2OTJQ

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2otjQ00
1M90R 3OW2P 3CC7Q 1Q81R 1K8AR 1KC8R 1VQ4Q 2OTJQ 1N8RR 1VQ9Q 1M1KR 1YITQ 1NJIR 2QEXQ 3I56Q 1Q7YR 3G4SQ 1YJWQ 3CCSQ 1VQMQ 1K9MR 3CC4Q 1Q82R 1S72Q 3CMAQ 1YHQQ 1VQOQ 3CXCP 3CCMQ 3CCEQ 1VQLQ 1W2BP 3I55Q 1YJNQ 1VQ5Q 1YI2Q 3CCRQ 1VQPQ 1K73R 1KD1R 3CCQQ 3G71Q 3CCVQ 3CPWP 3G6EQ 1QVGP 2OTLQ 3CCLQ 1Q86R 1VQ6Q 1YIJQ 3CCJQ 3CD6Q 1VQNQ 1VQKQ 1JJ2P 1YJ9Q 3CMEQ 3CC2Q 1KQSP 1QVFP 3CCUQ 2QA4Q 1VQ8Q 1VQ7Q
chains in the Genus database with same CATH superfamily
3I55T 4Y92A 2OAUA 4F7UA 1JJ2S 3RR6A 3HSBA 4N0AA 2Y4YA 2L89A 2DETA 4FW2A 4DBHA 1B3QA 1T0JA 1UUEA 3ASKA 4J8OA 1PHTA 3LH0A 4EPCA 2ZPIB 2DA9A 4BE2A 2DBMA 2FO0A 4LD9K 1OOTA 3GLXA 5D7UA 1GRIA 1XOVA 1EX4A 2DE0X 3CCVT 4J9IA 2QA4A 1QWEA 2K9GA 3C0CA 5I22A 3BW1A 7AT1B 2I0NA 3QJYA 5GAMf 2RB6A 2K2MA 2KGTA 1FX7A 1KSWA 3L2WA 2DBKA 3REAB 2CUBA 4QVCA 2CP6A 1ZHIA 5DY9A 2LT1A 2DIGA 2CZ0B 1IXDA 1Q81U 4C5HA 2XMFA 4FYWB 3CPWA 2XKOC 1OULA 3CCUT 2F2VA 2XG8D 1SSFA 4NS5A 2K7AA 3QYHB 5KYXA 1TU0B 1VQ5Q 2KVQG 3GPLA 4FL6A 3H8ZA 3JCMh 4OB3B 3PTAA 2K79A 2X4JA 1AOJA 3EG9A 3CC4T 2DJZA 2O9VA 5KE2A 1AZEA 4J9GA 3QZ5B 2EQMA 2MI6A 2J6FA 2ESWA 2KT8A 4FW1A 2HBPA 1Q7YC 1KJWA 3G4SQ 2ZPEB 1YNZA 5GANf 2QG9B 5CK9A 3R6NA 3QPHA 5IXBA 2DVEA 3MEVA 1CKAA 1FMKA 2QQSA 3L2ZA 1EZZB 2HAXA 4D8KA 1X2KA 5CQYA 3MKDA 3M0TA 4L59A 1RAIB 1QP2A 3MP8A 3AT1B 1TH7A 1NJIU 4M75D 2NUPA 2O2OA 2VXEA 4KGZB 5I11A 3VS0A 4HCKA 4KT0E 3GNGA 4F14A 5CKFA 4A4FA 5GMKl 1NPRA 3HPWA 2D8JA 3NGPA 2HDAA 2KK4A 1MMDA 4AFSC 3UPUA 2M9UA 1WPYA 3GP8A 4E7IA 2E1HA 3CCLT 1UGQB 4PL6A 3I56Q 4E47A 1AWXA 1PWTA 1R0BG 4RTYA 2LTOA 3C12A 1VQOQ 4M78E 3JCMX 2KQWA 2ED1A 3O5ZA 2FPFA 1OU9A 1Q86R 2CH4W 4CI0C 1JJ2P 3I9QA 4AT1B 3CCMT 3R6OA 2O31A 2DTIA 2G6FX 1K4US 1UEBA 4X1VA 4C8QF 1KC8C 3URGA 2K3YA 1VOMA 2X3WD 3SB2A 1H3HA 2CSIA 2RN8A 3QXEB 2JT4A 2K6DA 2VGMA 2VGNA 1JXOA 3CXCS 1YJNA 1QMCA 2LCSA 3SHWA 4C8QC 3CMAT 1WQ7A 2PVDB 1M1FA 3JB9J 2R58A 3LX7A 2VWFA 4BI8B 3VS1A 5KYYA 4XAXB 4PJOA 1MNDA 2P4TA 1UE9A 2EJ9A 1JJ2A 2RA2A 1KQ1A 3PFSA 5IHNA 1NG2A 1W1FA 1GCQC 3MJXA 2AZVA 1TG0A 5D6YA 3JCMW 3A98A 1KD1C 1ZSGA 3G1JA 2QDLA 2LJ1A 1FYNA 2X3XD 3S3NA 1VIEA 3CCJA 4LDXA 3TVTA 2X35A 1KQSS 2DXBA 4QT7A 3OS1A 4J7FA 2XI9A 5KYWA 3M0UA 2WSFE 4IUUA 1JQQA 2JM9A 4JDSA 1VQ8T 2CKKA 3TREA 3RDVA 1Q82U 4F17A 3L2QA 5CKDA 2HNIA 4XQ3A 2YLCA 1K73U 2MK5A 1Y57A 3JAME 2YRDA 1VQKQ 2DF6A 3TQ7P 1AEYA 4NOYA 1XTDA 2KYMA 2C0IA 4C8QB 1YJ9A 1YCYA 1IZ6A 3EGDB 1D0YA 1X43A 1NYGA 1VQ9Q 2EKOA 2YHTA 2RMOA 3QJ6A 2DERA 3VS7A 4E7JA 2KE9A 1MHNA 4M7DE 2QEXT 3E9GA 1IGUA 5KYNA 3G4ST 1E6HA 2VV5A 4HVVA 2Y4XA 3OA6A 3KXTA 1N5ZA 2V8JA 2JVVA 2VKNA 1K8AR 3SEMA 5LJ3f 2VC8A 4VUBA 2RHIA 4OMPA 3OYYA 4A4GA 3L2RA 3OYGA 3G71Q 1JBMA 3EFRA 2LJ0A 3ER0A 2DZ9A 3CMEQ 4IUQA 5GMKi 2QGGA 1VQ4Q 5CIUA 1I81A 1D3BB 3PGGA 2H3EB 1XNIA 4XTZA 2COWA 2A0FB 1BI0A 4C5IA 3V8LA 1WQWA 3RUXA 1RL2A 3H0FA 3I56T 4FYVB 1ZX6A 1M9SA 1VQPA 5GAN8 5FU6C 2V26A 5KH6A 1VQ7Q 1OV3A 2F69A 1V29B 3FEOA 4KH1B 5GJVB 4HXJA 1CKBA 2VYTA 1VQNT 4M75G 2FRYA 5KCOA 3QG1A 1N6AA 3CC7A 1TSFA 1ZA1B 2E4HA 1AWJA 4O5VA 5LJ3h 3CXCP 3L42A 1MMGA 5IT9E 1BBZA 1LVKA 2M16A 4CRIA 2H8HA 4OMMA 3EFOB 5L8RE 1YI2T 1WDXA 2HQHA 1C1AA 2NUTA 3KBGA 4BE1A 1NJIC 3QDFA 2LMJA 4M7AG 5KCHA 5CAIA 4L5GA 2BZXA 1OU8A 4LDWA 4E7ZA 4J9FA 1WLPB 4PJLA 4B9WA 2LCLA 2FEIA 1RLPC 5GAMd 2K5LA 3CXCA 4X34A 1H641 4LNPA 1MGQA 4JLGA 5D6XA 5ECAA 2A37A 3QIIA 4ZN3A 2AIRB 3GOXA 4HT9A 3CCEQ 2AT1B 3BDLA 4PK4A 5FWBA 4M77G 2FZGB 3EGXA 4C8QD 1I0CA 2OJ2A 1ZSZC 1BB9A 4JUVA 5GAMe 4LDUA 2W0ZA 1VIFA 3QZ9B 4MZTA 1M2VA 4JRIA 1NEGA 3I5SA 1YITQ 1VQKT 1UTIA 2EYYA 2CGHA 2YXYA 2OTJA 1GL5A 1U1TA 3EG1A 2LJ3A 4BY6C 3OYDA 2QXFA 2EQJA 4PKCC 3JB9F 1JXMA 2BUDA 5LJ5j 3NTKA 2V8IA 2K3BA 2JOYA 2GCXA 5GANd 1QW1A 1QCFA 3JV3A 1OX8A 3M57A 2E5QA 3CCRT 3LLRA 1WXBA 2OI3A 2SEMA 4M78F 3M4GA 4A54A 4LN2A 3EFSA 2B8AA 4Q5WA 3O8VA 2QK0A 4OVAA 4OGEA 2YT6A 1ZLMA 4B9XA 2K5IA 4M78C 1SG5A 5IAYA 4Z8AA 3CCUQ 4RTVA 3UDCA 3X26B 1BCMA 3G71T 1RADB 4GY5A 2M1HA 1KHIA 2EYZA 3M0PA 2CH4A 4XU0A 3SWNC 2F5KA 1Q82C 2E10A 3CC4Q 2JTFA 2CDTA 2W10A 2DFUA 1VQ4T 1K73C 2FB7A 1OQKA 5AYFA 4EMKB 2ZPBB 2LT4A 4BY6B 3IQLA 3JCMP 2EAYA 1VQLA 