2PFFB

Structural insights of yeast fatty acid synthase
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
2006
structure length
2006
Chain Sequence
b'MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEGHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fatty acid synthase subunit alpha
publication title Structural Insights of Yeast Fatty Acid Synthase
pubmed doi rcsb
molecule tags Transferase
total genus 233
structure length 2006
sequence length 2006
chains with identical sequence E, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01575 MaoC_dehydratas MaoC like domain
B PF08354 DUF1729 Domain of unknown function (DUF1729)
B PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
B PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis
B PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta
B PF17951 FAS_meander Fatty acid synthase meander beta sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2420 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB01
3.30.70.2430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB05
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2pffB03
3R97A 2PFFB 2G2YA 2QJ3A 4QBUA 2QC3A 3SBMA 2UV8G 3PTWA 5DZ6A 2G2ZA 3RGIA 2VKZG 2HG4A 3IM8A 4RR5A 2C2NA 3HHDA 2G2OA 5CZCA 2G1HA 3QATA 3IM9A 5DZ7A 2VZ9A 2VZ8A 2JFKA 5CZDA 3TQEA 3G87A 3K89A 2QO3A 3HMJG 4RL1A 3H0PA 3EZOA 1MLAA 3HJVA 2JFDA 2H1YA 1NM2A 2CUYA
chains in the Genus database with same CATH superfamily
3R97A 2HURA 1KHVA 2VBXA 3RW6A 3AJ2A 4B3MJ 4RW8B 4YR2A 1SKRA 4BC7A 1QE1B 3OR2A 1FJGF 4F25A 1RWNB 4DR3F 3SSSA 2UU9J 4ZJOA 4UTGA 3G9CA 4H4OA 3Q8QB 1XERA 4I2QB 5CAAA 1TL1A 5B0GA 3BH7B 2RT3A 1KN6A 1B70B 3KLIA 3OQ2A 3KJFB 3EZUA 3TZYA 2HFUA 1HNZF 2J0SD 1I3OB 1NSKL 2AJQA 1GFWB 1Q1KA 3M1VB 1GMVA 3KK1A 2NR0A 3PO5A 4PPDA 3S01A 3UCGA 4WXWA 2M52A 4G65A 3V5RA 1S0OA 1TZ0A 3U1MA 2AWZA 4P2FA 2R2RA 3NG8A 3SDEB 1SKWA 1RT5B 2O1PA 1EKSA 1MW7A 3ICLA 3D5MA 2DPJA 2BEFA 2COLA 4FVMA 4AL7A 2XLKA 3A3NB 1S10A 1XNQJ 3M8ZA 2AYEA 3L7PA 1I1GA 4I64A 1CJVA 2Y8YA 1H98A 1NZAA 1XIQA 1R0AA 1QD1A 3K5NA 2Z4PA 2AX1A 2IA6A 4J9PA 3EPIA 4GMKA 1DLOB 3GIKA 2RF2B 1WEYA 4DX6A 2ZM6J 4DV3J 1TELA 5KT5A 4NLVA 3RBDA 1LKZA 1RHJB 4W92B 2KYXA 4X4TA 5AJ3F 1RWKB 4OHZA 1IM4A 2Y0SD 1CJUA 3I6PA 3DLJA 2CQGA 1PGZA 4NI2A 1VMBA 3VZHA 3LF0A 1SIWB 3CMES 4FF1A 5IOLA 3K5OA 1ZTTA 2HBQB 4ECZA 3I82A 3AA9A 2GVDB 4DR7J 5IWAJ 3TP2A 2PMZD 5HMWA 3MFHA 4DF4A 3N01A 5KT6A 3PZPA 1FJ7A 3MPDA 2R7OA 2ZHBA 3BR8A 3OTEA 2PIIA 4I6WA 4WK1A 2PSZA 1LWCB 3T1AA 4ES1A 1GAOA 3KOAA 2QL5B 4O3NA 1JXVA 4KGMA 1R31A 3ENVA 1RT2B 4LSZB 2E7WA 2MKKA 2NS1B 5C2CA 2L48A 4GO7X 2AJ0A 1O8BA 4KFBB 3W9JA 1FE4A 4P74A 4M5IA 2ZOFA 2V4JA 2D3ZA 5H9EJ 3ZTRA 3V6DB 1YZ6A 3KK3A 1FKOB 4PWDB 1AFIA 2K06A 1J27A 3FUYA 4ZPBA 3KLVA 1UKUA 2DXEA 2EFGA 5J2MB 2ZKTA 4MKVA 2ZJRQ 2J9DA 4LRBA 4DU7A 3PIOQ 3M8SA 3E01A 3JYTA 5L1LA 1FTCA 3DRSB 4H4MA 1GMWA 4C6AA 2MZRA 3T5KA 2DCUB 3KWMA 2OD4A 1UL3A 2F8HA 3MM9A 5CXTA 1XN9A 1HBNA 3PIPQ 4OZLA 1HNIA 1RTHB 1N32J 1L3UA 4CYUA 4GVBA 1RT7A 2DKOB 2DNPA 3D9BA 2Z56B 4NA2A 7AT1B 1UFLA 1V9OA 1XC9A 1FWKA 2MPUA 2W2NP 2ZEJA 2CZ9A 3THVA 5KG4A 5IM0B 3DGPB 3QWPA 2ROPA 4X4QA 2EWHA 3FKBA 4XO0A 2UXDF 2ZBPA 5EWFA 2HQ3A 3SFUA 4ANDA 2I5JA 3O5TB 5LXYA 3MM5B 1IR2A 4J7CA 3EVOA 4DPXA 2J6UA 1WHVA 2VG6A 3CCMS 1WUUA 1S57A 1DARA 1NU4A 3HM9A 1S1UA 4DUZF 2DGSA 2HWHA 5K9FA 3D3CJ 5CYQA 2N4DA 4MK8A 4F0HA 1FD2A 4ZA1A 1T02A 3EYZA 1TK0A 2XEXA 3RGIA 4IO1A 2CQHA 2LFVA 4R8UB 5LSOA 1RXOB 1GTEA 2CQPA 3M2UA 4OYBA 4ELVA 4Y3CA 4U7UK 4WFZA 3VGUA 3QYYA 1O0PA 1RA6A 3P45B 1R43A 5E3QA 3MUTP 1SBRA 4LBPA 1S7HA 4ZVRB 5KFIA 4DX5A 4XDCA 4LSLA 1LFPA 4ES3A 2E7VA 2OTJS 3G86A 1S6QB 5IT0A 4NLOA 3GIIA 4BDPA 2F4VJ 3CC7S 2YY3A 1WJ9A 3UN2A 5DDQC 3UD3P 3MMBA 4RUHA 1HBOA 1Y0HA 3T9NA 3G8SA 4TYBA 1EZZB 3AOBA 1P9YA 5F3TA 3CULA 1REVA 3BV8A 3L9ZA 4PG4A 1Y9OA 6FD1A 1APSA 3CJ0A 2HK3A 3MPUB 1JXEA 1M5VC 2VKZG 2YBVA 2GMJA 1G7CB 3RUBL 2ZH7A 1HNXJ 1HPZA 2QLWA 5F8HA 1VRQC 2OKQA 2DR9A 5FJ4A 2Q43A 1S97A 2HRUA 4AXJA 3L7OA 2JVRA 2XSJA 1HNWF 3V4IB 4LF2A 3QPIA 2CDRB 1SQFA 3CB4A 1UW4A 1SPBP 3OTOJ 2HPUA 4XIUA 1T11A 1FI4A 4O4RA 4UZBA 5ITHA 1QSLA 2M5YA 1JLEA 1IBLJ 4P71A 1HI8A 1KEKA 2FDNA 3A8KA 1NK9A 4Z7CA 1VLYA 2QMUB 2K7KA 4FF3A 3UE2A 2OPPA 2C22A 3T5LA 3M8PA 2GJIA 3D1QA 1H0HB 3GONA 3QLHB 4DV0F 4P52A 2JL9A 3VQTA 3CJ8A 3O3LA 3DI6A 3PRBA 4OI0A 3DLKA 1MROB 4WKRA 3GCWP 5KG2A 2R8GA 2XI3A 3FZ2A 5HROA 4UUWA 4KH1B 2F9JA 2B6AB 1F60B 2IAJB 4ZVUB 4GVLA 4F4WA 1NEEA 4L3NA 3J7Z5 4ZKAA 2G1DA 3MR5A 1VHFA 1HBMA 4USVA 2YKMA 1XQIA 3TVZA 2R7VA 3QGHA 1NRKA 5E3AA 1SJRA 5C5JA 4IFVA 1X9MA 4RW9B 3MOJB 1EQ0A 1TV6A 2R7UA 3FFIB 1RCOB 4F4YA 1RBLA 2XY7A 5T7LB 1UPMB 2NLWA 3UDLA 1QUPA 1TQLA 4RBVA 4Y34A 3JSMB 2Z57B 4TU8A 4LFAF 2V94A 3TQEA 3JQMA 4LSNA 1MMNA 2FLLA 1RYRA 1ZM9A 4K8RA 4MH8A 1TAQA 2V6AA 3TUPA 1T3NA 3DLEB 1W25A 