EKH A;  3S71 B;  4GL1 X;  3BL1 A;  4E3D A;  2CBA A;  3EFT A;  3ZP9 A;  4Q78 A;  5A25 A;  3D92 A;  4WW8 A;  2WD2 A;  1JD0 A;  4PXX A;  6CA2 A;  1CCU A;  3MHI A;  3OIM A;  3ZNC A;  1FR4 A;  2X7T A;  1FSN A; 
#chains in the Genus database with same CATH homology
 2CBE A;  4K13 A;  3S8X A;  3CAJ A;  4TWL A;  5FNG A;  1I90 A;  2FNK A;  3U7C A;  3S76 A;  3HS4 A;  3RYY A;  3TMJ A;  2QOA A;  1CNC A;  5FL4 A;  1I9O A;  2GEH A;  3D0N A;  1FQM A;  3MNI A;  2GD8 A;  4CQ0 A;  9CA2 A;  2NNS A;  5JGS B;  5J8Z A;  3OYS A;  1TG3 A;  5DSM A;  3KOI A;  4KNI A;  3DD8 A;  1G53 A;  4MDM A;  2NWP A;  4HF3 A;  3RZ7 A;  4FVN A;  2EU3 A;  1HUG A;  3V2J A;  1CVH A;  4R59 A;  3KWA A;  3MNA A;  5CA2 A;  4PYY A;  1IF6 A;  1F2W A;  1KEQ A;  5G01 A;  1BZM A;  4G0C A;  4YHA A;  5SZ2 A;  2NWY A;  4ZWX A;  4Q6E A;  4WL4 A;  1IF5 A;  3N0N A;  4KAP A;  4X5S A;  2NNV A;  3K2F A;  2H15 A;  3DC3 A;  4K0T A;  5FLS A;  5EKM A;  2NXR A;  4JSZ A;  1TH9 A;  3TVO X;  3M5T A;  3Q31 A;  2NNO A;  4ZWY A;  3B4F A;  1THK A;  5EHW A;  1CAM A;  3RYX B;  3NJ9 A;  3OIL A;  4M2R A;  3IBN A;  5JQ0 A;  1I9P A;  4YYT A;  1CCS A;  4XIW A;  1ZSA A;  5SZ1 A;  1UGC A;  1T9N A;  1UGF A;  4MO8 A;  4YGN A;  1YO2 A;  1RAZ A;  1G3Z A;  4KUW A;  4HT0 A;  3OYQ A;  3F7B A;  3KNE A;  3N2P A;  3RYZ A;  3EFI A;  2NWZ A;  4Z1K A;  1YO1 A;  1FQL A;  4WUP A;  3M40 A;  1UGD A;  4Q7S A;  1XPZ A;  2Q1Q A;  2AX2 A;  3T5Z A;  5BNL A;  4Q8X A;  5EHE A;  2ZNC A;  4E3G A;  4E3H A;  4YX4 A;  1UGA A;  2WEJ A;  2FMZ A;  3IEO A;  5AMD A;  3T83 A;  4Q81 A;  1BNM A;  1BNW A;  1BNN A;  4QJW A;  5JEG B;  1CAY A;  1I9N A;  2HFW A;  2QP6 A;  4ITP A;  3MNJ A;  4L5W A;  4QEF A;  3VBD A;  5SZ4 A;  4QJP A;  5EZT X;  4Q8Y A;  1Z97 A;  1EOU A;  1XEV A;  1XQ0 A;  3DAZ A;  1JCZ A;  4QSI A;  1ZH9 A;  4KP5 A;  1G4J A;  3B1B A;  5FDI A;  3CYU A;  1BN3 A;  3W6I A;  2CBD A;  1CRA A;  1OKN A;  4DZ7 A;  1ZE8 A;  4Q06 A;  1G4O A;  2O4Z A;  1UGB A;  3DBU A;  1CRM A;  3S77 B;  4R5B A;  4YXU A;  4Q09 A;  1ZSC A;  5L3O A;  3RZ8 A;  3D93 A;  3UYN A;  3MNH A;  5DSO A;  3V3H B;  4WUQ A;  5FLP A;  5SZ0 A;  1HUH A;  2AW1 A;  4RUX A;  4Q7W A;  4HEY A;  4KNN A;  4CNV A;  5SZ6 A;  5E2R A;  3NI5 A;  3OKV A;  1RZE A;  1CVE A;  3M14 A;  4M2V A;  3MHL A;  5DSL A;  4YXI A;  4Q99 A;  2OSM A;  4CNW A;  3CA2 A;  4LU3 A;  5DOH A;  4QY3 A;  2X7U A;  3MDZ A;  1UGG A;  5JEP B;  2HL4 A;  1CAN A;  3RZ0 B;  3IBU A;  3MNK A;  