1GCPA 1Q86U 1TOVA 2E3HA 5EG2A 2CZ6B 3CQTA 1A0NB 2OTLT 2XHCA 3VS3A 2RHZA 4N4HA 4F7UB 1ZBJA 1ZBXA 1VQ7T 3ZBDA 2LP5A 2DD4A 2RQTA 4ZGJB 5FW9A 3RMSA 1T0HA 1SSHA 4C0GA 2H3JA 1GXIE 3VRZA 4IIMA 3FLGA 4M78B 1YIJA 1UGPB 6AT1B 2ED0A 4C0FA 3G6ET 1JU5C 4CC7A 2L8DA 3SWNB 1GBRA 1WZOA 3N5BB 1QVPA 2K2VA 1YHQA 1M8MA 2D8HA 4FYYB 2E70A 2ZAEA 3JB9H 4M7DF 2DTOA 2AZSA 1RAEB 1YCSB 2C0OA 1ABOA 1NE8A 1NBEB 3A1PA 1JEGA 2HKNA 4QQGA 3M58A 1NLOC 5KYXB 2EQKA 3CCJQ 1QQJA 4M7DC 2MAMA 3VRYA 5HK3A 2L3QA 5LL6S 3CCET 3M4YA 1BI3A 3EG9B 2BE7D 3E9FA 1ZUUA 1QP3A 1NM7A 1M3CA 4XU2A 4XTXA 5CVIA 1KK7A 4RTUA 1WA7A 5GAN2 1MUZA 3QSUA 5CO7A 3CMAQ 2DILA 2PVGB 3JCMf 3OYHA 4C92E 3REBB 3LYIA 5LJ3g 3ULRB 3I35A 2RJFA 2X9HA 4ME7A 1YITT 3HFOA 1AZGB 2WSEE 3META 1WJQA 4HVUA 1K8AU 2QAZA 1T3LA 3KUFA 3Q1JA 2MF2A 3KFVA 4MMKA 1XQHA 5A0DA 1U1SA 4PJOF 2BE9B 2NUPB 2DYBA 4MDXA 1VQ6Q 3OY9A 1PM3A 3L2VA 2CSQA 4ZN1A 1VQ8Q 3CD6A 1E6GA 3EH2A 4M7DB 2YDLA 1VA7A 3RIRA 3RKYA 1CSKA 2G3RA 1WJRA 2NUZA 2O9SA 3PVLA 2DL7A 2QQRA 4FU6A 4AG2C 5GAN3 4M75A 5CKHA 4J9EA 1VYUA 3VU3C 1TTHB 5LJ3e 3BFMA 1SPKA 3FDRA 1FWZA 1PRMC 2FPDA 3CC2A 2DZCA 1I5LA 3JB9D 1X01A 2K57A 2RQRA 1OI1A 4IIOA 2QEXQ 2CREA 1GFCA 2ENMA 3S3OA 2LC4A 2FG0A 4M78D 4FCYA 4OB0B 4M7AA 1E7OA 4IUVA 2EYXA 5AT1B 2VB6A 1KFZA 2DIQA 2KMTA 3CC7Q 1ACMB 3A8GB 2LX9A 3DKMA 1WIEA 2QGFB 3OBWA 4XK8E 4PJOB 1BIBA 4LDVA 1O75A 1S72Q 4D6WA 1NYFA 3QDRB 5GAOr 4QVZA 3V8JA 4J6WA 4M77A 4F7UE 3RERA 4R55A 4JLIA 4OF1A 4C0ZA 1VYVA 3SFMA 1Z9ZA 4NL3A 4ZGEB 1VQMQ 4DEYA 1B34B 2FZKB 4EMGA 3OYAA 1UECA 4CC3A 2LCCA 3UT1A 1K0SA 1WHKA 1UJ0A 2L3RA 3CCQQ 2E6NA 2RNAA 2ZZDA 1Q86C 1W2BS 1VQNQ 1AWOA 1LCKA 2J6OA 3HRUA 3VV0A 4KUIA 2KY9A 3CCJT 2K5FA 4RKUE 1N8RC 1AD5A 2EKHA 2VXFA 1M30A 2COZA 1YJWA 4HA8A 5IN1A 1YI2Q 2YUNA 3MP1A 3I5RA 3PNWC 5HKCA 1QVGS 2KBTA 2Y90A 1RAFB 1KC8R 2A7YA 4FSXA 3X20B 4C0DC 1RI9A 2FRWA 1MMNA 3L1AA 2AKLA 2RI5A 4HT8A 2BZ8A 3V8KA 4PLLA 1G83A 1RABB 2CS7A 4Z89A 4M7DD 2OX7A 2P84A 1UG1A 1G2BA 1W70A 1N9RA 1C0MA 5I21A 3CCLA 4E7KA 2EFIA 2K3XA 2P0QA 5GMKj 1VQ6T 5HY6A 2ZPHB 2ZCFB 2HQXA 3PIOA 3MEUA 1WFWA 2LZ6B 2BIVA 5GAOq 1KD1R 2X4XA 2QQBA 5GAN7 3CCMA 5L23A 1X27A 2GFUA 4J9HA 4XTUA 1M90R 2HL5C 4Y91A 1WJSA 1JRIA 2RK2A 2JN0A 5LJ5h 2EBPA 4C0DB 4LUEA 3NMZC 2L3PA 3CCRQ 3GIBA 1V1CA 2XDDA 2ZPGB 1IHVA 2KI7A 2JTMA 2EWNA 2O4XB 4PJOD 3VKIA 1X69A 2RI2A 1WHGA 1RAHB 2HKQB 3TEEA 4J6XA 3CCSQ 3OMCA 1R77A 1NZ9A 3CC7T 3M59A 2KROA 2E65A 4FT2A 1QCNA 2MOXA 1S72T 1LJOA 3JB9G 2DXTA 4C92F 1SRLA 1Q81C 2FYKA 9ATCB 2EYQA 2A08A 1UJYA 3TSZA 1H92A 3LWIA 4UC4A 4JRQA 3VS5A 4X9DA 1W2BP 5CKEA 2OTLQ 4C92C 3LW5E 1VQ5A 3QYGB 1VQMT 1GBQA 1TWBA 3JCMg 1F1BB 3JRZA 4HCZA 1TUDA 4PJOE 3CCQT 2JS0A 4KULA 4AFQC 3HFNA 3TCJA 2DEUA 1M2VB 3H41A 3PIPA 4OB2B 4EDUA 3G4SA 1PD0A 4DA4A 1OZ2A 3M9QA 3EG3A 1QVGP 3G6EQ 4C8QA 4DQ2A 2CP0A 3S6WA 1WX6A 1XJWB 3EGDA 3JCMd 5GANj 1W2BA 1R8OB 2KXCA 4XU3A 2XDBA 3QO3A 4RTXA 4E7SA 4BACA 3HHTB 1IGQA 1GCQA 3M55A 2OTJT 1MNEA 2CYZB 1C6VX 2DEQA 3QBYA 3HL8A 3JCMe 4XU1A 2CP3A 4C92B 2CZ7B 2JW4A 2QA4Q 4PJNA 1EFNA 2M0YA 3MEAA 1UB4A 3M0QA 3VUBA 1QVGA 2EIFA 4DBQA 1NJIR 2DL3A 4FT4A 3OS2A 1Y96A 3FRNA 1I8FA 5CCAA 4KH0B 1YWOA 1VQOA 2FPEA 1D1AA 2E41A 3NPFA 3ZFJA 3JCMV 2L5QA 3QWXX 3VYHB 3J81E 2O01E 1PCXA 2KNBB 1D3BA 2QTXA 2XD0A 4DBRA 2GQIA 2KRNA 5I2MA 1H8KA 4BI4A 4F7UF 2RHUA 3MP6A 4MMLA 4EMKC 3RKWA 2HQEA 4ZGDB 1B7TA 2DAQA 4ESRA 4V2SA 3WVDB 2RJEA 4ELYC 2LVMA 2HMAA 2JZ2A 3CC2Q 1JB0E 4M4ZA 1I5OB 1Y07A 3FJ5A 1WHLA 5A0LA 2A28A 2ATCB 3MHXA 2EVRA 3HRSA 4JPBW 3EG0A 1SEMA 1M1KR 2PQWA 3RNJA 4N0AC 2GBQA 2R5MA 1SHGA 2PTKA 4EMHA 1W4SA 5CR2A 2KRSA 3CCST 1MMAA 1P92A 1OZ3A 1PKTA 1PC0A 2RQWA 1G3SA 2KDSA 2FL7A 5KYUB 2E12A 1MV3A 2F5TX 4BDYA 1UGSB 1YP5A 4JJNK 1UHFA 4PFOA 2JMCA 3QKJA 5DLQE 3E2UA 1TUCA 3ZEHA 2IVWA 3EHRA 5GAOp 2A36A 3RKXA 3BE3A 1QVFP 4J83A 3NTHA 3DLMA 1VQKA 2E6ZA 2RJDA 4II1A 4C5EA 2LRQA 2MIOA 3WVEB 2J05A 2YLBA 2J7IA 2CP7A 4MZMA 3A5ZB 4O6JA 2JTEA 5FRMA 1VQ9A 1YN8A 5LJ5g 3JSCA 3OYKA 4YTLA 1KIKA 4ATOA 3SDZA 3X24B 1LOJA 3DB3A 1IB8A 4DBFA 2LNVA 4M7AF 1X6BA 1BK2A 1WHHA 2AHJB 4OMOA 5GAN5 1NEBA 1KC8U 3UWNA 3VS4A 3FJPA 2KYBA 2RM4A 1YBYA 3OBYA 1ZA2B 4QKUA 5FROA 4C92D 1YJNQ 1ZUYA 1YWPA 1HD3A 4RTZA 5HCKA 