3W60A 4CRJA 4N8NA 4OZ5A 1U1PA 2M88A 2VC1A 5AXMA 4A4JA 3VAMA 2QGFB 2VICA 5KFFA 2MKIA 2WOMB 2I1RA 2X1GA 3GILA 1NMEB 5HJYA 3W2WB 2EFQA 3V4MA 1PC4A 1OIAA 3CPWR 4FPIA 4AT1B 2QG9B 1PKUA 4CO3A 4J9OA 2VBWA 2L9NA 1FVQA 4C0HA 1IKYB 2V2VA 2ZITA 2N82B 3NWRA 4CH7A 5FLXU 1JLCA 2V2KA 2E1MC 2DGVA 4K4VA 4C8KA 2YWFA 4UF4A 1N48A 2G0JA 3ENAA 5GAEI 1IKXB 3PY8A 2F8MA 2E66A 1KQFB 2MTLA 4DX7A 2J9DE 4FN5A 4OX9F 1S9GB 3MEDB 3VCDA 3OFEA 4ZVFA 1B99A 1NZ8A 2C3OA 2DCLA 3DXSX 5A8KB 4DN9A 3ET6A 3AOCA 2R7RA 3EMTA 2RMLA 2XMWA 4OQJA 1AFJA 2FLPA 4CH0S 4P72A 5HLFA 4CLFA 4JI5J 5A8RA 2HHPA 4KGXB 4DN0A 1EETA 4B17A 4MK9A 3ZFVA 2HBRB 3QJJA 1UVJA 1HWLA 4AQYF 4IOBA 2XYHB 1FRHA 3O1LA 3LP0B 4K7QA 3FVYA 4C9DA 1RT6A 2X1FA 3RZAA 1LFWA 1XEZA 3PJ9A 5ADZA 1T03A 4OYZA 4Y00A 2FD2A 3FCVA 5CQGA 2QFJA 1JLBB 4F0MA 3PW0A 1K47A 2IC3A 3D67A 2PMWA 3TA0A 4JI1J 4KYZA 1JWWA 2GFFA 1FKPB 4J9RA 3KLFB 1D8ZA 7FDRA 4L74A 3F56A 2EFPA 1WEZA 3Q89A 1AZSA 2M0GB 3MM8A 2RE1A 1N52B 1VQOS 4W98A 1B7YB 4B3OA 2W2QP 4ZN3A 3THPA 5D4NA 4KE5A 2CPJA 2P2CB 3W3SA 3J7A1 3CD0A 3QZ7A 3LTOA 2V8VA 2UXCJ 1WKLA 2KRRA 3HCXA 4OYIA 3QWUA 3M2VB 4B9NA 1MWYA 1RTJB 3HP6A 4P2MA 5ETSA 1QM9A 5HSPA 4WP3A 1T9UA 2CNLB 3Q83A 2B0GA 5GAGI 1HWUA 3DLGB 2DH7A 4DI6A 3QRPA 3BO3A 4QYZK 1TKZA 2XHCA 4H4KA 1MU2A 2LEAA 4MJKA 4QW9A 3QGGA 2VV5A 1A7GE 3D7SB 3UNGC 3CDEA 2W25A 1RTIB 3W8PA 3I96A 4L6V3 4EUVA 2G2ZA 1RHRB 1D09B 4S0MA 5KFSA 3G6XA 4TYAA 3SZ2A 2BKPA 2Q6CA 4ZPAA 2XI2A 4DV6J 4NZ7A 1C4CA 3G8TA 2PO4A 2P6SA 2DO4A 1REGX 5F8LA 2HNDA 3K7RA 2RDDA 3GTYX 4NMLA 5H9FK 1VK3A 2MSSA 5DG9A 3GWCA 3B8HA 2MKJA 2X7IA 2H65B 1KQGB 2IM3A 5DQHA 3MURP 4QYRA 2D74B 4OZJA 3GIRA 4M5GA 1S0MA 4LRCA 2JNJA 3MEEB 3CCES 2BQUA 2MDAA 1N33F 5EUHA 3GFZA 5H1SV 3GV8B 4WP9A 3R27A 2ZZNA 4YR3A 4MIAA 1GMUA 4RU2A 2C1EB 3EXYA 2ZH8A 3EXCX 2R2TA 4X4VA 3LO3A 4CO1A 4GC7A 2PEBA 4M1KA 3UCZP 4IR9A 3DRRA 2BQRA 2XULA 2H9ZA 4LR9A 1ZAXA 4DV7J 4K5RA 4USMA 2OEMA 2ZBCA 5IT4A 2WVCA 2RRBA 2ZC3A 1ZS6A 4FS2A 2J0XA 4CI0B 2AZ1A 1Q7YT 2MHEA 1KVKA 2HVDA 3OVSA 2GQQA 3IS9B 3VAKA 3SIPB 4JI6J 1RHKB 4FYXB 1HR0J 5GMKa 3MM6B 5KAKA 4OX8A 3CJTA 2W01A 2W7OA 4LR7A 4QIFA 5J2QA 2HBYB 3IRXB 4JYAJ 3DFEA 5F0UA 3D1OA 4I7FB 1Q8KA 4X64F 2MZSA 2APOA 3BDPA 1WC6A 2DHHA 4YEAA 5C2GA 3MAHA 3DNCA 2YNFB 1SB6A 2KT2A 3MCNA 5BXIA 2VOOA 5KFTA 4CNYA 2OSQA 2PI4A 5FD1A 3RRHA 3AD8C 3OTCA 2JC0A 4WU2A 3TA2A 2VQEF 2YH0A 4JV2A 1EAYC 4A8FA 1V3ZA 2W4DA 5CYMB 1JLGA 4RU9A 2M8HA 3MEGB 3ITHA 3QAUA 1X5SA 2HBZB 5LMUF 3G8QA 2Z8QA 4KO0A 3HT0A 2J7WA 4ECXA 1DBDA 3BGFA 4CQ1A 3WC0A 1JJ4A 1DTQA 2VFVA 4WFXA 5KFGA 2V4RA 3UVJA 3CCTA 2OEKA 3IM9A 5BYQA 5HP1A 2HLTA 2F9DA 3AY0A 3DYAA 2CRLA 2L3MA 2VASA 2KVQE 4U8YA 2IVFB 1M5KC 1RWXB 3MMCB 2ABYA 2RQ4A 1RP5A 3QO9B 1E6YB 2XTJP 3PYGA 1KLMA 1U4BA 1VS3A 2B4PA 1CS4A 1DURA 3IC1A 3QZ8A 1U6ZA 2YQ0A 2CWXA 1T3OA 2XMTA 2UUCF 3OV7A 4OHXA 3IBCB 3AB4B 2XZTB 1RWMB 4ZPDA 3HO1A 3D1HA 2M4MA 3OVBA 1LWFA 1RTDB 2KZZA 4NOHA 4PWWA 2UVRA 1SC1B 3D54A 1ZA1B 5ETLA 5H9EK 3IMQJ 4LIWA 4WIIA 1FJEB 4OJHA 3OTBA 3AB2B 2W4CA 4K4UA 5CHCB 4ELUA 4B08A 1RT1A 2OIHA 2IPOB 3AQOA 2C2NA 1UVMA 1QTNB 3POTA 4JP8A 3NNHA 1Q78A 4A48A 1V3SA 1FRMA 2DPIA 2XNQA 2YNHB 2E7XA 4WCEQ 1XMOF 4RPFA 4I6YA 3AXMA 3K17A 2OPSB 4KSEB 3ZZRA 4FF2A 4FNHA 2BJDA 3C6UB 5IZHA 3UD5A 1FD8A 1Q5VA 4HH0A 1AB8A 4YHHF 1HD1A 4MYUA 3BBBA 1KD1T 1H2TZ 1TVRA 4AFFA 2LQ8A 4LF5F 4DR1F 2F40A 2LQ9A 2J9CA 4ES2A 5KFCA 4Y65A 2HHWA 2LMIA 1ZH5A 1YLXA 1Z4UA 3KFWX 1U2FA 3A12A 1HMVA 3TRGA 3M2RA 4ZVEA 3CMAS 3V6KA 4RNFA 4R5PB 4DG1A 2B9YA 5BYSA 4OMFG 2CYYA 1WACA 2F3JA 1F3FA 8RUCA 1S99A 3EWGA 3WZ0A 4ZLJA 2DRBA 1IBMF 1BQNB 4DJBA 2VH7A 3RRGA 4IDKA 4KKOB 1GQEA 1OWXA 4F8RA 1NB7A 2C28A 1WHXA 1BQXA 3SBMA 4CLUA 3KLEB 1RHUB 2CZVC 2OPRA 1I94F 3LP1A 3M6VA 2YX4A 3AJ1A 1FJGJ 1RUSA 4DR3J 3KHHA 3PTWA 3MFIA 2H5IB 2LCWA 1QDUB 1FDNA 1NH7A 4M63A 1JXLA 2NXJA 1SC6A 4FZVA 2WCXA 4A8SA 3SQGB 5JVHQ 1GX5A 2Z30B 3HVTA 2DHSA 3DOKA 3J7YU 3KMQA 4NLDA 1HNZJ 5I42A 3P6YC 1CG2A 2FJVA 2VQFJ 1U2CA 2GMHA 4WPAA 4CDIA 4DV2J 3RR8A 5KFQA 3MI7X 2DIVA 3A4TA 1YK9A 1F5CA 5CYJA 3E2EA 5M2PA 1I51B 3UCUP 1C0TB 1VISA 5C25A 1WEXA 2ASLA 1HYSB 3C8YA 3DLLQ 2IMOA 5D4LA 1C0UB 4DFMA 4WFBQ 1T9WA 4ETXA 2AJ4A 1MWQA 2LU2A 3BSOA 4HDGA 1T8EA 5F8JA 2KXNB 4BHQA 1WOSA 5L1KA 1R27B 1RHMB 3HD2A 2RJZA 4L72B 1S6PA 1YSJA 4MIBA 2FHJA 1CJTB 4LFCF 3HT3A 4HEA9 1D1UA 4X4SA 4AMMA 4LREA 1LNQA 2DRAA 3I0RB 3JAMU 1UJ5A 3CSKA 2Q1LA 2WZ1A 4H4OB 4KHRA 2DEIA 3M8WA 1VGYA 2VOPA 3TAQA 2OELA 1ZAWA 1TL1B 4UOGA 5AJ3J 4J37A 3NCRA 3KLIB 2W9BA 2FVQA 4U8VA 1YVFA 4ZVQB 3ZTPA 2W9AA 2W24A 4IQMA 3AD9C 2CWKA 3K89A 3BF4A 5HAOA 3IBWA 4DR2F 4B9MA 3NKYA 3KK1B 4FP9A 1ZBTA 3ETMA 2C42A 3MXHP 2CKWA 2QX0A 2GJ2A 4AL5A 2XB2D 4DS5A 1FFWB 3D6TB 5AE3A 3IG1A 3MDFA 1AUSL 3WX4A 2UVWA 1YRUA 2HVZA 4PCQA 1EB0A 1UEKA 3GIMA 2AGOA 1KDNA 3OW2R 4KH0B 2ILYA 2HZVA 1CJVB 1X8DA 1HKAA 1UETA 5G0RA 1YJTA 1FJCA 1R0AB 1PJ6A 3V6JA 4LF8F 4WXOA 