2OTJO

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2otjO00
1Q86P 3G71O 1Q86M 3CCML 1M90P 1M90M 1VQNO 1VQLL 2OTLO 1YIJO 1VQ9O 1M1KP 3CC4O 3CCUL 3CCQL 3CD6L 3CCJL 2QA4O 3CMAL 1W2BN 3CCEO 1VQ8L 1VQKL 1VQ6O 3G4SO 1KD1P 1KD1M 1YJ9L 3G6EO 2OTJL 3CCMO 1VQLO 3CPWK 3CCRL 1QVGK 1VQ4L 1YJNL 3CXCN 1Q82P 1Q82M 3CCLL 1M1KM 1QVFK 3I55L 3CCVL 1YHQO 1VQ7L 3CCUO 1YI2O 1YHQL 1K8AP 3CCQO 3CD6O 3CCJO 3CMAO 1YI2L 1VQ8O 1VQ5L 1VQKO 1YITL 3OW2K 1NJIP 1NJIM 1JJ2K 1YJ9O 3CC2L 2OTJO 1VQOL 3CCRO 1VQ4O 1YJNO 2QEXL 1KQSN 3CCLO 3I55O 3CCVO 1YJWL 1VQ7O 1K9MP 1K73P 1K73M 1W2BK 1Q81P 1Q81M 3I56L 1K8AM 1YITO 1VQ5O 1VQPO 3CCSL 1S72L 1Q7YP 1VQPL 3CC2O 3CMEO 1VQOO 3CC7L 3CMEL 3CXCK 2QEXO 3G71L 1VQNL 2OTLL 3CPWN 1QVGN 1YIJL 1KC8P 1KC8M 1VQ9L 1YJWO 1N8RP 1N8RM 1QVFN 1K9MM 3CC4L 3I56O 3CCSO 2QA4L 3CCEL 1S72O 1VQMO 1VQ6L 3OW2N 3G4SL 1Q7YM 3CC7O 1VQML 1JJ2N 3G6EL 1KQSK
chains in the Genus database with same CATH superfamily
1Q86P 3G71O 1Q86M 3CCML 1M90P 1M90M 1VQNO 1VQLL 2OTLO 5DS4A 1YIJO 1VQ9O 1M1KP 3CC4O 3CCUL 3CCQL 3CD6L 3CCJL 2QA4O 3CMAL 1W2BN 3CCEO 1VQ8L 1VQKL 1VQ6O 3G4SO 1KD1P 1KD1M 1YJ9L 5DS6A 3G6EO 2OTJL 5FCLA 3CCMO 1VQLO 3CPWK 3CCRL 1QVGK 1VQ4L 1YJNL 4WJ0A 3CXCN 1Q82P 1Q82M 3CCLL 1M1KM 1QVFK 3I55L 3NKDA 3CCVL 4P6IC 1YHQO 1VQ7L 3CCUO 1YI2O 1YHQL 1K8AP 3CCQO 3CD6O 3CCJO 3CMAO 1YI2L 1VQ8O 1VQ5L 1VQKO 5DS5A 4N06A 3OW2K 1YITL 1NJIP 5DLJA 1NJIM 1JJ2K 1YJ9O 3CC2L 2OTJO 1VQOL 4QDLA 3GODA 3CCRO 1VQ4O 1YJNO 2QEXL 1KQSN 3CCLO 3I55O 3CCVO 1YJWL 1VQ7O 1K9MP 1K73P 1K73M 1W2BK 1Q81P 1Q81M 3I56L 1K8AM 1YITO 1VQ5O 1VQPO 3CCSL 1S72L 1Q7YP 1VQPL 3CC2O 3CMEO 1VQOO 3CC7L 3CMEL 2YZSA 5DQTA 3CXCK 2QEXO 3G71L 1VQNL 4W8KA 2OTLL 3CPWN 1QVGN 1YIJL 1KC8P 1KC8M 1VQ9L 4XTKA 1YJWO 1N8RP 1N8RM 1QVFN 5DQZA 1K9MM 3CC4L 3I56O 3CCSO 2QA4L 3CCEL 1S72O 1VQMO 1VQ6L 3OW2N 3G4SL 1Q7YM 3CC7O 1VQML 1JJ2N 3G6EL 1KQSK
chains in the Genus database with same CATH topology
1Q86P 3G71O 1Q86M 3CCML 1M90P 1M90M 1VQNO 1VQLL 2OTLO 5DS4A 1YIJO 1VQ9O 1M1KP 3CC4O 3CCUL 3CCQL 3CD6L 3CCJL 2QA4O 3CMAL 1W2BN 3CCEO 1VQ8L 1VQKL 1VQ6O 3G4SO 1KD1P 1KD1M 1YJ9L 5DS6A 3G6EO 2OTJL 5FCLA 3CCMO 1VQLO 3CPWK 3CCRL 1QVGK 1VQ4L 1YJNL 4WJ0A 3CXCN 1Q82P 1Q82M 3CCLL 1M1KM 1QVFK 3I55L 3NKDA 3CCVL 4P6IC 1YHQO 1VQ7L 3CCUO 1YI2O 1YHQL 1K8AP 3CCQO 3CD6O 3CCJO 3CMAO 1YI2L 1VQ8O 1VQ5L 1VQKO 5DS5A 4N06A 3OW2K 