4N4IA 3OYLA 3CMEA 1WXUA 1OPKA 1SHFA 3UA7A 3NTIA 2LDMA 3MPUB 4M77F 1KG1A 3OW2S 4A4HA 2BKDN 2YUQA 1VQ4A 2QA4T 1K9MR 4ZNXA 5LJ5e 2GQVA 2GTJA 1KD1U 2PVOB 3P8HA 4KUDK 2XICA 1ZSZA 2KEAA 3OYFA 2O88A 3U23A 1D09B 4PFPA 4IUTA 4AFZC 3LGFA 1M90U 2GTOA 2LQ8A 4RTTA 1IO6A 3UF4A 2HCKA 1VQ7A 2DXCA 2VUBA 3EGUA 4CC2A 3OYJA 3C95A 2DO3A 1PRLC 1W6XA 3D7SB 4OB1B 2RH2A 3VYGA 2DL8A 1J3TA 1X75C 1KQ2A 4XTWA 2D1XA 4QQDA 3DLLA 1UFFA 2V1QA 1YJ9Q 4M7AB 5FLXE 1G3WA 1OX9A 4RMOA 4JRPA 2IPOB 2ABLA 2J6KA 2EQIA 1SF9A 3H0HA 4JZ4A 4WCIA 3QUIA 5GAN4 1KHCA 4D8DA 3CC2T 1RACB 2HL3A 1Z9QA 4C8QG 3GBQA 4OP0A 3G7ZA 2DJQA 2E64A 4M78A 5LJ3d 3CPWP 3CEYA 5GMKh 5FU7B 5I2SA 3UA6A 4ANJA 3VUZA 3WXMB 4M77B 3PMTA 4BDZA 4JS4A 1BI2A 3M5AA 3OMGA 3SWNA 4PJOC 1HJDA 5J26A 1YFNA 3MCAB 1TUGB 4LXCA 2EQUA 1X2QA 4N4GA 3CCEA 2DKGA 3F70A 5GAOm 2PNIA 4GLKA 3I55A 2FVUA 4HKEA 4XTVA 2ZPFB 3PT9A 4J9CA 2A3LA 1M2OA 4MZPA 2ZGWA 1HK9A 4FSSA 2RI3A 1WNLA 3M0RA 2DLPA 1YITA 4Z02A 4E6RA 1RAAB 1BKBA 1TXQA 3HTRA 1VQPQ 1PSFA 3GF5A 2CP2A 3L2UA 3SD4A 2WSCE 4LUDA 2PUOB 2ECZA 3CCVA 4DOWA 3ME9A 2CZ1B 3C94A 4RCCA 2QTVA 5KYYB 1Q7YR 3EHQA 2RO0A 4KRTA 4HCBA 2E3IA 2YSQA 3RBBB 2RPNA 2KAFA 1M3AA 2DM1A 1WI7A 1YJWT 2PU9B 5GAMh 3TU4K 4IKFA 3JCMJ 4MDWA 2GNCA 1D1BA 1HXDA 2EJFA 1YJNT 3OW2P 2JMAA 4JS5A 2MMPA 4KGXB 3CCUA 4Y28E 2D6FA 3P8DA 3PE0A 5KYWB 2QI2A 3CC4A 1UGRB 2LQKA 4M7DA 4L6V5 1OYXA 3GNFB 2SRCA 3OYNA 4OMQA 5FWCA 4C92G 5DLOA 5DM7R 3UATA 2FZCB 3OW2A 4M7AD 1RLQC 3E1SA 4RG2A 4KBMB 5GANh 3J80E 4R0KA 5IHIA 2V1RA 2KSSA 2NYSA 1OPLA 3PVQA 4ZTJA 3T9NA 1M4ZA 5M9OA 1BU1A 1IREB 1UDLA 2OTJQ 5LJ5f 2F1LA 1N8RR 1I1JA 2HBWA 3THKA 1M1KU 3A8HB 3INZA 1YJ9T 2BTTA 2RQUA 4M75E 2YRCA 2LQNA 2EGAA 3M54A 1IHWA 2JS2A 3M53A 4M77D 2QQAA 3MEWA 3A8OB 1K1ZA 1AHJB 4K11A 1X6OA 3EH1A 1RAGB 3AHUA 2B86A 2RK1A 1VUBA 3NFCA 1SKUB 1SRMA 3BY7A 4CC4B 1ZUKA 1EIFA 1U8RA 2HD0A 3CBMA 4M7AE 4AMCA 2QQ9A 4AFUC 3P8BB 3LWHA 1BI1A 4PJJA 1QWFA 4PFZA 1Q95G 2DYIA 3ZL7C 1M90C 5C0MA 2WACA 3JCMc 5GJWB 4WF2A 4P5NA 5C6SA 5GMKm 1B34A 1RUWA 2OAWA 1ZQ1A 3HKSA 1PD1A 1M5Q1 2AK5A 1D0ZA 1VQLQ 4TVRA 4Z88A 3JB9I 3CMAA 2C06A 2LQWA 4M77E 4WTOB 2MYSA 4EIKA 2EJGA 1VQ5T 1K9AA 4BI3A 1VQPT 1G3TA 2XIDA 2GF7A 4J9DA 4GBQA 1K8AC 4PNOA 3OS5A 4RCBA 4E7HA 2NUTB 3H0IA 2ROTA 1QKWA 3H9NA 1LPLA 2JUFA 2HEQA 5A2QE 1ABQA 1AVZC 2F2XA 4QW2A 4F7UG 1YIJQ 2NLUA 1FMVA 1VQ6A 1G5VA 2X4YA 3OSVA 3JCMQ 4IURA 5GAMj 1VQ8A 1QCOA 2JXBA 2VASA 2YWWA 2PUKB 1K9MU 4M78G 2R57A 1YHQQ 4BE0A 4QVDA 1Y96B 1QKXA 4C5GA 1AWWA 1T3SA 4HVWA 3EGXB 3OQ5A 1AT1B 1Q81R 1QVFS 2DPPB 5KE3A 5IH2A 1Y0MA 2JJ9A 1H3ZA 2XK0A 3M0SA 1G8XA 2QASA 2QEXA 5D6WA 2P0KA 4F04B 2XDPA 3FIFA 2MCNA 4OGCA 5GMKe 2QDYB 1VQOT 2M02A 2YRVA 2LX7A 4BB7A 1PKSA 1UGVA 3OSSC 4A63B 2AKKA 2L2PA 2RHYA 2DD5A 3J7AF 1WHMA 1N27A 1I07A 4E2FB 3CBPA 2I2LA 1O9SA 1TS9A 3OYEA 3X25B 3S3MA 2EGEA 2EYWA 4HCCA 2CT3A 1S72A 2O4XA 3OB9A 1PG5B 3MO8A 4A4EA 1M8VA 1X6GA 2IG0A 3X28B 3E19A 5GAMg 2MWOA 3VJPA 3A8MB 4OMNA 4JJCA 2HZYA 3V7RA 2QYZA 3VS6A 3FB9A 4ORZA 4A4KA 2DX1A 2FHDA 1B07A 2DL5A 5IHKA 1DJ7B 3I56A 4FM4B 1VQMA 2DNUA 3EAEA 1PSEA 4ELZC 4DOVA 3VS2A 3CD6Q 3CCQA 1KQSP 2XU8A 3JCMb 2V8KA 1VQNA 1M3BA 5FU6B 2K4YA 4LE9A 3TSWA 2DTHA 1JO8A 2DRMA 1HSQA 1UHCA 4X9CA 4E7LA 4GLMA 4M7DG 3I55Q 2KT1A 1WHJA 2YUOA 2Z0WA 3CBOA 3V7CA 5GANg 1YI2A 1R0CB 1VQLT 2DXUA 3M56A 3NHNA 4IUPA 2RF0A 2L0AA 1M1KC 1KQSA 1NLPC 2R5AA 1Q7YU 2EPDA 1LNXA 4J7IA 4BUGA 2PZ1A 2YUPA 4DEXA 2DL4A 4A53A 5J39A 1VQ9T 2L3SA 4J5YA 3EFOA 4RG8A 3CCVQ 4OMFB 2DK3A 2IIMA 2MWPA 2JM8A 3CPWS 3RMQA 2J06A 1YIJT 5GAOn 2BZYA 4ZTFA 2EW3A 4PJMA 1WYXA 8AT1B 2GGRA 5A0GA 5FRNA 4RTWA 3EG2A 2KXDA 4C8QE 4C92A 5GANe 1N9SA 1PNJA 2RHXA 4M75F 1V76A 4PJOG 3V7SA 1ZSZB 1FMWA 1YHQT 4JZ3A 2DMOA 3BDUA 2VVKA 4F16A 4JRKA 2KRMA 2C0TA 2X4WA 4FIBA 4JJBA 3OYIA 5IXFA 3CMET 3QHSA 3LGLA 1BYMA 5EC7A 3A8LB 2RQVA 1Q82R 2D9TA 4XTYA 4M75C 1VYTA 1K73R 4RUGA 2M51A 3CPFA 2COYA 3HRTA 3CCRA 1U06A 2DRKA 3OYCA 1U3OA 1GFDA 5GAN6 4BD3A 1M1GA 4AG1C 1G3YA 2RD1A 3OYBA 5CQXA 1N8RU 1MV0B 2F2WA 4B6MA 1I4K1 1YJWQ 1OEBA 1BCOA 1K0XA 1QVFA 3DB4A 3FC3A 1WXTA 2P0PA 3CCSA 1S1NA 3HP9A 5LJ5d 1IRXA 2CUDA 3H6ZA 1QLYA 4M7AC 5LJ3j 1D0XA 2D0NA 4PLIA 1M27C 3G71A 3C4SA 4QQ6A 4J6YA 5HK0A 2M0OA 4FYXB 1Y7XA 1K9MC 5GAOl 2HSPA 4R56A 2HSEB 5CKBA 3OYMA 1BIAA 1ARKA 2D0QB 8ATCB 4M75B 2EGCA 2X51A 3CCLQ 5FU7C 2GFAA 1NPPA 2LNHB 2ROLA 2OTLA 5KYUA 1FXXA 4M77C 2MPXC 4KGVB 4JJDA 1HYOA 1Y71A 2RJCA 3CD6T 2CP5A 2JNGA 4OMLA 2DVJA 4J9BA 3RESA 1K76A 4NL2A 2KR3A 2CT4A 1WGSA 4EMKA 1U5SA 1RI0A 3OS0A 3CCMQ 3LH5A 2P4RA 4LDYA 4LD6A 3QWYA 2E5KA 1D1CA 3G6EA 5J3BA 3PMIA 2NWMA