1TL3A 2HFSA 4I56A 4C98A 4TU9A 4WWSA 5ETKA 3MPWA 4YB1P 2BRLA 3PR5B 3TUIC 4DQIA 1NHKL 3RBZA 3GYXB 1VC6A 2G0IA 3ONQA 3ZNJ1 4J9MA 4DF8A 4OYMA 1C4AA 3G82A 3HHLA 1VLOA 4FYVB 2B51A 2DNRA 5CD4A 3BB5A 1UAWA 2MLYA 4OL8A 3NGSA 2DNZA 1CJUB 4USIA 5ETMA 4G1QA 4CCHA 3DN9A 3ZZYA 1TAUA 2B7BB 4OLPA 4ZITA 2CDQA 3QAEA 3MTKA 2RH3A 3ZTOA 2BE7D 1YJ7A 1X4EA 1JX4A 3OR1A 5A6WA 2ZWOA 5KFBA 4B3TF 1RHQB 2OJ3A 4NCGA 4PYAA 2C3YA 1VC5A 1G1XA 4JI3F 1HBUA 1PAEX 5DJBA 3QMQA 1QAJA 2RS2A 1GXLA 3MAAA 5GADI 5GAHI 1HHQA 4RNNA 1LK7A 5GMDA 2UXDJ 4JI2J 3HULA 4EBEA 5LMNJ 2XMMA 5L46A 5KFRA 5I3PA 3TJAA 2V4JB 5K8NA 4K0KF 1YRXA 3KK3B 5HJXA 2LQ5A 4USKA 2RHQB 1VHIA 5IC4B 4DSKA 2K3IA 3H42A 2KH9A 2ATCB 3QGPA 3BH6B 1V3RA 1HQ2A 3DU5A 1HARA 1H2UX 4M5NA 2RKIA 1YGYA 2Q3PA 5M2RA 3RTVA 2RQCA 2ZVSA 3VGTA 1U1KA 2J9EA 3R9LA 3MPYA 1FK9A 5KOXA 1D0EA 3E01B 1ZZFA 2HVEA 3H2LA 2DEJA 4H4MB 3JTPA 3RAQA 4YB7A 2KRBA 5EWEA 3MM9B 3MR2A 1XMBA 1HBNB 2J76E 3F44A 2MYFA 1HNIB 2NSCA 3DDNA 1XBWA 1S9FA 2GVZA 1M5SA 4CYUB 4GVBB 2YKNA 3TOQA 1Q53A 1RT7B 1RWOB 4C8NA 1P9QC 1M0SA 1PJ7A 2QLXA 3I5BA 3M9MB 2ZHOA 2YH1A 1B64A 4OI2A 4OZ0A 2W2PP 3I4HX 1S7IA 3KJVB 2DISA 3Q2SC 3HHEA 2XS5A 1EP4A 2H51B 1S59A 1F9FA 4NRUA 1TR0A 1FDBA 4L3KA 2DR7A 2K3KA 3KLGA 4LVOP 3K57A 2VJUA 3TA1A 2POKA 2I5JB 3A1YG 1UP1A 2DHXA 5LM7E 2KJVA 2VG7A 3E51A 2IDEA 4DQSA 2VG6B 1FFSB 5LXRA 4ED5A 1S1UB 1PIEA 4X84A 4DL2A 2AW0A 1ZTWA 3EZ5A 3HMJG 5CA5A 2KG1A 5CYQB 2ZZMA 3HD1A 1KVJA 4ED1A 2ZNZA 1FCAA 4CO4A 2WVBA 2BMBA 2LA6A 1VQNS 3P8BB 1VRTB 2KKHA 3UWTA 1HNWJ 3RG6A 1T9XA 4DZ6A 1Y5NB 4ZJQA 1YDLA 2QLBB 1NK5A 3PO4A 2NZCA 1WC3A 2CVIA 3M2UB 4F50A 3H8YA 5L9NA 5A2QU 4DXLA 3W62A 1DTTA 3M30A 1P8GA 3MR7A 4OHYA 3DLHA 2EFOA 4UW2A 1N34F 4C4WA 4RNHA 3J81Y 2L08A 3TUZC 4M5DA 4EBDA 4ZP7A 5CZXA 3AHPA 1YRTA 2LXUA 4EK2A 2JJ4D 1EKRA 2N4CA 4DV0J 1TKTA 1GK8A 4AD6A 3MMBB 2BE9B 1HBOB 4P2SA 5HMYA 3DMJA 1CLFA 2V5HG 3M32A 4ZHRA 3PFEA 1NJZA 1KVIA 5CD4H 1JIHA 2ASDA 3QQCD 4F7VA 4KV8A 5HL7Q 4AL6A 2FPHX 4MKAA 2HYIB 2LECA 3CD5A 2B8PA 2W2OP 2IRUA 1J5OA 1VQ9S 3KUEA 1HPZB 3IBFB 4ZMMA 2Q6BA 1XTZA 2E1PA 3QFHA 3JS9A 4DLGA 1NK4A 2CNKB 2XSJB 2BACA 2DNOA 3Q8RB 2HQIA 4LFAJ 2F1FA 2AJ2A 2ZWPA 1JLEB 4DQPA 4IG3A 2A2CA 4Q8EA 2VZ9A 3N28A 5I3UA 3DXBA 2U1AA 3H7HB 3T41A 1A6LA 2DGXA 3KK2A 2OPPB 1IBKJ 2LDYA 2L41A 3IR7B 1DY3A 2QMXA 1U49A 4V1Ak 1UA1A 1KQSR 2X3DA 4EYHB 3DI6B 2PA3A 2YWWA 2VPWB 3V2UC 2FVSA 3R5AA 5C24A 3DLKB 4NCAA 4FNIA 1N5YA 3KG0A 4HI1A 2G13A 2AEFA 5HROB 4FKXA 3LP2A 2R8JA 1HBMB 2YKMB 4OX9J 5M2UA 2B43A 3R7NB 2KDOA 4DSLA 4IFVB 4IFYA 2LXIA 3W5ZA 4MIWA 1TV6B 4HT5A 2D41A 4YP3A 3CJ2A 1D8YA 4BS2A 3TJ8A 4C8ZA 3HZGA 2IBOA 4NXMF 3SXLA 3H5XA 3MTJA 1S1VA 3MWBA 4O3QA 4LSNB 4AQYJ 1NPKA 1VQ5S 1X5OA 4DSEA 3JXOA 2VG5A 3F41A 3TNVA 4Z2XA 3MUMP 4NRTA 1Q0NA 2WSEC 5HI7A 3H98A 3MD1A 1HIYA 5BJRA 1FF2A 2V67A 5D78A 2B7CB 2EK1A 1YJUA 2R8KA 3JQKA 1WG5A 2HQFA 4K5SA 1KONA 5K20B 1G6BA 4BBYA 5HQLA 4PG8A 4RUAA 1WC5A 4EWTA 1EARA 2QSFA 1XJWB 2HK2A 1VFJA 2QC3A 4DWIA 2XC9A 2HG4A 1B7FA 2LVWA 2NXUA 2RF2A 5T14A 4X4UA 1JLCB 4C3KA 1X5TA 4P6QA 4G1IA 5B0FA 1X4BA 4TKTA 3PHEA 2O01C 4HI2A 1RAIB 1KRPA 2A2DA 3C15A 2V4QA 2FGOA 3FRZA 1WI8A 3MM7B 1RAHB 4QWCA 2EC2A 5GADU 1RADB 1NO8A 2DO0A 4ZN1A 4F36A 5DQGA 2MZQA 5KTQA 1URRA 3ET6B 2GJFA 3I5AA 1L3SA 1WF0A 4QR1A 5ETVA 2WBRA 2N7YA 4ECVA 3TAMA 5HLFB 3CWJA 4FXVA 1EETB 5KFNA 1R8PA 5D8HB 1NCLA 1S77D 1P27B 5LOQA 1DJ0A 3IGVA 5HQMA 2Y1JA 1GXUA 1WDDA 4KT0C 3QSYB 1RT6B 3PNIA 2EI5A 4I2PA 4KY3A 2UXBF 3FEZA 1T03B 1FKAF 3MCMA 1SV5B 1UTAA 1VQ7S 4RW6B 2IC3B 1RT2A 1HL6A 2CQDA 3DHWC 3SYZA 3NS7B 3N4WA 1DAXA 1B0TA 2N7CA 2VKRA 3EM1A 5D0EA 4PKDB 2KG0A 4B9SA 2FZCB 1TL4A 3BN7A 4CWBA 5IFMA 3M9OB 4PWDA 3MM8B 3R5GA 4B3OB 2I2YA 4Q45A 5JUMA 2JFDA 1ACMB 5J2MA 3C6TA 5KG0A 1Q86T 4J9QA 3D6FB 1TK8A 2XMVA 1VQYA 1YTYA 1BQMA 3UR0A 3M8QB 4O3RA 2MJUA 4XTTA 2JLFA 1UW9A 4E2FB 1EQMA 2AF6A 3KNGA 3PX6A 1HQUA 1TKZB 1MU2B 4JUZA 1RTHA 1TUGB 3RBXA 2B9WA 2VD3A 1NPRA 1RU1A 3CW2C 2FY8A 2HGLA 1S0VA 1CQNA 4E8UA 4W90B 3UDEA 3SV4A 3C2PA 2LEPA 2KO1A 1OQ6A 1FT8A 1R3NA 3PJXA 2F7VA 1HI0P 2HNDB 3VVTA 1HNVA 1MN7A 2OGUA 2BJ8A 2ZHAA 2JEGA 3GB0A 5A0YB 3LGHA 2BM1A 1FA0A 1QJHA 4X64J 3OL8A 2OFHX 5A8WA 3Q8PB 3ILIA 1VQ4S 2W7PA 2AZ3A 3SQOP 2FY1A 2XY6A 1E6VA 5AXKA 3EGVA 4ECWA 1M90T 3T6BA 2ROEA 1U48A 4NLUA 5SZTA 2EBEA 3GFXA 1SVDA 3GYGA 1YJRA 3MMJA 4B3SF 1S76D 5DS7A 3ZZOA 2BR0A 3FBEA 3DRRB 4B9VA 2K8GA 3LPEA 2HGMA 1X4HA 2X1BA 2BE2A 1H7WA 3TX0A 2QYCA 3KG1A 2C2RA 4HLBA 3M05A 2FLNA 4N56A 3IWXA 4LIRA 5LMUJ 4PWUA 2XO7A 1RAJA 3W1YC 3IO1A 2M3DA 4CLKA 4J5OA 1N0VC 3D0IE 4R25A 4ZCLA 3OLBA 2R9LA 3L95X 2HNYA 2ZKUA 4A47A 2V63A 1RI7A 2W8KA 5J2QB 5EX3A 4DFPA 1C1CA 2VFTA 1L5UA 3C3LA 1RZMA 4YR0A 1Y10A 3NEKA 3R7SB 1FDDA 1SJ4P 3SV3A 4N7TA 2GA7A 4NYOA 4ZVSB 2JH3A 2AEMA 3T1YF 5SUHA 1OY6A 2UUCJ 3HF5A 3NGRA 2XMUA 2R7WA 4PG7A 4B3RF 2XYPB 3JSBA 3C14A 4H4KC 2PD1A 1CJKA 2IA0A 1RAEB 