1CNG A;  3T85 A;  1ZNC A;  2FOQ A;  2NWO A;  3T82 A;  4WR7 A;  5JDV B;  4ZAO A;  3IBL A;  4YGL A;  3DC9 A;  2NN1 A;  1G46 A;  3MMF A;  3M5S A;  2FOV A;  5LMD A;  5C8I A;  5SZ5 A;  2Q38 A;  5EH8 A;  1CIN A;  4Q9Y A;  1BN4 A;  1MOO A;  4ETQ C;  4LHI A;  1FR7 A;  4C3T A;  3DCS A;  4Y0J A;  3F8E A;  5FNH A;  3RGE A;  5FNJ A;  1RJ6 A;  2ABE A;  4XIX A;  1JV0 A;  4N16 A;  1ZGE A;  5FL6 A;  4Q87 A;  3S9T A;  1CVA A;  1TTM A;  4ZWZ A;  1CNJ A;  2NXS A;  3S74 B;  2POV A;  1CVD A;  3M1J A;  4PQ7 A;  4CNR A;  1I91 A;  4XFW A;  1HEA A;  3HKN A;  3DD0 A;  4FIK A;  2H4N A;  1LZV A;  3M04 A;  4ITO A;  4PZH A;  3SAX A;  3HKT A;  1I9M A;  1YDC A;  3V5G A;  1TBT X;  3W6H A;  1FSQ A;  4QK3 A;  1CNB A;  1LG6 A;  5DVX A;  4BCW A;  3M1Q A;  2FOS A;  1CCT A;  4KNM A;  3GZ0 A;  1KWQ A;  3MYQ A;  1H9N A;  3MHM A;  1DMY A;  1YO0 A;  5FNI A;  1IF9 A;  3ML5 A;  1G48 A;  5AML A;  4Z1E A;  4FU5 A;  1RZA A;  3P4V A;  1ZFK A;  4RUZ A;  3OIK A;  3DCW A;  1CVB A;  3U47 A;  1DCB A;  2CA2 A;  4WW6 A;  1KOP A;  4ZWI A;  1HEC A;  1ZFQ A;  1AM6 A;  2HD6 A;  5DSP A;  4UOV A;  3N4B A;  3PYK A;  4Q7P A;  4QSA A;  1CNI A;  1RZD A;  3SBH A;  1IF7 A;  1J9W A;  1TEQ X;  1ZSB A;  3BL0 A;  1HED A;  3JXH C;  3KIG A;  3P58 A;  4L5V A;  5SZ7 A;  4CAC A;  2WD3 A;  7CA2 A;  2POW A;  5E2M A;  4E9O X;  4YGK A;  4HBA A;  4R5A A;  5E5U A;  3T84 A;  2IT4 A;  3M2N A;  5EOI A;  3IGP A;  1OKM A;  3SBI A;  3MZC A;  1I9L A;  5G0C A;  2QO8 A;  1CAL A;  3V3F A;  2FOY A;  4RFC A;  2NMX A;  4QIY A;  3KOK A;  3FE4 A;  1G0E A;  4MDL A;  3UYQ A;  3C7P A;  3HKU A;  3U3A X;  4K1Q A;  1FLJ A;  1YDA A;  3N3J A;  12CA A;  4YXO A;  5JQT A;  1RAY A;  3TVN X;  3CZV A;  4Z1N A;  1CNK A;  1KWR A;  3KS3 A;  1LGD A;  4HT2 A;  5AMG A;  1RZC A;  1G52 A;  4FL7 A;  1BN1 A;  4PYX A;  5G03 A;  3RYJ B;  4YWP A;  3M98 A;  4ZX0 A;  5EH7 A;  4QJX A;  3M2Z A;  2HNC A;  1RJ5 A;  2VVB X;  2EZ7 A;  3HLJ A;  3M2Y A;  5E5R A;  3M1W A;  1CVF A;  4CA2 A;  4XE1 A;  4FVO A;  4RN4 A;  4Q49 A;  4KP8 A;  5FNM A;  1BNV A;  1LG5 A;  5DSN A;  5JG5 B;  5E2K A;  3SAP A;  4E5Q A;  3HFP A;  4KNJ A;  1CNY A;  2ILI A;  4Q8Z A;  5BRU A;  5JG3 B;  3DV7 A;  1DCA A;  4K0S A;  1CA2 A;  1KOQ A;  5G0B A;  3P55 A;  1A42 A;  2NN7 A;  4QK1 A;  3P44 A;  3QYK A;  1HEB A;  4HU1 A;  5E2S A;  2W2J A;  3OY0 A;  4RH2 A;  3V2M A;  1CZM A;  4Q0L A;  4QJ0 A;  1TB0 X;  3JXF A;  1H4N A;  1AZM A;  1BNT A;  1H9Q A;  4QJM A;  1XEG