chains in the Genus database with same CATH topology
1M90R 3OW2P 3CC7Q 1Q81R 1K8AR 1KC8R 1VQ4Q 2OTJQ 1N8RR 1VQ9Q 1M1KR 1YITQ 1NJIR 2QEXQ 3I56Q 1Q7YR 3G4SQ 1YJWQ 3CCSQ 1VQMQ 1K9MR 3CC4Q 1Q82R 1S72Q 3CMAQ 1YHQQ 1VQOQ 3CXCP 3CCMQ 3CCEQ 1VQLQ 1W2BP 3I55Q 1YJNQ 1VQ5Q 1YI2Q 3CCRQ 1VQPQ 1K73R 1KD1R 3CCQQ 3G71Q 3CCVQ 3CPWP 3G6EQ 1QVGP 2OTLQ 3CCLQ 1Q86R 1VQ6Q 1YIJQ 3CCJQ 3CD6Q 1VQNQ 1VQKQ 1JJ2P 1YJ9Q 3CMEQ 3CC2Q 1KQSP 1QVFP 3CCUQ 2QA4Q 1VQ8Q 1VQ7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 R;  3OW2 P;  3CC7 Q;  1Q81 R;  1K8A R;  1KC8 R;  1VQ4 Q;  2OTJ Q;  1N8R R;  1VQ9 Q;  1M1K R;  1YIT Q;  1NJI R;  2QEX Q;  3I56 Q;  1Q7Y R;  3G4S Q;  1YJW Q;  3CCS Q;  1VQM Q;  1K9M R;  3CC4 Q;  1Q82 R;  1S72 Q;  3CMA Q;  1YHQ Q;  1VQO Q;  3CXC P;  3CCM Q;  3CCE Q;  1VQL Q;  1W2B P;  3I55 Q;  1YJN Q;  1VQ5 Q;  1YI2 Q;  3CCR Q;  1VQP Q;  1K73 R;  1KD1 R;  3CCQ Q;  3G71 Q;  3CCV Q;  3CPW P;  3G6E Q;  1QVG P;  2OTL Q;  3CCL Q;  1Q86 R;  1VQ6 Q;  1YIJ Q;  3CCJ Q;  3CD6 Q;  1VQN Q;  1VQK Q;  1JJ2 P;  1YJ9 Q;  3CME Q;  3CC2 Q;  1KQS P;  1QVF P;  3CCU Q;  2QA4 Q;  1VQ8 Q;  1VQ7 Q; 
#chains in the Genus database with same CATH topology
 3I55 T;  4Y92 A;  2OAU A;  4F7U A;  1JJ2 S;  3RR6 A;  3HSB A;  4N0A A;  2Y4Y A;  2L89 A;  2DET A;  4FW2 A;  4DBH A;  1B3Q A;  1T0J A;  1UUE A;  3ASK A;  4J8O A;  1PHT A;  3LH0 A;  4EPC A;  2ZPI B;  2DA9 A;  4BE2 A;  2DBM A;  2FO0 A;  4LD9 K;  1OOT A;  3GLX A;  5D7U A;  1GRI A;  1XOV A;  1EX4 A;  2DE0 X;  3CCV T;  4J9I A;  2QA4 A;  1QWE A;  2K9G A;  3C0C A;  5I22 A;  3BW1 A;  7AT1 B;  2I0N A;  3QJY A;  5GAM f;  2RB6 A;  2K2M A;  2KGT A;  1FX7 A;  1KSW A;  3L2W A;  2DBK A;  3REA B;  2CUB A;  4QVC A;  2CP6 A;  1ZHI A;  5DY9 A;  2LT1 A;  2DIG A;  2CZ0 B;  1IXD A;  1Q81 U;  4C5H A;  2XMF A;  4FYW B;  3CPW A;  2XKO C;  1OUL A;  3CCU T;  2F2V A;  2XG8 D;  1SSF A;  4NS5 A;  2K7A A;  3QYH B;  5KYX A;  1TU0 B;  1VQ5 Q;  2KVQ G;  3GPL A;  4FL6 A;  3H8Z A;  3JCM h;  4OB3 B;  3PTA A;  2K79 A;  2X4J A;  1AOJ A;  3EG9 A;  3CC4 T;  2DJZ A;  2O9V A;  5KE2 A;  1AZE A;  4J9G A;  3QZ5 B;  2EQM A;  2MI6 A;  2J6F A;  2ESW A;  2KT8 A;  4FW1 A;  2HBP A;  1Q7Y C;  1KJW A;  3G4S Q;  2ZPE B;  1YNZ A;  5GAN f;  2QG9 B;  5CK9 A;  3R6N A;  3QPH A;  5IXB A;  2DVE A;  3MEV A;  1CKA A;  1FMK A;  2QQS A;  3L2Z A;  1EZZ B;  2HAX A;  4D8K A;  1X2K A;  5CQY A;  3MKD A;  3M0T A;  4L59 A;  1RAI B;  1QP2 A;  3MP8 A;  3AT1 B;  1TH7 A;  1NJI U;  4M75 D;  2NUP A;  2O2O A;  2VXE A;  4KGZ B;  5I11 A;  3VS0 A;  4HCK A;  4KT0 E;  3GNG A;  4F14 A;  5CKF A;  4A4F A;  5GMK l;  1NPR A;  3HPW A;  2D8J A;  3NGP A;  2HDA A;  2KK4 A;  1MMD A;  4AFS C;  3UPU A;  2M9U A;  1WPY A;  3GP8 A;  4E7I A;  2E1H A;  3CCL T;  1UGQ B;  4PL6 A;  3I56 Q;  4E47 A;  1AWX A;  1PWT A;  1R0B G;  4RTY A;  2LTO A;  3C12 A;  1VQO Q;  4M78 E;  3JCM X;  2KQW A;  2ED1 A;  3O5Z A;  2FPF A;  1OU9 A;  1Q86 R;  2CH4 W;  4CI0 C;  1JJ2 P;  3I9Q A;  4AT1 B;  3CCM T;  3R6O A;  2O31 A;  2DTI A;  2G6F X;  1K4U S;  1UEB A;  4X1V A;  4C8Q F;  1KC8 C;  3URG A;  2K3Y A;  1VOM A;  2X3W D;  3SB2 A;  1H3H A;  2CSI A;  2RN8 A;  3QXE B;  2JT4 A;  2K6D A;  2VGM A;  2VGN A;  1JXO A;  3CXC S;  1YJN A;  1QMC A;  2LCS A;  3SHW A;  4C8Q C;  3CMA T;  1WQ7 A;  2PVD B;  1M1F A;  3JB9 J;  2R58 A;  3LX7 A;  2VWF A;  4BI8 B;  3VS1 A;  5KYY A;  4XAX B;  4PJO A;  1MND A;  2P4T A;  1UE9 A;  2EJ9 A;  1JJ2 A;  2RA2 A;  1KQ1 A;  3PFS A;  5IHN A;  1NG2 A;  1W1F A;  1GCQ C;  3MJX A;  2AZV A;  1TG0 A;  5D6Y A;  3JCM W;  3A98 A;  1KD1 C;  1ZSG A;  3G1J A;  2QDL A;  2LJ1 A;  1FYN A;  2X3X D;  3S3N A;  1VIE A;  3CCJ A;  4LDX A;  3TVT A;  2X35 A;  1KQS S;  2DXB A;  4QT7 A;  3OS1 A;  4J7F A;  2XI9 A;  5KYW A;  3M0U A;  2WSF E;  4IUU