3S7RA 2BV3A 2CJBA 4OZ2A 2NXNA 4WFAQ 5DM6Q 3R5BA 5J2PB 1UFKA 2PFFB 3VWSA 2IM2A 2PEHA 3PW2A 2ADBA 4HYKA 3HFZB 3OBIA 4U96A 2O5DA 5B0AA 4JI7J 4PR6A 2WONA 2WVEA 5E7OB 4QZVB 4WFYA 2E5JA 4MK7A 3K2YA 1SC4B 2HRTA 4KGKA 4KO0B 4F3MA 1A0OB 3OSNA 2G1HA 1O51A 1S48A 3GG0A 5DLGA 2XLIA 3DU6A 2LP4A 1PC5A 4JI8F 2DNNA 4HVZA 1DTQB 1XMOJ 4QQBA 2GCFA 3UVJB 2V9KA 5HP1B 2B4VA 5B0BA 3DYAB 2F4VF 5IT9U 5DM7Q 1KFDA 1QY7A 4WTOB 2KM8B 2CADA 4RW4A 1RQ0A 2CJXB 3JTNA 1CS4B 3FRYA 2XWYA 4RNOA 3BREA 3M4XA 5AXNA 4ZLPA 4CLSA 1U0HA 4YQWA 2IAJA 4GC6A 5KT4A 3RBEA 3PYFA 3WC2A 1W2IA 1RWVB 4ZK7M 4WKYA 1D3WA 2C2EA 1XMQF 5AE1A 5HN0A 4RW9A 4RJVA 1V5VA 1T9TA 1LWFB 4O23A 5J1PA 1PYSB 4NMXA 1HNXF 2BXJA 2GX8A 4DCJB 1KTVA 3HSDA 1IBMJ 1OSDA 4DL7A 3HJVA 2B5JA 4DL0C 4V19X 5L8RC 4NYPA 4OV1A 2D1CA 4H54A 3JSMA 1LXJA 1RT1B 3DM2A 3CCLS 1BMQB 4KR0B 3POTB 1F2GA 3HHKA 1IBLF 3DOLA 4ECTA 1QSYA 2BRKA 2R7TA 4Y2KA 1YJNS 5A2QY 1ZYQA 1X0FA 2OSRA 4JV5F 2ZBQA 4JV1A 9RUBA 5KFHA 2KVIA 1NSAA 3KXDA 3L3CA 4HH1A 3CJKA 1U1LA 2YKOA 2MKYA 2NUHA 2MJNA 4Z7YA 1RACB 2HS3A 2QMWA 3EVWA 1UVLA 1CULA 2D9OA 5E2QA 2XBPA 3T1HF 2HWTA 1RE1B 5IQ6A 1TVRB 4DUTA 1M5HA 2A3JA 1XNRF 3ETOA 4B02A 4IRKA 5A76A 2RU3A 3Q2TC 5B09A 4OFZA 3OFFA 2HEKA 4DG1B 2GIFA 1T94A 2MY8A 1N6QA 3LGNA 3TX8A 2CQ1A 1HD0A 3T5HA 5LSRA 3NOCA 4C97A 5EX0A 4RLEA 2YKAA 4BC9A 3W2VA 3GSIA 4IDKB 3N79A 1NJIT 1WORA 2WB4A 1HHTP 2HIQA 4WTYA 4LFCJ 2OPRB 2DBBA 2DY1A 4IOCQ 3NMAA 4DCOB 2GIRA 3LP1B 5D15A 2KM8C 3J7AN 2MMYA 2D9PA 4L73A 2BM0A 4F2SA 4QCLA 1WSRA 2QL9B 2V2QA 2NREA 4OX7A 5D4PA 2FC8A 1UJ4A 4C8MA 4ECYA 1P1LA 2J0WA 1C1BB 4IR1A 2BOAA 1QLNA 5B08A 4X62J 1FKPA 1YJWS 1XR6A 3HVTB 4CIOA 2VPZB 1V6HA 3DOKB 5I42B 3CC4S 3RAMA 2YQ1A 2BANB 2YQ3A 1X4FA 4DR2J 1UPPA 2OEJA 2MKCA 1K44A 3QRQA 1BE4A 4N8OA 1R7IA 3K5LA 3M8YA 3PR4A 1NK0A 4TY8A 1MMDA 3TW0A 2AX0A 3KDNA 1VK8A 4JI0J 3N5BA 2A10A 3NOGA 1FRLA 3BGUA 5C25B 3N6LA 2WAQD 5L1IA 4BWJA 2UV8A 1F9HA 3OT9A 3W66A 3KLHA 4DFJA 1RLCL 3D68A 4J9UE 3MHYA 4Y28C 1NKCA 2K1RA 1H3DA 3TARA 5KG1A 3C16A 1S6OA 3K58A 3OXGA 4LF8J 2ZDPA 4KAIA 5KFLA 2B4UA 3ISNC 3TAPA 1YBUA 4YOEA 2MSTA 2NYHA 3Q8SB 1NHVA 4LF9F 3TJ9A 5F9NA 4J9SA 1U1QA 1HI1A 4L75A 4Q2LA 4TVAB 1NB2A 3FK4A 2OFGX 3KDOA 3SSQA 1FWLA 2XZWA 2RB7A 2KFNA 2W9BB 2NCKL 3B54A 3F0NA 2BJ9A 2XSFA 3DCAA 3RAXA 1OPZA 3FCHA 3I9V9 3HVWA 5ETRA 1T9VA 1KHWA 2YX1A 1UWAA 5F8MA 3W5XA 2D7SA 4QWEA 3RB4A 4B3TJ 2QIFA 2CFXA 1EHWA 2J8AA 4WYWA 1PSDA 2HZAA 4JI3J 1FRXA 2QRRA 5F9LA 2VA2A 1NH8A 4UOHA 4GKJF 2YNGA 2RHSB 4CZCA 2AYGA 2XHWA 1QSSA 3FSXA 1FXDA 1HA1A 2FGCA 2CNOB 5G0RB 4K4WA 3HKWA 2D3O1 2ACYA 1WHWA 2I38A 1CC7A 1TL3B 3J80Y 2HHTA 3PX0A 2PA8D 1UWBA 4XK8C 4DR6F 4K0KJ 1F2HA 1PCAA 5KFZA 2ZZTA 4QR2A 4HR2A 1FERA 1H7XA 4DS4A 5LSLA 4LQ3A 1XR7A 3G82B 2XMJA 3HHLB 5AXLA 2ZDOA 1SUQA 2HZCA 3OXLA 3BGLA 3UO0A 2F65A 4CLYA 3K0JA 2HQCA 2G2OA 3BPSP 4F26A 2DNGA 5KFDA 1TMJA 4RWXA 1VIXA 4KJIA 4LF6F 4G1QB 2YNFA 2R7SA 1RT3A 4EEYA 1AROP 4ETZA 2OMLA 5DG7A 3T19A 5K14B 1IKVA 1YZ7A 2EK6A 2W2MP 3D66A 2PFDA 1F0XA 5HMXA 3HJFA 2DVIA 1LWEA 4DPOA 1SJQA 3OR1B 3QSIA 4BWMA 2I6WA 2K7JA 4NCGB 2QE5A 2WTFA 1MSWD 3KJNB 2DNMA 2ZFHA 1H73A 1R8HA 3KTQA 4DZDA 3HFKA 2GW8A 2M70A 1HBUB 5F0WA 4JBCA 1HWIA 3AODA 4USJC 2W7AA 1ZA2B 3EZOA 4C8LA 2NYIA 3M7VA 4I67A 4KC5A 3PVXA 4AMPA 2XYGB 3MAAB 3H4DA 4O3PA 3PG9A 3Q8UA 2EKYA 1CC8A 2IM1A 1TL5A 3IGNA 3QT8A 2IMWP 3LANA 3H0PA 3RJMB 2B9EA 3HFVA 3G4SS 1DQ8A 4NLRA 1YBAA 3A8EA 3NY0A 2LYVA 3U02A 3PKMA 1JLAA 3AJDA 2IVYA 2BZ2A 3AT1B 1U2RA 4HACA 3G71S 3HKZD 2CPYA 1R89A 2VDHA 2ZD1A 3PW5A 1U47A 1WTBA 2RKIB 5A6PA 3HX9A 3NXZA 1P6TA 1S1WA 2EPIA 1YKWA 2V2ZA 3BQ2A 3ADAC 3CDUA 3LGMA 1FK9B 3PV8A 3VGSA 2H4YB 1K73T 1FFGB 1VOMA 3QJLA 1JB0C 1O5JA 4GO5X 1GMWD 4Y2MA 4LVNP 3RB6A 5KFOA 2NZ4A 2GVZB 5THWA 2YKNB 1UA0A 2QV6A 4RZRA 1RGVA 3ZZZA 3NAIA 4DUYF 4IG0A 2AV5A 4CLWA 3BGRA 3Q0AA 3MEKA 3HHLC 3ISZA 4OV6A 1EP4B 4ILRA 1QAYA 2EC0A 4EFAC 1IWAA 5HK4A 5IS2A 4CO5A 4ZPCA 3KLGB 3EUNA 1S72S 1U8WA 2UUWA 2V9WA 1MMLA 3R5DA 1ICEB 4MTPA 5I4MA 3QFWA 4URSA 2Z2YB 1SH2A 4ED2A 1CQMA 3FQLA 4ZPTR 2H54B 2AP6A 2ALZA 4ECQA 2VC0A 4LBIA 1B0PA 2C2OB 3QIDA 2HAFA 2E1RA 1RJJA 2GC8A 1RK8A 4V19J 3HLUA 4C8OA 3HSGA 2D3UA 5D3GA 2HIYA 3GU0A 3MGJA 1X4DA 4DL6A 2BJ7A 2C3MA 1NJYA 4ZCMA 2BYCA 1DTTB 3M30B 3MOZA 2XCPA 4X4RA 4ZS6A 4ECUA 4O3SA 4DR4F 2VPYB 4M5DB 3PYEA 3BQ0A 3DLBA 1FNMA 1JLFA 3RU0A 4RW7A 2SXLA 3W5YA 2FUG9 4C0BA 4OZ3A 2P9CA 4N47A 3CIZA 5IC6B 1TKTB 1YIJS 2IM0A 1VQ8S 4UQTA 1R8CA 2MGZB 5T41A 3J7YI 2GAGC 4DPUA 3L09A 3DMJB 4FXWA 3M32B 4ZHRB 2BW7A 3R8YA 3IWLA 2LLZA 4GRSA 3PX4A 4IUFA 3D3BJ 4UQGA 2QT7A 4Z37A 4ALZA 3GJTB 3SQGA 2FZKB 1MWZA 5CABA 2LA4A 4QYZJ 3GSDA 2Y1IA 1J5OB 5IT9Y 5J1NA 1ELOA 4QWBA 2O66A 4I6AA 2C2DA 4KQZA 4C11A 1FNOA 3BKFA 4NXMJ 2OLWA 3WIVA 3CIMA 2FC9A 2MZTA 1W7WA 3CUNA 1N5SA 4QR0A 4GKKF 1X31C 5HBMA 2Z2MA 2XCAA 3VAFA 2CG4A 2GO8A 1WI6A 3PEJA 1HYSA 4TY9A 4IG3B 3MPVA 4CH1A 