A;  4HEZ A;  4G7A A;  5EH5 A;  1LUG A;  4QSB A;  5FLT A;  3S75 B;  1BNU A;  4TWM A;  2CBC A;  3V7X A;  3P5L A;  5E2N A;  3FW3 A;  3L14 A;  5DSR A;  3V3I B;  3RLD A;  1TEU X;  2WEH A;  3P5A A;  3M5E A;  1TG9 A;  5FL5 A;  3IBI A;  1G45 A;  3IAI A;  4E49 A;  4YGF A;  5JES B;  4COQ A;  4RFD A;  1URT A;  3D9Z A;  3K34 A;  1BNQ A;  1CIL A;  4FPT A;  4JSW A;  2WEG A;  3K7K A;  1HCB A;  1I8Z A;  2OSF A;  5BYI A;  3P3H A;  4RIU A;  4RUY A;  3DA2 A;  2HOC A;  3OKU A;  1IF8 A;  2FMG A;  4XZ5 A;  4M2U A;  4IDR X;  4QIZ A;  1I9Q A;  5FLR A;  4Q08 A;  2Q1B A;  5IPZ A;  5FLQ A;  3M3X A;  1CNH A;  3RJ7 A;  2F14 A;  5FLO A;  3KKX A;  2NNG A;  5SZ3 A;  4E3F A;  1G6V A;  1G1D A;  1CAI A;  3D8W A;  3V3G B;  1OKL A;  1CIM A;  1Y7W A;  4N0X B;  1CNX A;  1BCD A;  1BIC A;  2FNM A;  4HEW A;  1BV3 A;  3M96 A;  5DSQ A;  5L6K A;  3V3J A;  3NB5 A;  3RZ1 B;  5DSK A;  4RIV A;  1UGE A;  4ILX A;  4Q07 A;  4LP6 A;  3F4X A;  1CAO A;  3S72 B;  3MNU A;  4JSS A;  5BRV A;  2FOU A;  3T5U A;  5FDC A;  1CAH A;  3S78 B;  5CLU A;  1DMX A;  1YDB A;  1Z93 A;  3KON A;  4KV0 A;  3S97 A;  5HPJ A;  1HVA A;  1FSR A;  4Q6D A;  5EHV A;  2HKK A;  2VVA X;  3PJJ A;  3ML2 A;  3RG4 A;  8CA2 A;  1V9I C;  4FRC A;  3MHO A;  5CJF A;  4MLX A;  4KUV A;  2EU2 A;  5DSJ A;  3P3J A;  3DVB A;  4JS6 A;  1FQR A;  3DCC A;  3RYV B;  2FW4 A;  1OQ5 A;  3KLD B;  4KUY A;  5CAC A;  3R17 B;  2WEO A;  4JSA A;  1V9E A;  5EKJ A;  4MLT A;  1Z9Y A;  5JEH B;  3M2X A;  4E4A A;  5E28 A;  1RZB A;  3LXE A;  3JXG A;  1AVN A;  3FFP X;  2CAB A;  5FNK A;  4L5U A;  3U45 X;  5JGT B;  4MTY A;  3MHC A;  3M1K A;  2CBB A;  3S73 B;  1CAK A;  3BET A;  4BF6 A;  1CAJ A;  4Q83 A;  5DSI A;  3F7U A;  3PO6 A;  3R16 A;  4Q90 A;  5DOG A;  4Z1J A;  2X7S A;  1CVC A;  1FQN A;  1ZGF A;  4QJO A;  4QSJ A;  2NXT A;  1IF4 A;  4IWZ A;  5A6H A;  4DZ9 A;  3RG3 A;  4M2W A;  4YGJ A;  1MUA A;  5FNL A;  1G0F A;  3MWO A;  1HCA A;  4Q7V A;  1G54 A;  5DRS A;  4BF1 A;  1CNW A;  5EIJ A;  4YVY A;  2POU A;  4QK2 A;  3DVD A;  4QTL A;  1CA3 A;  1CAZ A;  3RZ5 A;  3M67 A;  3DVC A;  1TE3 X;  4K0Z A;  4CNX A;  4MDG A;  3HKQ A;  2FNN A;  4Z0Q A;  1YDD A;  4ZX1 A;  5BRW A;  5EKH A;  3S71 B;  4GL1 X;  3BL1 A;  4E3D A;  2CBA A;  3EFT A;  3ZP9 A;  4Q78 A;  5A25 A;  3D92 A;  4WW8 A;  2WD2 A;  1JD0 A;  4PXX A;  6CA2 A;  1CCU A;  3MHI A;  3OIM A;  3ZNC A;  1FR4 A;  2X7T A;  1FSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...