A;  1JQQ A;  2JM9 A;  4JDS A;  1VQ8 T;  2CKK A;  3TRE A;  3RDV A;  1Q82 U;  4F17 A;  3L2Q A;  5CKD A;  2HNI A;  4XQ3 A;  2YLC A;  1K73 U;  2MK5 A;  1Y57 A;  3JAM E;  2YRD A;  1VQK Q;  2DF6 A;  3TQ7 P;  1AEY A;  4NOY A;  1XTD A;  2KYM A;  2C0I A;  4C8Q B;  1YJ9 A;  1YCY A;  1IZ6 A;  3EGD B;  1D0Y A;  1X43 A;  1NYG A;  1VQ9 Q;  2EKO A;  2YHT A;  2RMO A;  3QJ6 A;  2DER A;  3VS7 A;  4E7J A;  2KE9 A;  1MHN A;  4M7D E;  2QEX T;  3E9G A;  1IGU A;  5KYN A;  3G4S T;  1E6H A;  2VV5 A;  4HVV A;  2Y4X A;  3OA6 A;  3KXT A;  1N5Z A;  2V8J A;  2JVV A;  2VKN A;  1K8A R;  3SEM A;  5LJ3 f;  2VC8 A;  4VUB A;  2RHI A;  4OMP A;  3OYY A;  4A4G A;  3L2R A;  3OYG A;  3G71 Q;  1JBM A;  3EFR A;  2LJ0 A;  3ER0 A;  2DZ9 A;  3CME Q;  4IUQ A;  5GMK i;  2QGG A;  1VQ4 Q;  5CIU A;  1I81 A;  1D3B B;  3PGG A;  2H3E B;  1XNI A;  4XTZ A;  2COW A;  2A0F B;  1BI0 A;  4C5I A;  3V8L A;  1WQW A;  3RUX A;  1RL2 A;  3H0F A;  3I56 T;  4FYV B;  1ZX6 A;  1M9S A;  1VQP A;  5GAN 8;  5FU6 C;  2V26 A;  5KH6 A;  1VQ7 Q;  1OV3 A;  2F69 A;  1V29 B;  3FEO A;  4KH1 B;  5GJV B;  4HXJ A;  1CKB A;  2VYT A;  1VQN T;  4M75 G;  2FRY A;  5KCO A;  3QG1 A;  1N6A A;  3CC7 A;  1TSF A;  1ZA1 B;  2E4H A;  1AWJ A;  4O5V A;  5LJ3 h;  3CXC P;  3L42 A;  1MMG A;  5IT9 E;  1BBZ A;  1LVK A;  2M16 A;  4CRI A;  2H8H A;  4OMM A;  3EFO B;  5L8R E;  1YI2 T;  1WDX A;  2HQH A;  1C1A A;  2NUT A;  3KBG A;  4BE1 A;  1NJI C;  3QDF A;  2LMJ A;  4M7A G;  5KCH A;  5CAI A;  4L5G A;  2BZX A;  1OU8 A;  4LDW A;  4E7Z A;  4J9F A;  1WLP B;  4PJL A;  4B9W A;  2LCL A;  2FEI A;  1RLP C;  5GAM d;  2K5L A;  3CXC A;  4X34 A;  1H64 1;  4LNP A;  1MGQ A;  4JLG A;  5D6X A;  5ECA A;  2A37 A;  3QII A;  4ZN3 A;  2AIR B;  3GOX A;  4HT9 A;  3CCE Q;  2AT1 B;  3BDL A;  4PK4 A;  5FWB A;  4M77 G;  2FZG B;  3EGX A;  4C8Q D;  1I0C A;  2OJ2 A;  1ZSZ C;  1BB9 A;  4JUV A;  5GAM e;  4LDU A;  2W0Z A;  1VIF A;  3QZ9 B;  4MZT A;  1M2V A;  4JRI A;  1NEG A;  3I5S A;  1YIT Q;  1VQK T;  1UTI A;  2EYY A;  2CGH A;  2YXY A;  2OTJ A;  1GL5 A;  1U1T A;  3EG1 A;  2LJ3 A;  4BY6 C;  3OYD A;  2QXF A;  2EQJ A;  4PKC C;  3JB9 F;  1JXM A;  2BUD A;  5LJ5 j;  3NTK A;  2V8I A;  2K3B A;  2JOY A;  2GCX A;  5GAN d;  1QW1 A;  1QCF A;  3JV3 A;  1OX8 A;  3M57 A;  2E5Q A;  3CCR T;  3LLR A;  1WXB A;  2OI3 A;  2SEM A;  4M78 F;  3M4G A;  4A54 A;  4LN2 A;  3EFS A;  2B8A A;  4Q5W A;  3O8V A;  2QK0 A;  4OVA A;  4OGE A;  2YT6 A;  1ZLM A;  4B9X A;  2K5I A;  4M78 C;  1SG5 A;  5IAY A;  4Z8A A;  3CCU Q;  4RTV A;  3UDC A;  3X26 B;  1BCM A;  3G71 T;  1RAD B;  4GY5 A;  2M1H A;  1KHI A;  2EYZ A;  3M0P A;  2CH4 A;  4XU0 A;  3SWN C;  2F5K A;  1Q82 C;  2E10 A;  3CC4 Q;  2JTF A;  2CDT A;  2W10 A;  2DFU A;  1VQ4 T;  1K73 C;  2FB7 A;  1OQK A;  5AYF A;  4EMK B;  2ZPB B;  2LT4 A;  4BY6 B;  3IQL A;  3JCM P;  2EAY A;  1VQL A;  1GCP A;  1Q86 U;  1TOV A;  2E3H A;  5EG2 A;  2CZ6 B;  3CQT A;  1A0N B;  2OTL T;  2XHC A;  3VS3 A;  2RHZ A;  4N4H A;  4F7U B;  1ZBJ A;  1ZBX A;  1VQ7 T;  3ZBD A;  2LP5 A;  2DD4 A;  2RQT A;  4ZGJ B;  5FW9 A;  3RMS A;  1T0H A;  1SSH A;  4C0G A;  2H3J A;  1GXI E;  3VRZ A;  4IIM A;  3FLG A;  4M78 B;  1YIJ A;  1UGP B;  6AT1 B;  2ED0 A;  4C0F A;  3G6E T;  1JU5 C;  4CC7 A;  2L8D A;  3SWN B;  1GBR A;  1WZO A;  3N5B B;  1QVP A;  2K2V A;  1YHQ A;  1M8M A;  2D8H A;  4FYY B;  2E70 A;  2ZAE A;  3JB9 H;  4M7D F;  2DTO A;  2AZS A;  1RAE B;  1YCS B;  2C0O A;  1ABO A;  1NE8 A;  1NBE B;  3A1P A;  1JEG A;  2HKN A;  4QQG A;  3M58 A;  1NLO C;  5KYX B;  2EQK A;  3CCJ Q;  1QQJ A;  4M7D C;  2MAM A;  3VRY A;  5HK3 A;  2L3Q A;  5LL6 S;  3CCE T;  3M4Y A;  1BI3 A;  3EG9 B;  2BE7 D;  3E9F A;  1ZUU A;  1QP3 A;  1NM7 A;  1M3C A;  4XU2 A;  4XTX A;  5CVI A;  1KK7 A;  4RTU A;  1WA7 A;  5GAN 2;  1MUZ A;  3QSU A;  5CO7 A;  3CMA Q;  2DIL A;  2PVG B;  3JCM f;  3OYH A;  4C92 E;  3REB B;  3LYI A;  5LJ3 g;  3ULR B;  3I35 A;  2RJF A;  2X9H A;  4ME7 A;  1YIT T;  3HFO A;  1AZG B;  2WSE E;  3MET A;  1WJQ A;  4HVU A;  1K8A U;  2QAZ A;  1T3L A;  3KUF A;  3Q1J A;  2MF2 A;  3KFV A;  4MMK A;  1XQH A;  5A0D A;  1U1S A;  4PJO F;  2BE9 B;  2NUP B;  2DYB A;  4MDX A;  1VQ6 Q;  3OY9 