3DRPA 1JJCB 3LH2S 4NLTA 3FJ2A 7FD1A 2Y1RI 4Q43A 4JB8B 2PGCA 1GXTA 2ACMA 2OP5A 4WFNQ 2LDIA 1VR6A 2CVEA 3KK2B 1H38A 4QU7A 2MZ1A 1OS5A 1CPZA 3NNAA 1S1XA 2OI2A 2IJFA 1WF1A 5L38A 1S9EB 1FO1A 1X7VA 2B56A 4UOFA 4ILMA 2F4FA 4DSFA 4FF4A 1SCJB 1M1GA 3R2DJ 3OD2A 1SKSA 2GHWA 2QTWA 5C24B 3I0RA 3C19A 1N5YB 4NXNF 2X51A 3ZTSA 3GP9A 4NLYA 1SL1A 4P9SA 2E44A 3OHAA 2E5IA 2VPXB 2MQMA 1T7PA 3GV7B 4YUDA 4WE1A 3LP2B 1WHYA 1RWPB 4NLSA 2GS8A 4BLGA 4C2MA 3C66A 4TNOA 2HFVA 5AE2A 4NWBA 3SCJE 2EVZA 4N41A 4IFYB 2HHHF 4ZPWR 1TKXA 3O44A 4AE5A 2VQFF 2CQBA 2N3OA 4K4ZA 2A6MA 4DV2F 3X1LB 4B9UA 2VIHA 1BXNA 4ANCA 1RT4A 3R5CA 3VAIA 1S1VB 5HMZA 4O4GA 1RA7A 3W9IA 4CLLA 3LUYA 3IAS9 4URGA 2RRAA 2VHGA 3PACA 2VG5B 1FHTA 2MB0B 3J81U 2OMOA 4NPOA 3A3PB 4NLWA 3FMBA 2UXBJ 2BJ1A 4YY3F 4OJ3A 3BQ1A 4DV5J 1M5OC 3NBPB 5K8MA 1NBEB 3VF0B 2XZDB 3OVAA 2V8PA 1SC3B 1Y11A 2AHOB 2JX2A 1YX2A 3H59A 4QPXA 2MQNA 5HVFA 4EZ6A 4ID5A 1DFDA 1YI2S 3GYNA 1PYTA 2E5LF 5DLFA 4TLRA 3I55S 2AKWB 4NE9C 3C15B 3KHLA 2UUAF 2P6TA 1ZM2A 1OY9A 2RDIA 3VVUA 1UVKA 2AIRB 4E0DA 3HZEA 3JQJA 4G3IA 3H2VE 1WOPA 4HHUA 3TWZA 4IQXA 3E3XA 2W4PA 2ZUAA 1KR4A 5J1EA 2CJ9A 5E41A 3MMAB 3CDWA 1VYAA 1VBXA 2CJYB 1F5BA 3SI8A 3TAMB 4HKQA 2PMHA 2W1BA 2MQQA 2HFNA 5DO2A 3CCQS 3OSPA 1O6XA 2FYXA 3OL9A 2V50A 2W9CA 2WW8A 1Q8BA 4G6VB 3R1LA 2MQPA 1TP7A 4I2PB 3OJUA 2VFUA 3D4JA 4A8XA 2R8HA 2DNLA 4OYPA 5HATA 4C0OC 3PW7A 4IH7A 3OPKA 1UCNA 4W4MA 2HS4A 3BGOP 4TQSA 3IAM9 2EKNA 3K8VA 4I69A 4YS2A 1IKWA 3O6QA 1RWWB 4F02A 3M6UA 2HMIA 3WIUA 2I9SA 4HDHA 3CC2S 2YX7A 2KL8A 1VJQA 2LU1A 1JLQA 1K9MT 1VQSA 3M9NB 1F1BB 1FEEA 2XM3A 2O67A 3C6TB 5L9XA 4X65F 1BQMB 1FE0A 1VIOA 2BJEA 2IHR1 4B3SJ 3CVKA 2UUBJ 4LF7F 2EEYA 4F4XA 1QVGR 4K2JA 2Y9HA 1XK8A 5F3ZA 5D0GA 4C3LA 4PZVA 3WDOA 2XS2A 1NJWA 2KXFA 3HSJA 1J5EF 1HQUB 3LQVA 3HDSA 3ZZPA 3UFCX 1L3TA 2IDLA 1NAQA 3P4UB 5KG7A 3BPDA 4DV4F 4URQU 2VDIA 3IXQA 1KOOA 1HQEA 1NLKL 3KJVA 4XDDA 1HW8A 5KFAA 1UVIA 1HNVB 4LFBF 1UZHA 4YB6A 2ZH4A 4AMNA 4DPWA 1RWUA 1U45A 2YWHA 4JI2F 2QJ3A 2XMAA 3KG4A 5LMNF 4Q0BB 1LXNA 1YBTA 3IM8A 4UY85 1AW0A 1RISA 3CJ5A 1PYOB 5A8WB 2BA9A 2HGNA 3T1YJ 2VODA 4ILLA 2BDPA 2HFOA 5MLCV 1WG1A 3IRWP 4C3MA 2WRMA 3GR0A 2AD9A 4B3RJ 1KP6A 4LBHA 2G4BA 3QIPA 1JKHA 3FMWA 1E6VB 1SXLA 3FEYB 1L3KA 3FBFA 1S5ZA 3FDSA 2G0CA 2B4OA 4LRAA 5LJ5Y 1UZDA 2H5EA 1VRTA 4EO8A 1TUWA 3R7BB 2M9KA 4OHWA 3VZIA 3LOUA 2R42A 3HPOA 2E9TA 2RUSA 2BE2B 2HKEA 2MLZA 2CPIA 4NZ0A 2ZVIA 4DSIA 2BVZA 4C48A 1LW0A 2RILA 1LOUA 4EMDA 4OIXA 4JI8J 1U7LA 4PXDA 1IQZA 4DPTA 2IFXA 2HNYB 4J90A 1R0BG 1C1CB 2HNZA 2V69A 1SQGA 4TQRA 3PEHA 3LPYA 3BSNA 1KBRA 2QN6B 5CZCA 2ZH9A 4ZCIA 3KMSA 2R2UA 2MKSA 2MXYA 2PI5A 3OR2B 4NLQA 1XMQJ 1NHUA 1ZZNA 4MT1A 3BKUA 3C14B 1TL7A 4ED3A 2CQIA 1CJKB 3CCUS 1Y7PA 3FBBA 2VBZA 3ENWA 4ZVPB 4ZP6A 2P9GA 4CP5A 3AOAA 1GEHA 3P3DA 3K5MA 3OUYA 4O44A 4RBUA 1U8SA 1J2VA 5KFMA 1N0UA 2XS7A 3QJPA 4KRWA 3CTRA 2E9RX 4PRFA 1FVSA 2WONB 1YQHA 1UFWA 2MQLA 3BR9A 2DHAA 4WU3A 2FJBB 4KHPF 2DGOA 2EW9A 5KG5A 4JV5J 3CD7A 4NLPA 4KB7A 2DNHA 4QW8A 4IOAQ 4FBTA 4WBFA 4F3QA 1IVZA 3QGIA 3QATA 4F4ZA 2EG1A 3B4MA 5DZ7A 1NDPA 1FNXH 3CO9A 3BSCA 4KHMA 3T1HJ 1MLAA 4RW4B 1U02A 1H72C 5KT2A 2J0QD 1DHMA 1N88A 4QWAA 2A0FB 2KU7A 2YNIA 4FXDA 2XWXA 1KS2A 4HTIA 1U0HB 1XNRJ 2B3TB 3RRKA 3MECA 5JXSA 4Q44A 1K0TA 3NGUA 2CPHA 1VC0A 1SL0A 3SCKE 3SFGA 1TUVA 4LMZA 1RABB 3ILJA 2IRYA 2B8QA 4RNMA 4X66F 4TXSA 3I5CA 1KC8T 4U7UD 1RLDA 1AA1B 2Y1LB 1RBOB 2BQ3A 3ZC4A 4EU0A 4N76A 5EN1A 5IV3A 2B5JB 2XGPA 2JSXA 4NI2B 5KFKA 3ZZ0A 2WB1D 4DV1F 3EX7B 4CTAA 4G1PA 3B82A 3DM2B 1NK8A 4ANEA 3L4BC 5E3PA 3TEHB 1BHNA 5FDLA 4RBTA 4EBCA 3CCWA 3CJ4A 4OX6A 2ZOGA 1VCTA 1PAUB 5GVQA 3DOLB 2G9OA 5CCMA 3IR5B 2D3OR 1U6FA 3TVYA 2OH2A 2KFYA 4LF1A 5DDPC 1TMMA 2N3LA 1IQTA 3FZBA 1IBKF 4FVCA 4I0WA 2AT1B 2ZUGA 3CJKB 3PRVA 2GGPA 5B0CA 2HW3A 2A6OA 1FESA 3HHNB 4PUOA 1CULB 4A8WA 3OFGA 4J9NA 4JOUA 3H25A 1VRUA 2LXFA 3CEDA 1K8AT 4USUA 4Q7AA 3ISND 1HWJA 1QTMA 5FIIA 2E9ZA 2WSCC 5BYRA 2CPDA 1U0SA 3CD6S 2F63A 2FVRA 3NAHA 3Q23A 4JI4F 3KNAA 1IM6A 2GZOA 3NWGA 4MKBA 3MM7A 2DD8S 1Y3KA 2WBMA 2ASJA 1Y00A 5LL6d 2ATLA 3CCVS 4BCAA 2QA4G 2VA3A 3LAKA 4C8YA 1ZM4A 4DUZJ 3WHIA 3SCLE 1N6QB 3D0GE 5BR8F 1VBKA 2X3GA 4F04B 3H40A 4PQUA 1BWVA 1V5IB 3QT7A 3LWLA 4PG6A 5RUBA 3I0SA 2DIUA 2AMCB 3W2VB 4AUKA 3JSRA 1N5TA 1VQMS 1VQKS 3ILOA 2OPQA 3JYTB 1T05A 3H20A 2HHXA 1FX4A 1N56A 1RAOA 2UVUA 3BSAA 1WD6A 2XQCA 1WC1A 2KHDA 8AT1B 4RUCA 3CJQA 4LF9J 1OO0B 4X4PA 1SV5A 1S1TA 4RW6A 2IY5B 4PAAA 2ZE2A 1EX8A 2LQJA 2HHVA 4RX6A 3A13A 4MFBA 4AYBD 3TZXA 2J6TA 1CSJA 4OI1A 1JMTA 3KHRA 3GV5B 4DR5F 3G6VA 4Q5VA 2DRDA 2V8DA 2MKHA 2CNNB 4B9TA 4ER8A 4MMOA 3DHXA 2XG8A 1F6TA 5DRKA 3OLAA 3GIJA 5MAOA 1YITS 5C42A 2RQMA 3W8GA 1IBCB 3I4PA 4RO0A 4KGVB 4TY8B 2JZ5A 3Q86A 2A1BA 4ECRA 5D77A 3CXCR 3M8QA 3W9HA 2Q79A 1JNZB 3THTA 3KLHB 3CCZA 3OXFA 4GKJJ 1AYEA 2RSQA 2YXLA 4UOCA 2K1RB 2IRXA 3PRDA 2VFSA 4LT6A 1GTHA 