1YITL 1NJIP 5DLJA 1NJIM 1JJ2K 1YJ9O 3CC2L 2OTJO 1VQOL 4QDLA 3GODA 3CCRO 1VQ4O 1YJNO 2QEXL 1KQSN 3CCLO 3I55O 3CCVO 1YJWL 1VQ7O 1K9MP 1K73P 1K73M 1W2BK 1Q81P 1Q81M 3I56L 1K8AM 1YITO 1VQ5O 1VQPO 3CCSL 1S72L 1Q7YP 1VQPL 3CC2O 3CMEO 1VQOO 3CC7L 3CMEL 2YZSA 5DQTA 3CXCK 2QEXO 3G71L 1VQNL 4W8KA 2OTLL 3CPWN 1QVGN 1YIJL 1KC8P 1KC8M 1VQ9L 4XTKA 1YJWO 1N8RP 1N8RM 1QVFN 5DQZA 1K9MM 3CC4L 3I56O 3CCSO 2QA4L 3CCEL 1S72O 1VQMO 1VQ6L 3OW2N 3G4SL 1Q7YM 3CC7O 1VQML 1JJ2N 3G6EL 1KQSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 P;  3G71 O;  1Q86 M;  3CCM L;  1M90 P;  1M90 M;  1VQN O;  1VQL L;  2OTL O;  1YIJ O;  1VQ9 O;  1M1K P;  3CC4 O;  3CCU L;  3CCQ L;  3CD6 L;  3CCJ L;  2QA4 O;  3CMA L;  1W2B N;  3CCE O;  1VQ8 L;  1VQK L;  1VQ6 O;  3G4S O;  1KD1 P;  1KD1 M;  1YJ9 L;  3G6E O;  2OTJ L;  3CCM O;  1VQL O;  3CPW K;  3CCR L;  1QVG K;  1VQ4 L;  1YJN L;  3CXC N;  1Q82 P;  1Q82 M;  3CCL L;  1M1K M;  1QVF K;  3I55 L;  3CCV L;  1YHQ O;  1VQ7 L;  3CCU O;  1YI2 O;  1YHQ L;  1K8A P;  3CCQ O;  3CD6 O;  3CCJ O;  3CMA O;  1YI2 L;  1VQ8 O;  1VQ5 L;  1VQK O;  1YIT L;  3OW2 K;  1NJI P;  1NJI M;  1JJ2 K;  1YJ9 O;  3CC2 L;  2OTJ O;  1VQO L;  3CCR O;  1VQ4 O;  1YJN O;  2QEX L;  1KQS N;  3CCL O;  3I55 O;  3CCV O;  1YJW L;  1VQ7 O;  1K9M P;  1K73 P;  1K73 M;  1W2B K;  1Q81 P;  1Q81 M;  3I56 L;  1K8A M;  1YIT O;  1VQ5 O;  1VQP O;  3CCS L;  1S72 L;  1Q7Y P;  1VQP L;  3CC2 O;  3CME O;  1VQO O;  3CC7 L;  3CME L;  3CXC K;  2QEX O;  3G71 L;  1VQN L;  2OTL L;  3CPW N;  1QVG N;  1YIJ L;  1KC8 P;  1KC8 M;  1VQ9 L;  1YJW O;  1N8R P;  1N8R M;  1QVF N;  1K9M M;  3CC4 L;  3I56 O;  3CCS O;  2QA4 L;  3CCE L;  1S72 O;  1VQM O;  1VQ6 L;  3OW2 N;  3G4S L;  1Q7Y M;  3CC7 O;  1VQM L;  1JJ2 N;  3G6E L;  1KQS K; 
#chains in the Genus database with same CATH topology
 1Q86 P;  3G71 O;  1Q86 M;  3CCM L;  1M90 P;  1M90 M;  1VQN O;  1VQL L;  2OTL O;  5DS4 A;  1YIJ O;  1VQ9 O;  1M1K P;  3CC4 O;  3CCU L;  3CCQ L;  3CD6 L;  3CCJ L;  2QA4 O;  3CMA L;  1W2B N;  3CCE O;  1VQ8 L;  1VQK L;  1VQ6 O;  3G4S O;  1KD1 P;  1KD1 M;  1YJ9 L;  5DS6 A;  3G6E O;  2OTJ L;  5FCL A;  3CCM O;  1VQL O;  3CPW K;  3CCR L;  1QVG K;  1VQ4 L;  1YJN L;  4WJ0 A;  3CXC N;  1Q82 P;  1Q82 M;  3CCL L;  1M1K M;  1QVF K;  3I55 L;  3NKD A;  3CCV L;  4P6I C;  1YHQ O;  1VQ7 L;  3CCU O;  1YI2 O;  