A;  1PM3 A;  3L2V A;  2CSQ A;  4ZN1 A;  1VQ8 Q;  3CD6 A;  1E6G A;  3EH2 A;  4M7D B;  2YDL A;  1VA7 A;  3RIR A;  3RKY A;  1CSK A;  2G3R A;  1WJR A;  2NUZ A;  2O9S A;  3PVL A;  2DL7 A;  2QQR A;  4FU6 A;  4AG2 C;  5GAN 3;  4M75 A;  5CKH A;  4J9E A;  1VYU A;  3VU3 C;  1TTH B;  5LJ3 e;  3BFM A;  1SPK A;  3FDR A;  1FWZ A;  1PRM C;  2FPD A;  3CC2 A;  2DZC A;  1I5L A;  3JB9 D;  1X01 A;  2K57 A;  2RQR A;  1OI1 A;  4IIO A;  2QEX Q;  2CRE A;  1GFC A;  2ENM A;  3S3O A;  2LC4 A;  2FG0 A;  4M78 D;  4FCY A;  4OB0 B;  4M7A A;  1E7O A;  4IUV A;  2EYX A;  5AT1 B;  2VB6 A;  1KFZ A;  2DIQ A;  2KMT A;  3CC7 Q;  1ACM B;  3A8G B;  2LX9 A;  3DKM A;  1WIE A;  2QGF B;  3OBW A;  4XK8 E;  4PJO B;  1BIB A;  4LDV A;  1O75 A;  1S72 Q;  4D6W A;  1NYF A;  3QDR B;  5GAO r;  4QVZ A;  3V8J A;  4J6W A;  4M77 A;  4F7U E;  3RER A;  4R55 A;  4JLI A;  4OF1 A;  4C0Z A;  1VYV A;  3SFM A;  1Z9Z A;  4NL3 A;  4ZGE B;  1VQM Q;  4DEY A;  1B34 B;  2FZK B;  4EMG A;  3OYA A;  1UEC A;  4CC3 A;  2LCC A;  3UT1 A;  1K0S A;  1WHK A;  1UJ0 A;  2L3R A;  3CCQ Q;  2E6N A;  2RNA A;  2ZZD A;  1Q86 C;  1W2B S;  1VQN Q;  1AWO A;  1LCK A;  2J6O A;  3HRU A;  3VV0 A;  4KUI A;  2KY9 A;  3CCJ T;  2K5F A;  4RKU E;  1N8R C;  1AD5 A;  2EKH A;  2VXF A;  1M30 A;  2COZ A;  1YJW A;  4HA8 A;  5IN1 A;  1YI2 Q;  2YUN A;  3MP1 A;  3I5R A;  3PNW C;  5HKC A;  1QVG S;  2KBT A;  2Y90 A;  1RAF B;  1KC8 R;  2A7Y A;  4FSX A;  3X20 B;  4C0D C;  1RI9 A;  2FRW A;  1MMN A;  3L1A A;  2AKL A;  2RI5 A;  4HT8 A;  2BZ8 A;  3V8K A;  4PLL A;  1G83 A;  1RAB B;  2CS7 A;  4Z89 A;  4M7D D;  2OX7 A;  2P84 A;  1UG1 A;  1G2B A;  1W70 A;  1N9R A;  1C0M A;  5I21 A;  3CCL A;  4E7K A;  2EFI A;  2K3X A;  2P0Q A;  5GMK j;  1VQ6 T;  5HY6 A;  2ZPH B;  2ZCF B;  2HQX A;  3PIO A;  3MEU A;  1WFW A;  2LZ6 B;  2BIV A;  5GAO q;  1KD1 R;  2X4X A;  2QQB A;  5GAN 7;  3CCM A;  5L23 A;  1X27 A;  2GFU A;  4J9H A;  4XTU A;  1M90 R;  2HL5 C;  4Y91 A;  1WJS A;  1JRI A;  2RK2 A;  2JN0 A;  5LJ5 h;  2EBP A;  4C0D B;  4LUE A;  3NMZ C;  2L3P A;  3CCR Q;  3GIB A;  1V1C A;  2XDD A;  2ZPG B;  1IHV A;  2KI7 A;  2JTM A;  2EWN A;  2O4X B;  4PJO D;  3VKI A;  1X69 A;  2RI2 A;  1WHG A;  1RAH B;  2HKQ B;  3TEE A;  4J6X A;  3CCS Q;  3OMC A;  1R77 A;  1NZ9 A;  3CC7 T;  3M59 A;  2KRO A;  2E65 A;  4FT2 A;  1QCN A;  2MOX A;  1S72 T;  1LJO A;  3JB9 G;  2DXT A;  4C92 F;  1SRL A;  1Q81 C;  2FYK A;  9ATC B;  2EYQ A;  2A08 A;  1UJY A;  3TSZ A;  1H92 A;  3LWI A;  4UC4 A;  4JRQ A;  3VS5 A;  4X9D A;  1W2B P;  5CKE A;  2OTL Q;  4C92 C;  3LW5 E;  1VQ5 A;  3QYG B;  1VQM T;  1GBQ A;  1TWB A;  3JCM g;  1F1B B;  3JRZ A;  4HCZ A;  1TUD A;  4PJO E;  3CCQ T;  2JS0 A;  4KUL A;  4AFQ C;  3HFN A;  3TCJ A;  2DEU A;  1M2V B;  3H41 A;  3PIP A;  4OB2 B;  4EDU A;  3G4S A;  1PD0 A;  4DA4 A;  1OZ2 A;  3M9Q A;  3EG3 A;  1QVG P;  3G6E Q;  4C8Q A;  4DQ2 A;  2CP0 A;  3S6W A;  1WX6 A;  1XJW B;  3EGD A;  3JCM d;  5GAN j;  1W2B A;  1R8O B;  2KXC A;  4XU3 A;  2XDB A;  3QO3 A;  4RTX A;  4E7S A;  4BAC A;  3HHT B;  1IGQ A;  1GCQ A;  3M55 A;  2OTJ T;  1MNE A;  2CYZ B;  1C6V X;  2DEQ A;  3QBY A;  3HL8 A;  3JCM e;  4XU1 A;  2CP3 A;  4C92 B;  2CZ7 B;  2JW4 A;  2QA4 Q;  4PJN A;  1EFN A;  2M0Y A;  3MEA A;  1UB4 A;  3M0Q A;  3VUB A;  1QVG A;  2EIF A;  4DBQ A;  1NJI R;  2DL3 A;  4FT4 A;  3OS2 A;  1Y96 A;  3FRN A;  1I8F A;  5CCA A;  4KH0 B;  1YWO A;  1VQO A;  2FPE A;  1D1A A;  2E41 A;  3NPF A;  3ZFJ A;  3JCM V;  2L5Q A;  3QWX X;  3VYH B;  3J81 E;  2O01 E;  1PCX A;  2KNB B;  1D3B A;  2QTX A;  2XD0 A;  4DBR A;  2GQI A;  2KRN A;  5I2M A;  1H8K A;  4BI4 A;  4F7U F;  2RHU A;  3MP6 A;  4MML A;  4EMK C;  3RKW A;  2HQE A;  4ZGD B;  1B7T A;  2DAQ A;  4ESR A;  4V2S A;  3WVD B;  2RJE A;  4ELY C;  2LVM A;  2HMA A;  2JZ2 A;  3CC2 Q;  1JB0 E;  4M4Z A;  1I5O B;  1Y07 A;  3FJ5 A;  1WHL A;  5A0L A;  2A28 A;  2ATC B;  3MHX A;  2EVR A;  3HRS A;  4JPB W;  3EG0 A;  1SEM A;  1M1K R;  2PQW A;  3RNJ A;  4N0A C;  2GBQ A;  2R5M A;  1SHG A;  2PTK A;  4EMH A;  1W4S A;  5CR2 A;  2KRS A;  3CCS T;  1MMA A;  1P92 A;  1OZ3 A;  1PKT A;  1PC0 A;  2RQW A;  1G3S A;  2KDS A;  2FL7 A;  5KYU B;  2E12 A;  1MV3 