1HFEL 3C16B 3H90A 5EHHA 1YG0A 4U9RA 5CCLA 1C2PA 1OMSA 4Y6IA 3FSIA 2GQCA 4UY8T 4U95A 1FEHA 2YWKA 1NDKA 3O8WA 3UDCA 2FHJD 2YWEA 3GJSB 3ZZUA 4HHJA 4DR6J 3VAJA 3MCSA 3V81A 1JJHA 2CJQA 2I8EA 3RB3A 1IXKA 3NCQA 4K4YA 4M5HA 3I87A 3PW4A 3PM9A 4LSLB 1WSVA 4NEYA 5J2NA 5D0RA 3W7BA 4ZDNA 5A0YA 1NSPA 1PILA 4QWDA 2NSBA 3NLCA 4DDFA 3T5JA 3K59A 4N5SA 4LF6J 2AEJA 3FGVA 5C7PA 3KKFA 3AA8A 1FWPA 4ZLNA 3EDRB 1U6BA 3ELHA 2WHOA 1REVB 4PABA 2CIMA 3MD3A 1TU0B 4USTA 2XLJA 2M7SA 2CPFA 5HANA 2J6SA 3DGVA 4DOZA 1R6YA 1RKIA 1FRKA 4LF4F 2HSEB 2R8IA 2NQPA 1S0NA 2YNGB 3C46A 4CT8A 3U1NA 2ILZA 3DRXA 5B0DA 1NK7A 2HAIA 3DOMA 1VBZA 3BM7A 1SJFA 1GH8A 4A8KA 3FQKA 1WNEA 5IXUA 1LW2A 3Q22A 2YPZA 4AXIA 5JJBA 4ED6A 4M94A 2K2PA 2CQCA 1UWBB 3TZWA 2DGTA 1RBAA 3ZXWA 4IKAA 1QAXA 4ICLA 3EJMA 4HT7A 1Y4ZB 1AUDA 2YTCA 2VUGA 1SUQB 3M8PB 3Q8VA 4U67Q 4MYTA 2OUGA 3HHLD 3GFYA 4J9VA 1URNA 2I0XA 4ENOA 4RW8A 1KQKA 4HL9A 4OHVA 1RT3B 3HXMA 1QE1A 4F67A 1OJ4A 1IKVB 4X4NA 3TI0A 3W61A 2CQ4A 2DB1A 2E5GA 3R5JB 1WWHA 4FDFA 4I2QA 3R6GB 1ZPVA 1YJVA 2FVPA 2VB6A 1LWEB 4RUBA 2L9WA 3MZIA 4RL1A 3TUJC 1FTRA 4EI2A 3W65A 4FYYB 3D6MB 3FSYA 4KGZB 3S1TA 3J81j 3OFHA 1SKUB 5J2PA 4TLQA 3Q8YA 1AXQA 4A8MP 4OZNA 2H1YA 4DUYJ 3MUVP 4DQQA 3M1VA 1S49A 3FBCA 4DPYA 2DGUA 2XMKA 5E33A 3NCPA 1ZPWX 3GCXP 2HHUA 4IH6A 3SDEA 1RT5A 1W2BR 2NXEA 5KFVA 5ETQA 3D28A 3J7ZT 3GR1A 1IR1A 4MAKA 3H4BA 1JLAB 5KOWA 2QLJB 1HW9A 3JB9k 4HACB 3CMQA 4LUBA 1N36F 3RYLA 2ZD1B 2AGQA 1YHQS 4OYAA 3N6NA 6FDRA 4PXEA 1S1WB 1Q16B 4B3MF 1X9SA 2AYBA 3PYDA 1DLOA 2IVMA 2UU9F 5CZDA 2DXFA 2QA4S 1SH0A 1JQGA 1HWKA 3BO2A 2MLXA 4ZP9A 4DFKA 1SL2A 1RAAB 4IYQA 3T3FA 1OPIA 4EYIB 3SCIE 4DR4J 1Y5IB 6AT1B 2C2ZB 1U25A 1VJWA 4QIWD 3IN5A 2Q66A 5KFUA 2FLOA 2WVFA 1QUVA 1T95A 4IG0B 2HLUA 4JI7F 3JSYA 5GAEU 3BGRB 4ID8A 2W8LA 2FB0A 4CT9A 4D3HA 2GVDA 5A8RB 2OTLS 3R6LB 2FJAB 1BLUA 3J80U 2PC6A 1PBUA 3IFEA 3H2UB 1Y3JA 2ZH5A 1EJ7L 3GQCA 4PEOA 3TO8A 1H74A 4IRCA 1LWCA 5B7WA 1XNQF 3BBFA 4DEZA 1YJ9S 2Y0BB 1RTZA 2UZAA 4CO0A 3PDNA 4NASA 1WTFA 4QIVA 3RR7A 1EIYB 2DH9A 1IR0A 2KHCA 2V34A 4A8OA 1R8BA 2MY7A 4KFBA 2KT3A 3NRBA 2H48B 2G2YA 1I5OB 3T6JA 1NPPA 1WDTA 3NS6A 2ERRA 3V6DA 2KI2A 5D3GB 1AZSB 1FKOA 2C2KB 2DNKA 4GKKJ 2ZM6F 4DV3F 1N33J 4K4XA 4P7VA 4EO6A 2FHMA 1KKHA 3MR6A 2CQ0A 1ZM3A 3QBCA 1BD6A 1G4CA 2JEFA 4J9KA 5ETPA 1DQ9A 4Y2AA 2RD5C 1JLFB 1TFWA 5G4DA 4RW7B 1VBYA 3DRSA 3RW7A 2QYGA 1ZAVA 1LK5A 2M8DB 3CO0P 4DR7F 4PQAA 4DBQA 5IWAF 1Q8LA 2KFZA 3G96A 4NXNJ 3I9ZA 8ATCB 2F5GA 3W63A 3BZQA 3N6MA 4A8QA 1PBAA 3DC2A 3EVMA 3LAMA 3CCRS 1C1BA 4P7TA 2XY5A 5GAGU 1UJ6A 1SJ1A 5IM0A 3DGPA 2RDJA 3PKYA 2HHHJ 4NLXA 2XO6A 4QIGA 2BANA 3DDIA 2U2FA 4PXBA 3PJWA 2FIUA 2QLFB 1SI9A 4N77A 2ALYB 4C11B 2CA9A 5DGBA 5D4OA 3MM5A 2V8GA 5U47A 4DHVA 2HWIA 3P5TL 4Y2IA 4NCBA 2RUGA 2ZBRA 1PG5B 5HBMB 4U6PA 3LWMA 2VL1A 5KFPA 3U1LA 2HVIA 3DRPB 4IH5A 4YY3J 1F9EB 4X2BA 2VQEJ 5ETNA 4NL5A 3PXGa 5ETTA 4NA3A 2PDAA 1S1XB 3QNWB 4R8UA 1U1NA 2PE8A 3A8IA 4E98A 2GHVC 2VBYA 2GO9A 1IUJA 1BWEA 2NXCA 4IRDA 4QOTA 1N32F 3E8OA 3Q24A 4YN3B 1U1MA 2E5LJ 5E0OA 1DRZA 2DT9A 3R1HA 2GMLA 4WE1B 2E1CA 2JOQA 3IR6B 1GX6A 1S6QA 2UUAJ 1CBKA 4ERDA 1P1TA 2WVDA 4X62F 3BO4A 3K8WA 1TKXB 4ZJLA 4CM2A 3EGZA 3F73A 1OQ3A 5IV4A 3HK2A 1N5QA 1Q8IA 1UEVA 2MHNA 3D6HB 1RT4B 2HQGA 5F8GA 1IJFB 5FLXY 1NNDA 1K0VA 4I1TA 1H2VZ 4RR5A 5DDOC 2Y8WA 4O4GB 5D6GA 1AT1B 1IN0A 3QT6A 2FJEB 2QZ8A 3DKDA 3BEGB 1DQAA 4JI0F 1R8AA 2JEJA 4RWWA 1MN9A 5L39A 3BDEA 4KBIA 1TKDA 1OY8A 2DR6A 3EE3A 1WF2A 5ETOA 2Y3YA 2RS8A 4PG5A 4NEZA 2P5VA 4F4KA 3V4IA 3I56S 4HHHA 4OJ1A 2YKPA 5HVHA 5K8OA 1JLGB 4EGLA 2AJ1A 4UUXA 2J7UA 3CE8A 3ITHB 4ID5B 2FJWA 2AJFE 1RB0A 1X4GA 4DL3A 3OL7A 3OL6A 2L9DA 3KHGA 4FBUA 2D69A 2YPYA 3IP0A 3MAQA 5I3QA 3I32A 1TK5A 2R4FA 4X65J 3QLHA 2DGWA 4ED0A 3RB0A 2ZC4A 1VQPS 2VONA 4YHHJ 3AH6A 4LF7J 3H5YA 2VF3A 1KLMB 1MROA 1MNEA 5K14A 5LT5A 5J1EB 4DLEA 5DETA 1KTQA 2IJNA 1TFYA 4LF5J 2MZJA 4DR1J 2BOPA 4QBUA 4JV0A 2JC1A 1VI7A 2B6AA 1OYDA 5EGYA 2MQ8A 1J5EJ 1KWMA 4DQRA 4CNZA 1Z2LA 1Q82T 1R6VA 2KB2A 5CH7B 2YKQA 2J7KA 4K59A 2BBEA 2W9CB 4DV4J 5E3RA 3FFIA 4P73A 2P9EA 5T7LA 2KZMA 4WYLA 2KJWA 3BJYA 5KFWA 5GMEA 2AQ4A 4PPZA 1UMJA 4ZVOB 1RU2A 4LFBJ 2RNEA 2HQDA 2DNYA 3GZ7A 4XPEA 4FYWB 2RU9A 4J91A 1GT8A 3OTOF 1I94J 1IKWB 3KJQB 1SIZA 3OJSA 2ZBIA 3DLEA 4Y2CA 1S4EA 3EPGA 2RIJA 2B9XA 1NSQA 5HQ8A 3VQSA 1BUXA 2HMIB 4WK3A 1BGXT 1X4CA 2EG2A 3P5BP 4FS1A 1M1HA 3GPAA 1JLQB 2WOMA 3CF5Q 3UD4P 4ZIWA 2BABA 1BC6A 3W2WA 2EFVA 3GMGA 1F3VA 4ZCKA 2CAJA 1IJEB 5E5NA 4P2XA 2CPXA 1IKYA 2RQKA 3AFGA 3CJRA 2WK4A 2OHDA 5HVGA 3R2CJ 4LQ9A 4QPTA 3GFHA 3ZTQA 3GLJA 4UT4A 1IKXA 5EDWA 1B0VA 1WOOA 4UZCA 4NLGA 1ZOTA 4M8LA 3GE9A 1HMVB 1N8RT 3M2RB 1S9GA 2FHKA 2CJAA 3MEDA 2DH8A 4ECSA 5D0HA 3CNQP 3IA0A 3M6WA 5A8KA 1FRIA 2FQQB 3N0VA 1D9FA 4F3OA 1HQEB 3AXKA 5F8IA 4Q2MA 4QJVA 4QU6A 3UNYA 2DXDA 2DNQA 1LQ9A 1UEUA 3B6BA 2XGQA 2FVCA 2CZ4A 2R3VA 3G2XA 3CDAA 