1YHQ L;  1K8A P;  3CCQ O;  3CD6 O;  3CCJ O;  3CMA O;  1YI2 L;  1VQ8 O;  1VQ5 L;  1VQK O;  5DS5 A;  4N06 A;  3OW2 K;  1YIT L;  1NJI P;  5DLJ A;  1NJI M;  1JJ2 K;  1YJ9 O;  3CC2 L;  2OTJ O;  1VQO L;  4QDL A;  3GOD A;  3CCR O;  1VQ4 O;  1YJN O;  2QEX L;  1KQS N;  3CCL O;  3I55 O;  3CCV O;  1YJW L;  1VQ7 O;  1K9M P;  1K73 P;  1K73 M;  1W2B K;  1Q81 P;  1Q81 M;  3I56 L;  1K8A M;  1YIT O;  1VQ5 O;  1VQP O;  3CCS L;  1S72 L;  1Q7Y P;  1VQP L;  3CC2 O;  3CME O;  1VQO O;  3CC7 L;  3CME L;  2YZS A;  5DQT A;  3CXC K;  2QEX O;  3G71 L;  1VQN L;  4W8K A;  2OTL L;  3CPW N;  1QVG N;  1YIJ L;  1KC8 P;  1KC8 M;  1VQ9 L;  4XTK A;  1YJW O;  1N8R P;  1N8R M;  1QVF N;  5DQZ A;  1K9M M;  3CC4 L;  3I56 O;  3CCS O;  2QA4 L;  3CCE L;  1S72 O;  1VQM O;  1VQ6 L;  3OW2 N;  3G4S L;  1Q7Y M;  3CC7 O;  1VQM L;  1JJ2 N;  3G6E L;  1KQS K; 
#chains in the Genus database with same CATH homology
 1Q86 P;  3G71 O;  1Q86 M;  3CCM L;  1M90 P;  1M90 M;  1VQN O;  1VQL L;  2OTL O;  5DS4 A;  1YIJ O;  1VQ9 O;  1M1K P;  3CC4 O;  3CCU L;  3CCQ L;  3CD6 L;  3CCJ L;  2QA4 O;  3CMA L;  1W2B N;  3CCE O;  1VQ8 L;  1VQK L;  1VQ6 O;  3G4S O;  1KD1 P;  1KD1 M;  1YJ9 L;  5DS6 A;  3G6E O;  2OTJ L;  5FCL A;  3CCM O;  1VQL O;  3CPW K;  3CCR L;  1QVG K;  1VQ4 L;  1YJN L;  4WJ0 A;  3CXC N;  1Q82 P;  1Q82 M;  3CCL L;  1M1K M;  1QVF K;  3I55 L;  3NKD A;  3CCV L;  4P6I C;  1YHQ O;  1VQ7 L;  3CCU O;  1YI2 O;  1YHQ L;  1K8A P;  3CCQ O;  3CD6 O;  3CCJ O;  3CMA O;  1YI2 L;  1VQ8 O;  1VQ5 L;  1VQK O;  5DS5 A;  4N06 A;  3OW2 K;  1YIT L;  1NJI P;  5DLJ A;  1NJI M;  1JJ2 K;  1YJ9 O;  3CC2 L;  2OTJ O;  1VQO L;  4QDL A;  3GOD A;  3CCR O;  1VQ4 O;  1YJN O;  2QEX L;  1KQS N;  3CCL O;  3I55 O;  3CCV O;  1YJW L;  1VQ7 O;  1K9M P;  1K73 P;  1K73 M;  1W2B K;  1Q81 P;  1Q81 M;  3I56 L;  1K8A M;  1YIT O;  1VQ5 O;  1VQP O;  3CCS L;  1S72 L;  1Q7Y P;  1VQP L;  3CC2 O;  3CME O;  1VQO O;  3CC7 L;  3CME L;  2YZS A;  5DQT A;  3CXC K;  2QEX O;  3G71 L;  1VQN L;  4W8K A;  2OTL L;  3CPW N;  1QVG N;  1YIJ L;  1KC8 P;  1KC8 M;  1VQ9 L;  4XTK A;  1YJW O;  1N8R P;  1N8R M;  1QVF N;  5DQZ A;  1K9M M;  3CC4 L;  3I56 O;  3CCS O;  2QA4 L;  3CCE L;  1S72 O;  1VQM O;  1VQ6 L;  3OW2 N;  3G4S L;  1Q7Y M;  3CC7 O;  1VQM L;  1JJ2 N;  3G6E L;  1KQS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...