A;  2F5T X;  4BDY A;  1UGS B;  1YP5 A;  4JJN K;  1UHF A;  4PFO A;  2JMC A;  3QKJ A;  5DLQ E;  3E2U A;  1TUC A;  3ZEH A;  2IVW A;  3EHR A;  5GAO p;  2A36 A;  3RKX A;  3BE3 A;  1QVF P;  4J83 A;  3NTH A;  3DLM A;  1VQK A;  2E6Z A;  2RJD A;  4II1 A;  4C5E A;  2LRQ A;  2MIO A;  3WVE B;  2J05 A;  2YLB A;  2J7I A;  2CP7 A;  4MZM A;  3A5Z B;  4O6J A;  2JTE A;  5FRM A;  1VQ9 A;  1YN8 A;  5LJ5 g;  3JSC A;  3OYK A;  4YTL A;  1KIK A;  4ATO A;  3SDZ A;  3X24 B;  1LOJ A;  3DB3 A;  1IB8 A;  4DBF A;  2LNV A;  4M7A F;  1X6B A;  1BK2 A;  1WHH A;  2AHJ B;  4OMO A;  5GAN 5;  1NEB A;  1KC8 U;  3UWN A;  3VS4 A;  3FJP A;  2KYB A;  2RM4 A;  1YBY A;  3OBY A;  1ZA2 B;  4QKU A;  5FRO A;  4C92 D;  1YJN Q;  1ZUY A;  1YWP A;  1HD3 A;  4RTZ A;  5HCK A;  4N4I A;  3OYL A;  3CME A;  1WXU A;  1OPK A;  1SHF A;  3UA7 A;  3NTI A;  2LDM A;  3MPU B;  4M77 F;  1KG1 A;  3OW2 S;  4A4H A;  2BKD N;  2YUQ A;  1VQ4 A;  2QA4 T;  1K9M R;  4ZNX A;  5LJ5 e;  2GQV A;  2GTJ A;  1KD1 U;  2PVO B;  3P8H A;  4KUD K;  2XIC A;  1ZSZ A;  2KEA A;  3OYF A;  2O88 A;  3U23 A;  1D09 B;  4PFP A;  4IUT A;  4AFZ C;  3LGF A;  1M90 U;  2GTO A;  2LQ8 A;  4RTT A;  1IO6 A;  3UF4 A;  2HCK A;  1VQ7 A;  2DXC A;  2VUB A;  3EGU A;  4CC2 A;  3OYJ A;  3C95 A;  2DO3 A;  1PRL C;  1W6X A;  3D7S B;  4OB1 B;  2RH2 A;  3VYG A;  2DL8 A;  1J3T A;  1X75 C;  1KQ2 A;  4XTW A;  2D1X A;  4QQD A;  3DLL A;  1UFF A;  2V1Q A;  1YJ9 Q;  4M7A B;  5FLX E;  1G3W A;  1OX9 A;  4RMO A;  4JRP A;  2IPO B;  2ABL A;  2J6K A;  2EQI A;  1SF9 A;  3H0H A;  4JZ4 A;  4WCI A;  3QUI A;  5GAN 4;  1KHC A;  4D8D A;  3CC2 T;  1RAC B;  2HL3 A;  1Z9Q A;  4C8Q G;  3GBQ A;  4OP0 A;  3G7Z A;  2DJQ A;  2E64 A;  4M78 A;  5LJ3 d;  3CPW P;  3CEY A;  5GMK h;  5FU7 B;  5I2S A;  3UA6 A;  4ANJ A;  3VUZ A;  3WXM B;  4M77 B;  3PMT A;  4BDZ A;  4JS4 A;  1BI2 A;  3M5A A;  3OMG A;  3SWN A;  4PJO C;  1HJD A;  5J26 A;  1YFN A;  3MCA B;  1TUG B;  4LXC A;  2EQU A;  1X2Q A;  4N4G A;  3CCE A;  2DKG A;  3F70 A;  5GAO m;  2PNI A;  4GLK A;  3I55 A;  2FVU A;  4HKE A;  4XTV A;  2ZPF B;  3PT9 A;  4J9C A;  2A3L A;  1M2O A;  4MZP A;  2ZGW A;  1HK9 A;  4FSS A;  2RI3 A;  1WNL A;  3M0R A;  2DLP A;  1YIT A;  4Z02 A;  4E6R A;  1RAA B;  1BKB A;  1TXQ A;  3HTR A;  1VQP Q;  1PSF A;  3GF5 A;  2CP2 A;  3L2U A;  3SD4 A;  2WSC E;  4LUD A;  2PUO B;  2ECZ A;  3CCV A;  4DOW A;  3ME9 A;  2CZ1 B;  3C94 A;  4RCC A;  2QTV A;  5KYY B;  1Q7Y R;  3EHQ A;  2RO0 A;  4KRT A;  4HCB A;  2E3I A;  2YSQ A;  3RBB B;  2RPN A;  2KAF A;  1M3A A;  2DM1 A;  1WI7 A;  1YJW T;  2PU9 B;  5GAM h;  3TU4 K;  4IKF A;  3JCM J;  4MDW A;  2GNC A;  1D1B A;  1HXD A;  2EJF A;  1YJN T;  3OW2 P;  2JMA A;  4JS5 A;  2MMP A;  4KGX B;  3CCU A;  4Y28 E;  2D6F A;  3P8D A;  3PE0 A;  5KYW B;  2QI2 A;  3CC4 A;  1UGR B;  2LQK A;  4M7D A;  4L6V 5;  1OYX A;  3GNF B;  2SRC A;  3OYN A;  4OMQ A;  5FWC A;  4C92 G;  5DLO A;  5DM7 R;  3UAT A;  2FZC B;  3OW2 A;  4M7A D;  1RLQ C;  3E1S A;  4RG2 A;  4KBM B;  5GAN h;  3J80 E;  4R0K A;  5IHI A;  2V1R A;  2KSS A;  2NYS A;  1OPL A;  3PVQ A;  4ZTJ A;  3T9N A;  1M4Z A;  5M9O A;  1BU1 A;  1IRE B;  1UDL A;  2OTJ Q;  5LJ5 f;  2F1L A;  1N8R R;  1I1J A;  2HBW A;  3THK A;  1M1K U;  3A8H B;  3INZ A;  1YJ9 T;  2BTT A;  2RQU A;  4M75 E;  2YRC A;  2LQN A;  2EGA A;  3M54 A;  1IHW A;  2JS2 A;  3M53 A;  4M77 D;  2QQA A;  3MEW A;  3A8O B;  1K1Z A;  1AHJ B;  4K11 A;  1X6O A;  3EH1 A;  1RAG B;  3AHU A;  2B86 A;  2RK1 A;  1VUB A;  3NFC A;  1SKU B;  1SRM A;  3BY7 A;  4CC4 B;  1ZUK A;  1EIF A;  1U8R A;  2HD0 A;  3CBM A;  4M7A E;  4AMC A;  2QQ9 A;  4AFU C;  3P8B B;  3LWH A;  1BI1 A;  4PJJ A;  1QWF A;  4PFZ A;  1Q95 G;  2DYI A;  3ZL7 C;  1M90 C;  5C0M A;  2WAC A;  3JCM c;  5GJW B;  4WF2 A;  4P5N A;  5C6S A;  5GMK m;  1B34 A;  1RUW A;  2OAW A;  1ZQ1 A;  3HKS A;  1PD1 A;  1M5Q 1;  2AK5 A;  1D0Z A;  1VQL Q;  4TVR A;  4Z88 A;  3JB9 I;  3CMA A;  2C06 A;  2LQW A;  4M77 E;  4WTO B;  2MYS A;  4EIK A;  2EJG A;  1VQ5 T;  1K9A A;  4BI3 A;  1VQP T;  1G3T A;  2XID A;  2GF7 A;  4J9D A;  4GBQ A;  1K8A C;  4PNO A;  3OS5 A;  4RCB A;  4E7H A;  2NUT B;  3H0I A;  2ROT A;  1QKW A;  3H9N A;  1LPL