4NZ6A 2HHQA 3BBCA 3ULHA 1HHSA 1Q81T 1RDRA 1Z1ZA 3LP0A 3V6HA 1VDHA 1UVNA 2AGPA 3KYLA 1S6UA 1SJ3P 1DZ5A 1CEZA 1JLBA 4TU7A 2CQ3A 4USHA 3QIPB 1JKHB 3NGDA 3UDVA 3N9UC 2HS0A 1U1RA 3M6XA 4DX8H 4OI4A 4F0KA 1RSCA 3EICA 3KLFA 3CCSS 3U7JA 3W64A 2UUTA 3FEXB 3ZO7A 4USWA 3EGWB 1Q7LB 3NMRA 4J9LA 2R2SA 4ZVGA 2C3PA 3AAWB 4ITSA 4CLZA 4LRDA 2VJVA 3AD7C 1JK9B 2IYGA 5F8NA 4FKYA 2LKZA 2FZGB 4XAKA 3OHBA 2KN4A 2UP1A 4KHPJ 1U09A 5EWGA 4PXCA 2Z2ZA 1LW0B 1FDAA 4ED7A 4EZ9A 4OYOA 1H6KX 1I6JA 3M2VA 2NPFA 1RTJA 2JLEA 4ZOSA 1PJ5A 4NA1A 1S12A 4WF9Q 1Q4RA 4U7CA 4ZLLA 2JHEA 2HHSA 1WC4A 1NK6A 4KTQA 3DLGA 2JEIA 4JI5F 2MGZA 2QA1A 2HNZB 2JDJA 1NXIA 2ZJPQ 1S6PB 1RTIA 3PFOA 1BY9A 1NJXA 3A3OB 3VV2B 2ASYA 4OLOA 2Z2LA 3N5FA 2ZJQQ 2ZNYA 1Q95G 1NKBA 5KT3A 3S8SA 4K2XA 4X66J 3OTDA 1TL7B 4KIAA 4OJGA 3BYRA 2KTQA 1L3VA 4JI1F 1R0CB 2MQOA 4DMZA 3CJSA 3TEGA 3VALA 3KUGA 2IIHA 2GAHC 3G87A 4DV1J 5B0EA 3OUYB 4O44B 5KT7A 1RKJA 1NM2A 1HLWA 3MEEA 2O3DA 3VGVA 3QRRA 2DK2A 4K4SA 1LWXA 3WQPA 3BS9A 5JMNA 4K4TA 3SEOA 2FTRA 1JJ2R 1RAGB 1WC0A 2QFIA 5K8PA 1TTHB 2EXUA 2IYIA 5KG3A 1FRJA 3AQPA 1NUEA 1B4SA 3CCJS 2UXCF 4A46A 2WSFC 1KFSA 1T9YA 1D9AA 3VR1A 3H5SA 3IG1B 5F41A 1S9EA 2CPZA 2Z58B 4HTJA 2QO3A 4ED4A 3I31A 4LRFA 3JTOA 4YMEA 4O0IA 4AMOA 2CXEA 2P8IA 4TN2A 3UQSA 3HI9A 2AU0A 5HO4A 2YNIB 3P49B 2UV8G 2EBGA 2CUYA 3IS9A 4JI4J 2RRNA 2X1AA 4F4AA 3MECB 4DV6F 1FXLA 3MM6A 4NX9A 2LEBA 1Q79A 3B4DA 2JVOA 2OAUA 2BX6A 2C3UA 3IRXA 3D2WA 5BR8J 2V8HA 4M5MA 1NKEA 2BKNA 1Z2ZA 4I7FA 3GJRB 4M95A 4M5KA 5JVGQ 2ZH6A 1IWGA 4ZVTB 5L1JA 3UI3A 1D9DA 3ILLA 4CTAB 2HVHA 2BKOA 2DY9A 3S6EA 4RKUC 3X3UA 5FDLB 1MG7A 3CDBA 1GNKA 1X0PA 1RCXB 1Q5YA 4K50A 1YWXA 2H3EB 2FHOB 1B3TA 1QAIA 4Y0FA 3US5A 3TQ1A 5E3CA 1S79A 2CG8A 1OYEA 2LQBA 3NBPA 3MCOA 2CJKA 2DHGA 3P96A 4F2RA 2KT5A 5CYMA 2V0NA 4DCPB 3LW5C 2GGPB 4QIEA 3MEGA 2KXHA 4DV7F 4OI3A 4DU8A 1VQLS 4OZ1A 4PUOB 2OD6A 2H5JB 4DR5J 4XPCA 1VRUB 4L76A 2DGQA 1T0TV 3TZZA 3EDQB 4ELTA 3CJ3A 5K5MA 4KPYA 2PT0A 2DJWA 1G3OA 3ZZTA 4JI6F 2V68A 1HR0F 3UR3C 3LA0A 1WKJA 4ZIVA 3MMCA 4MKYA 2RVJA 3H5UA 1KOHA 3QO9A 5GAHU 1E6YA 2H4WB 2QEXS 4JYAF 3CGIA 2ZH3A 3MMAA 4DL5A 4PQUB 3ENQA 4Q8FA 5KFEA 1N4LA 3I0SB 4YFUA 3PHTA 4O3OA 3G6YA 5IQQA 3D0HE 4B9LA 2OPQB 4WZQA 1T05B 2C2MB 2IBKA 1ITPA 4ZPVR 4M5LA 2F8EX 3KUHA 2GNKA 4CM0A 1N54B 1RTDA 2VZ8A 4DSJA 4M5JA 2DYAA 2ZOMA 3HSZA 4OI6A 3VTIA 4ATNA 1N34J 4DV5F 1PO6A 3TANA 1S1TB 4C7QA 2ZE2B 4NYZA 3O2IA 2E29A 3GJQB 4MFBB 3K5PA 2HFZA 3BYPA 5LJ3Y 3HVAA 1QVFR 1XWLA 3MF5A 3G6ES 4PYDA 1WELA 1S4FA 1U26A 2NUUG 3MR3A 3WX8A 1WKKA 2E1AA 2CQ2A 4FYDA 2BUNA 3JAMY 5CZVA 2R7QA 2YNHA 5C42B 2MEWA 3ZNUA 4CO2A 4FPRA 1X60A 3NL0A 5DQIA 2QA2A 1Y5LB 2RAQA 2GQ2A 4X4OA 1NDLA 2VG7B 1RYSA 2OPSA 4I68A 4DL4A 1CVJA 4KPCA 5DGAA 3C6UA 1X9WA 3TVKA 1VQ6S 2OO4A 2BW2A 2CPEA 5DZ6A 4LF4J 3NNCA 2IJRA 3M8RA 2QL7B 2DR8A 4OYWA 4P10A 1W26A 3QT5A 4P75A 3HVRA 5KFXA 4R5PA 1M5PC 2AYMA 1KLNA 3UN3A 4YB5A 3SMZA 4LR8A 4O0NA 5DG8A 1SQEA 1KSPA 4R0EA 2M2BA 1LV5A 3V81B 2UVVA 4R0JA 4WP8A 1BQNA 3NGTA 3UN5A 5J2NB 4KKOA 3B78A 2JRSA 2J8SA 5KFJA 4D3GA 4OYXA 2FJDB 3KLEA 4IO9Q 1X4AA 4Q0BA 9ATCB 4I4BA 2Z0GA 4WJBA 1A9NB 3IWNC 1U24A 2YWGA 3BKTA 2ADCA 1N5VA 3UPFA 1F5AA 2HRYA 3VAGA 3NS5A 4ZP8A 1ZETA 2WW4A 3R3TA 2A18A 2FJXA 4LJMA 3PCOB 2ROGA 1JNRB 4ZVHA 3VHQA 3LALA 1NDCA 2DITA 3FNNA 4KV8B 1K1SA 3FC9A 4YDXA 4YDDB 1FXRA 3GG1A 1G2EA 3TR5A 2UUBF 2R7XA 2VU5A 2JLGA 2ZH1A 3UW1A 3HHDA 3DRYA 3EGNA 2YVSA 2E5HA 1K1QA 2NPIA 1ROFA 3DOMB 2J5AA 1WG4A 1ULRA 1KNZA 2EFNA 3T9ZA 1FX2A 4CLTA 2JWNA 3WBZA 2PN6A 5KG6A 1LEOA 3NGKA 2GIQA 1LW2B 2KYZA 2GV1A 1C0TA 4A8YA 1RAFB 5H9FJ 4WIQA 1SH3A 2GHPA 1C0UA 2BJ3A 3A8JA 5I3UB 4WZMA 3DDKA 2VFRA 4CLPA 4ICLB 3U27A 1X5PA 3VAHA 2ZH2A 1XR5A 5AT1B 1M1KT 4ED8A 1U1OA 3CT9A 3NP5A 2JFKA 1N36J 3SSRA 5DDRC 2DR5A 2XNRA 3TYTA 1OSCA 3FCWA 3L7UA 2QSWA 1CJTA 2DTJA 3BN4A 5KFYA
chains in the Genus database with same CATH topology
3KLIB 2W9BA 1LW2A 2FVQA 3R97A 2J8AA 3Q22A 4WYWA 1KHVA 2VBXA 3RW6A 1PSDA 4AXIA 5JJBA 3AJ2A 1YVFA 4RW8B 4ED6A 4YR2A 4M94A 2K2PA 1FRXA 2CQCA 1UWBB 2DGTA 2W9AA 2W24A 2QRRA 4BC7A 5F9LA 1SKRA 1QE1B 4IQMA 3OR2A 1FJGF 2VA2A 4F25A 1NH8A 4IKAA 1QAXA 3K89A 4ICLA 4GKJF 4DR3F 3BF4A 3SSSA 2YNGA 4HT7A 3G9CA 1Y4ZB 3IBWA 4H4OA 2AYGA 4CZCA 3Q8QB 4DR2F 4B9MA 1XERA 4I2QB 3NKYA 3KK1B 2XHWA 4FP9A 1AUDA 1ZBTA 2YTCA 1QSSA 3FSXA 2VUGA 2C42A 3MXHP 1TL1A 1FXDA 1HA1A 1SUQB 3M8PB 2FGCA 5B0GA 4U67Q 4MYTA 2CKWA 5G0RB 2GJ2A 4AL5A 4K4WA 2XB2D 4DS5A 3HHLD 2RT3A 3GFYA 3HKWA 1KN6A 3KLIA 1URNA 2I0XA 3OQ2A 2ACYA 1WHWA 3EZUA 2I38A 1CC7A 1TL3B 5AE3A 4RW8A 1KQKA 4HL9A 3J80Y 1HNZF 2J0SD 2HHTA 3IG1A 4OHVA 3MDFA 3PX0A 2PA8D 1RT3B 1UWBA 4XK8C 3HXMA 4DR6F 3WX4A 2UVWA 1QE1A 4F67A 2AJQA 1YRUA 2HVZA 4PCQA 1Q1KA 1IKVB 4X4NA 3GIMA 3TI0A 5KFZA 2AGOA 2CQ4A 4QR2A 2DB1A 2E5GA 3OW2R 3M1VB 1FERA 1WWHA 1H7XA 4DS4A 4I2QA 5LSLA 1ZPVA 1YJVA 3KK1A 4LQ3A 1XR7A 2FVPA 2VB6A 