2OK4D

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct oxidized with ferricyanide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
molecule tags Oxidoreductase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ok4D00
3RMZC 2HXCD 4FA1C 4FB1C 2GC7B 3C75L 3SVWC 2Q7QD 4FAVC 3L4MC 3SWSC 2OK4D 4L3HC 2MTAL 1MAFL 2AGLD 2I0RD 2IUVD 1MG3B 2BBKL 3PXTC 4FA9C 2IURD 2IUQD 3L4OC 2HJ4D 2J57K 2I0SD 2OIZD 2HKMD 2J56L 2GC4B 2HJBD 2H47B 3SLEC 3PXSC 3ORVC 3RLMC 3SXTC 4FA5C 2IUPD 3RN1C 4FA4C 1MDAL 1MAEL 2HKRD 2AH0D 2IAAB 4Y5RC 3RN0C 2OK6D 1MG2B 2AGWD 4O1QC 2I0TD 2OJYD 2H3XB 2MADL 2AGXD 4L1QC 2AGZD 2AH1D 4L3GC 2J55L 3SJLC 2AGYD 4K3IC 4FANC 3PXWC
chains in the Genus database with same CATH superfamily
3RMZC 2HXCD 4FA1C 4FB1C 2GC7B 3C75L 3SVWC 2Q7QD 4FAVC 3L4MC 3SWSC 2OK4D 4L3HC 2MTAL 1MAFL 2AGLD 2I0RD 2IUVD 1MG3B 2BBKL 3PXTC 4FA9C 2IURD 2IUQD 3L4OC 2HJ4D 2J57K 2I0SD 2OIZD 2HKMD 2J56L 2GC4B 2HJBD 2H47B 3SLEC 3PXSC 3ORVC 3RLMC 3SXTC 4FA5C 2IUPD 3RN1C 4FA4C 1MDAL 1MAEL 2HKRD 2AH0D 2IAAB 4Y5RC 3RN0C 2OK6D 1MG2B 2AGWD 4O1QC 2I0TD 2OJYD 2H3XB 2MADL 2AGXD 4L1QC 2AGZD 2AH1D 4L3GC 2J55L 3SJLC 2AGYD 4K3IC 4FANC 3PXWC
chains in the Genus database with same CATH topology
3RMZC 2HXCD 4FA1C 4FB1C 2GC7B 3C75L 3SVWC 2Q7QD 4FAVC 3L4MC 3SWSC 2OK4D 4L3HC 2MTAL 1MAFL 2AGLD 2I0RD 2IUVD 1MG3B 2BBKL 3PXTC 4FA9C 2IURD 2IUQD 3L4OC 2HJ4D 2J57K 2I0SD 2OIZD 2HKMD 2J56L 2GC4B 2HJBD 2H47B 3SLEC 3PXSC 3ORVC 3RLMC 3SXTC 4FA5C 2IUPD 3RN1C 4FA4C 1MDAL 1MAEL 2HKRD 2AH0D 2IAAB 4Y5RC 3RN0C 2OK6D 1MG2B 2AGWD 4O1QC 2I0TD 2OJYD 2H3XB 2MADL 2AGXD 4L1QC 2AGZD 2AH1D 4L3GC 2J55L 3SJLC 2AGYD 4K3IC 4FANC 3PXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMZ C;  2HXC D;  4FA1 C;  4FB1 C;  2GC7 B;  3C75 L;  3SVW C;  2Q7Q D;  4FAV C;  3L4M C;  3SWS C;  2OK4 D;  4L3H C;  2MTA L;  1MAF L;  2AGL D;  2I0R D;  2IUV D;  1MG3 B;  2BBK L;  3PXT C;  4FA9 C;  2IUR D;  2IUQ D;  3L4O C;  2HJ4 D;  2J57 K;  2I0S D;  2OIZ D;  2HKM D;  2J56 L;  2GC4 B;  2HJB D;  2H47 B;  3SLE C;  3PXS C;  3ORV C;  3RLM C;  3SXT C;  4FA5 C;  2IUP D;  3RN1 C;  4FA4 C;  1MDA L;  1MAE L;  2HKR D;  2AH0 D;  2IAA B;  4Y5R C;  3RN0 C;  2OK6 D;  1MG2 B;  2AGW D;  4O1Q C;  2I0T D;  2OJY D;  2H3X B;  2MAD L;  2AGX D;  4L1Q C;  2AGZ D;  2AH1 D;  4L3G C;  2J55 L;  3SJL C;  2AGY D;  4K3I C;  4FAN C;  3PXW C; 
#chains in the Genus database with same CATH topology
 3RMZ C;  2HXC D;  4FA1 C;  4FB1 C;  2GC7 B;  3C75 L;  3SVW C;  2Q7Q D;  4FAV C;  3L4M C;  3SWS C;  2OK4 D;  4L3H C;  2MTA L;  1MAF L;  2AGL D;  2I0R D;  2IUV D;  1MG3 B;  2BBK L;  3PXT C;  4FA9 C;  2IUR D;  2IUQ D;  3L4O C;  2HJ4 D;  2J57 K;  2I0S D;  2OIZ D;  2HKM D;  2J56 L;  2GC4 B;  2HJB D;  2H47 B;  3SLE C;  3PXS C;  3ORV C;  3RLM C;  3SXT C;  4FA5 C;  2IUP D;  3RN1 C;  4FA4 C;  1MDA L;  1MAE L;  2HKR D;  2AH0 D;  2IAA B;  4Y5R C;  3RN0 C;  2OK6 D;  1MG2 B;  2AGW D;  4O1Q C;  2I0T D;  2OJY D;  2H3X B;  2MAD L;  2AGX D;  4L1Q C;  2AGZ D;  2AH1 D;  4L3G C;  2J55 L;  3SJL C;  2AGY D;  4K3I C;  4FAN C;  3PXW C; 
#chains in the Genus database with same CATH homology
 3RMZ C;  2HXC D;  4FA1 C;  4FB1 C;  2GC7 B;  3C75 L;  3SVW C;  2Q7Q D;  4FAV C;  3L4M C;  3SWS C;  2OK4 D;  4L3H C;  2MTA L;  1MAF L;  2AGL D;  2I0R D;  2IUV D;  1MG3 B;  2BBK L;  3PXT C;  4FA9 C;  2IUR D;  2IUQ D;  3L4O C;  2HJ4 D;  2J57 K;  2I0S D;  2OIZ D;  2HKM D;  2J56 L;  2GC4 B;  2HJB D;  2H47 B;  3SLE C;  3PXS C;  3ORV C;  3RLM C;  3SXT C;  4FA5 C;  2IUP D;  3RN1 C;  4FA4 C;  1MDA L;  1MAE L;  2HKR D;  2AH0 D;  2IAA B;  4Y5R C;  3RN0 C;  2OK6 D;  1MG2 B;  2AGW D;  4O1Q C;  2I0T D;  2OJY D;  2H3X B;  2MAD L;  2AGX D;  4L1Q C;  2AGZ D;  2AH1 D;  4L3G C;  2J55 L;  3SJL C;  2AGY D;  4K3I C;  4FAN C;  3PXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...