A;  2JUF A;  2HEQ A;  5A2Q E;  1ABQ A;  1AVZ C;  2F2X A;  4QW2 A;  4F7U G;  1YIJ Q;  2NLU A;  1FMV A;  1VQ6 A;  1G5V A;  2X4Y A;  3OSV A;  3JCM Q;  4IUR A;  5GAM j;  1VQ8 A;  1QCO A;  2JXB A;  2VAS A;  2YWW A;  2PUK B;  1K9M U;  4M78 G;  2R57 A;  1YHQ Q;  4BE0 A;  4QVD A;  1Y96 B;  1QKX A;  4C5G A;  1AWW A;  1T3S A;  4HVW A;  3EGX B;  3OQ5 A;  1AT1 B;  1Q81 R;  1QVF S;  2DPP B;  5KE3 A;  5IH2 A;  1Y0M A;  2JJ9 A;  1H3Z A;  2XK0 A;  3M0S A;  1G8X A;  2QAS A;  2QEX A;  5D6W A;  2P0K A;  4F04 B;  2XDP A;  3FIF A;  2MCN A;  4OGC A;  5GMK e;  2QDY B;  1VQO T;  2M02 A;  2YRV A;  2LX7 A;  4BB7 A;  1PKS A;  1UGV A;  3OSS C;  4A63 B;  2AKK A;  2L2P A;  2RHY A;  2DD5 A;  3J7A F;  1WHM A;  1N27 A;  1I07 A;  4E2F B;  3CBP A;  2I2L A;  1O9S A;  1TS9 A;  3OYE A;  3X25 B;  3S3M A;  2EGE A;  2EYW A;  4HCC A;  2CT3 A;  1S72 A;  2O4X A;  3OB9 A;  1PG5 B;  3MO8 A;  4A4E A;  1M8V A;  1X6G A;  2IG0 A;  3X28 B;  3E19 A;  5GAM g;  2MWO A;  3VJP A;  3A8M B;  4OMN A;  4JJC A;  2HZY A;  3V7R A;  2QYZ A;  3VS6 A;  3FB9 A;  4ORZ A;  4A4K A;  2DX1 A;  2FHD A;  1B07 A;  2DL5 A;  5IHK A;  1DJ7 B;  3I56 A;  4FM4 B;  1VQM A;  2DNU A;  3EAE A;  1PSE A;  4ELZ C;  4DOV A;  3VS2 A;  3CD6 Q;  3CCQ A;  1KQS P;  2XU8 A;  3JCM b;  2V8K A;  1VQN A;  1M3B A;  5FU6 B;  2K4Y A;  4LE9 A;  3TSW A;  2DTH A;  1JO8 A;  2DRM A;  1HSQ A;  1UHC A;  4X9C A;  4E7L A;  4GLM A;  4M7D G;  3I55 Q;  2KT1 A;  1WHJ A;  2YUO A;  2Z0W A;  3CBO A;  3V7C A;  5GAN g;  1YI2 A;  1R0C B;  1VQL T;  2DXU A;  3M56 A;  3NHN A;  4IUP A;  2RF0 A;  2L0A A;  1M1K C;  1KQS A;  1NLP C;  2R5A A;  1Q7Y U;  2EPD A;  1LNX A;  4J7I A;  4BUG A;  2PZ1 A;  2YUP A;  4DEX A;  2DL4 A;  4A53 A;  5J39 A;  1VQ9 T;  2L3S A;  4J5Y A;  3EFO A;  4RG8 A;  3CCV Q;  4OMF B;  2DK3 A;  2IIM A;  2MWP A;  2JM8 A;  3CPW S;  3RMQ A;  2J06 A;  1YIJ T;  5GAO n;  2BZY A;  4ZTF A;  2EW3 A;  4PJM A;  1WYX A;  8AT1 B;  2GGR A;  5A0G A;  5FRN A;  4RTW A;  3EG2 A;  2KXD A;  4C8Q E;  4C92 A;  5GAN e;  1N9S A;  1PNJ A;  2RHX A;  4M75 F;  1V76 A;  4PJO G;  3V7S A;  1ZSZ B;  1FMW A;  1YHQ T;  4JZ3 A;  2DMO A;  3BDU A;  2VVK A;  4F16 A;  4JRK A;  2KRM A;  2C0T A;  2X4W A;  4FIB A;  4JJB A;  3OYI A;  5IXF A;  3CME T;  3QHS A;  3LGL A;  1BYM A;  5EC7 A;  3A8L B;  2RQV A;  1Q82 R;  2D9T A;  4XTY A;  4M75 C;  1VYT A;  1K73 R;  4RUG A;  2M51 A;  3CPF A;  2COY A;  3HRT A;  3CCR A;  1U06 A;  2DRK A;  3OYC A;  1U3O A;  1GFD A;  5GAN 6;  4BD3 A;  1M1G A;  4AG1 C;  1G3Y A;  2RD1 A;  3OYB A;  5CQX A;  1N8R U;  1MV0 B;  2F2W A;  4B6M A;  1I4K 1;  1YJW Q;  1OEB A;  1BCO A;  1K0X A;  1QVF A;  3DB4 A;  3FC3 A;  1WXT A;  2P0P A;  3CCS A;  1S1N A;  3HP9 A;  5LJ5 d;  1IRX A;  2CUD A;  3H6Z A;  1QLY A;  4M7A C;  5LJ3 j;  1D0X A;  2D0N A;  4PLI A;  1M27 C;  3G71 A;  3C4S A;  4QQ6 A;  4J6Y A;  5HK0 A;  2M0O A;  4FYX B;  1Y7X A;  1K9M C;  5GAO l;  2HSP A;  4R56 A;  2HSE B;  5CKB A;  3OYM A;  1BIA A;  1ARK A;  2D0Q B;  8ATC B;  4M75 B;  2EGC A;  2X51 A;  3CCL Q;  5FU7 C;  2GFA A;  1NPP A;  2LNH B;  2ROL A;  2OTL A;  5KYU A;  1FXX A;  4M77 C;  2MPX C;  4KGV B;  4JJD A;  1HYO A;  1Y71 A;  2RJC A;  3CD6 T;  2CP5 A;  2JNG A;  4OML A;  2DVJ A;  4J9B A;  3RES A;  1K76 A;  4NL2 A;  2KR3 A;  2CT4 A;  1WGS A;  4EMK A;  1U5S A;  1RI0 A;  3OS0 A;  3CCM Q;  3LH5 A;  2P4R A;  4LDY A;  4LD6 A;  3QWY A;  2E5K A;  1D1C A;  3G6E A;  5J3B A;  3PMI A;  2NWM A; 
#chains in the Genus database with same CATH homology
 1M90 R;  3OW2 P;  3CC7 Q;  1Q81 R;  1K8A R;  1KC8 R;  1VQ4 Q;  2OTJ Q;  1N8R R;  1VQ9 Q;  1M1K R;  1YIT Q;  1NJI R;  2QEX Q;  3I56 Q;  1Q7Y R;  3G4S Q;  1YJW Q;  3CCS Q;  1VQM Q;  1K9M R;  3CC4 Q;  1Q82 R;  1S72 Q;  3CMA Q;  1YHQ Q;  1VQO Q;  3CXC P;  3CCM Q;  3CCE Q;  1VQL Q;  1W2B P;  3I55 Q;  1YJN Q;  1VQ5 Q;  1YI2 Q;  3CCR Q;  1VQP Q;  1K73 R;  1KD1 R;  3CCQ Q;  3G71 Q;  3CCV Q;  3CPW P;  3G6E Q;  1QVG P;  2OTL Q;  3CCL Q;  1Q86 R;  1VQ6 Q;  1YIJ Q;  3CCJ Q;  3CD6 Q;  1VQN Q;  1VQK Q;  1JJ2 P;  1YJ9 Q;  3CME Q;  3CC2 Q;  1KQS P;  1QVF P;  3CCU Q;  2QA4 Q;  1VQ8 Q;  1VQ7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...