1LWEB 2XMJA 3HHLB 2NR0A 2ILYA 2L9WA 3MZIA 2ZDOA 5AXLA 3TUJC 3PO5A 4RL1A 1FTRA 1SUQA 1X8DA 4PPDA 3S01A 3UCGA 4WXWA 2M52A 2HZCA 1UETA 5G0RA 1YJTA 3BGLA 3FSYA 3OXLA 3V5RA 1FJCA 1R0AB 1S0OA 3K0JA 1TZ0A 3S1TA 4F26A 3U1MA 2G2OA 2AWZA 2R2RA 2DNGA 3OFHA 3V6JA 4LF8F 5KFDA 4RWXA 3NG8A 4WXOA 1VIXA 4KJIA 1TL3A 4I56A 4C98A 3SDEB 4TU9A 5J2PA 1SKWA 1RT5B 4LF6F 2O1PA 4TLQA 4G1QB 2YNFA 3MPWA 2R7SA 1AXQA 1RT3A 4A8MP 4EEYA 1AROP 4YB1P 1MW7A 3ICLA 4ETZA 3D5MA 4OZNA 2BRLA 2H1YA 2OMLA 3PR5B 3TUIC 3MUVP 5DG7A 2DPJA 3T19A 4DQIA 5K14B 4DQQA 1IKVA 2COLA 2EK6A 3GYXB 4FVMA 4AL7A 1VC6A 1F0XA 2XLKA 3ONQA 5HMXA 4J9MA 1S10A 3HJFA 3M1VA 2DVIA 2AYEA 4DF8A 3L7PA 1C4AA 1I1GA 1S49A 1LWEA 3HHLA 4I64A 2B51A 2DNRA 4DPOA 1SJQA 2DGUA 1H98A 2XMKA 5E33A 3BB5A 1NZAA 3OR1B 1R0AA 4BWMA 1UAWA 3NCPA 4OL8A 1ZPWX 2K7JA 2DNZA 3K5NA 4NCGB 4USIA 2QE5A 2WTFA 2HHUA 1MSWD 4IH6A 3SDEA 1RT5A 2DNMA 2ZFHA 2Z4PA 4G1QA 1W2BR 2AX1A 5KFVA 4CCHA 3DN9A 2IA6A 3ZZYA 3D28A 3J7ZT 1TAUA 4J9PA 1R8HA 3KTQA 2B7BB 3GR1A 3HFKA 2GW8A 4OLPA 2M70A 1HBUB 3EPIA 5F0WA 4GMKA 1DLOB 2CDQA 1HWIA 3QAEA 4JBCA 4MAKA 3MTKA 3GIKA 2RF2B 4USJC 2W7AA 2RH3A 1WEYA 3H4BA 1JLAB 4C8LA 3EZOA 5KOWA 2NYIA 4I67A 4KC5A 1HW9A 3JB9k 5KT5A 4NLVA 3RBDA 1LKZA 3PVXA 1X4EA 3H4DA 4O3PA 4LUBA 1N36F 3RYLA 1JX4A 3OR1A 4W92B 2KYXA 2ZD1B 4X4TA 5AJ3F 2AGQA 4OHZA 5A6WA 2EKYA 1CC8A 2IM1A 5KFBA 1IM4A 1TL5A 3IGNA 1YHQS 4B3TF 2OJ3A 2Y0SD 2IMWP 4NCGA 3N6NA 3LANA 6FDRA 3I6PA 4PXEA 3DLJA 3H0PA 2C3YA 1S1WB 2CQGA 1PGZA 1VC5A 1Q16B 4B3MF 1G1XA 4JI3F 1VMBA 1X9SA 3G4SS 1DQ8A 4NLRA 2AYBA 3VZHA 1HBUA 1YBAA 3A8EA 1DLOA 2IVMA 3LF0A 5DJBA 1SIWB 2LYVA 3QMQA 3U02A 2UU9F 3CMES 4FF1A 3PKMA 3K5OA 1JLAA 1ZTTA 1QAJA 2RS2A 4ECZA 5CZDA 2IVYA 2BZ2A 1GXLA 3I82A 2QA4S 1U2RA 3AA9A 1SH0A 3G71S 1HWKA 3HKZD 2CPYA 3BO2A 1R89A 5GADI 4ZP9A 5GAHI 4DFKA 1SL2A 3TP2A 4RNNA 2ZD1A 1LK7A 2PMZD 3PW5A 1U47A 4IYQA 3T3FA 1WTBA 1OPIA 4EYIB 4EBEA 3SCIE 2RKIB 5HMWA 5A6PA 3MFHA 4DF4A 3HX9A 1P6TA 2XMMA 3N01A 1S1WA 5KFRA 1Y5IB 5KT6A 2EPIA 3PZPA 5I3PA 3BQ2A 1FJ7A 2V4JB 1U25A 1VJWA 2R7OA 4QIWD 3IN5A 5K8NA 2ZHBA 2Q66A 5KFUA 4K0KF 2FLOA 1YRXA 1QUVA 3BR8A 3CDUA 2PIIA 3LGMA 3OTEA 2PSZA 4I6WA 4WK1A 1FK9B 1LWCB 3T1AA 1T95A 3PV8A 3KK3B 4ES1A 1GAOA 3KOAA 4IG0B 2HLUA 2LQ5A 4JI7F 4O3NA 1K73T 3JSYA 5GAEU 3BGRB 2K3IA 4ID8A 1VOMA 4DSKA 4KGMA 2W8LA 2KH9A 1R31A 2FB0A 4CT9A 3ENVA 1RT2B 3QJLA 1JB0C 4D3HA 1O5JA 5A8RB 4GO5X 3QGPA 1V3RA 3DU5A 4Y2MA 2E7WA 4LVNP 2OTLS 2MKKA 2NS1B 3RB6A 2FJAB 1BLUA 2L48A 2PC6A 4GO7X 5KFOA 2AJ0A 1HARA 1H2UX 2NZ4A 5THWA 2RKIA 1O8BA 1YGYA 3IFEA 2Q3PA 4KFBB 5M2RA 3H2UB 3RTVA 2YKNB 1FE4A 1Y3JA 2ZH5A 1UA0A 2RQCA 2QV6A 2ZVSA 4RZRA 3GQCA 1U1KA 1RGVA 2J9EA 2ZOFA 2V4JA 3TO8A 2D3ZA 5H9EJ 3V6DB 3MPYA 3ZZZA 4IRCA 1FK9A 3NAIA 1LWCA 4DUYF 5KOXA 3KK3A 1D0EA 3E01B 4IG0A 1FKOB 1ZZFA 5B7WA 4PWDB 1AFIA 3H2LA 2AV5A 4H4MB 3JTPA 1XNQF 3BGRA 4DEZA 1YJ9S 3Q0AA 3MEKA 3HHLC 3RAQA 2UZAA 4YB7A 2KRBA 3ISZA 4ZPBA 5EWEA 4CO0A 3MM9B 3PDNA 1EP4B 4ILRA 1WTFA 1QAYA 3KLVA 1UKUA 3MR2A 1XMBA 2EC0A 2EFGA 4QIVA 4EFAC 3RR7A 1HBNB 2J76E 3F44A 5J2MB 2ZKTA 2MYFA 1HNIB 2ZJRQ 2DH9A 2NSCA 5IS2A 3DDNA 1XBWA 4CO5A 1S9FA 1IR0A 2KHCA 4ZPCA 4A8OA 1R8BA 2MY7A 3EUNA 4KFBA 1M5SA 3KLGB 1S72S 2KT3A 2YKNA 3TOQA 2UUWA 1Q53A 1RT7B 3NRBA 2J9DA 2G2YA 4C8NA 1P9QC 2V9WA 1M0SA 1MMLA 3T6JA 3NS6A 2ERRA 3PIOQ 2QLXA 3I5BA 3R5DA 3M9MB 4MTPA 2ZHOA 5I4MA 3M8SA 2KI2A 3V6DA 5D3GB 2YH1A 1B64A 4OI2A 4OZ0A 4URSA 3I4HX 1SH2A 3E01A 4ED2A 1CQMA 1FKOA 3JYTA 3KJVB 5L1LA 3FQLA 2DISA 3Q2SC 4ZPTR 1FTCA 2DNKA 3DRSB 3HHEA 4H4MA 3T5KA 2MZRA 2ZM6F 2DCUB 4DV3F 2XS5A 2AP6A 2ALZA 3KWMA 4K4XA 4ECQA 2OD4A 4P7VA 1UL3A 2F8HA 4EO6A 2FHMA 3MM9A 2VC0A 1EP4A 5CXTA 1XN9A 1F9FA 1HBNA 1B0PA 4NRUA 3QIDA 1TR0A 3PIPQ 1FDBA 2E1RA 4OZLA 1HNIA 1RTHB 1RJJA 3MR6A 2DR7A 2CQ0A 2K3KA 1ZM3A 2GC8A 3KLGA 4LVOP 1L3UA 1RK8A 3K57A 1RT7A 2DNPA 3TA1A 2POKA 4V19J 1BD6A 2I5JB 3A1YG 3HLUA 4NA2A 1UP1A 2JEFA 4C8OA 2DHXA 4J9KA 1UFLA 2D3UA 1DQ9A 1V9OA 4Y2AA 1XC9A 2RD5C 5D3GA 2KJVA 1JLFB 2MPUA 3MGJA 1TFWA 5G4DA 4RW7B 2VG7A 1VBYA 1X4DA 3E51A 3DRSA 4DQSA 3RW7A 2VG6B 3THVA 5KG4A 5IM0B 5LXRA 4DL6A 3QWPA 1ZAVA 1LK5A 4ED5A 2ROPA 2C3MA 1NJYA 2M8DB 1S1UB 4ZCMA 4X4QA 4DR7F 4X84A 4PQAA 4DL2A 2AW0A 2BYCA 1ZTWA 4DBQA 5IWAF 2EWHA 3HMJG 3EZ5A 5CA5A 1DTTB 1Q8LA 3M30B 2KG1A 4XO0A 2KFZA 2UXDF 5CYQB 3G96A 2ZZMA 3I9ZA 3MOZA 5EWFA 2XCPA 4X4RA 4ZS6A 2HQ3A 4ECUA 1KVJA 4ED1A 2ZNZA 3SFUA 1FCAA 4O3SA 3BZQA 2I5JA 4CO4A 4DR4F 3N6MA 2VPYB 2LA6A 3O5TB 4A8QA 4M5DB 1VQNS 3DC2A 1VRTB 3MM5B 2KKHA 3UWTA 5LXYA 3BQ0A 3LAMA 3CCRS 1C1BA 4P7TA 3DLBA 1FNMA 2XY5A 1JLFA 1Y5NB 3RU0A 4RW7A 2SXLA 5GAGU 1UJ6A 1SJ1A 1NK5A 2FUG9 2J6UA 4C0BA 3PO4A 1WHVA 2VG6A 3CCMS 5IM0A 3DGPA 2P9CA 2CVIA 4N47A 3CIZA 1DARA 1NU4A 3M2UB 3HM9A 2RDJA 1TKTB 4F50A 3PKYA 1YIJS 2IM0A 1S1UA 3H8YA 1VQ8S 4NLXA 4UQTA 5L9NA 4QIGA 1R8CA 4DUZF 2DGSA 5T41A 2HWHA 5K9FA 2MGZB 2BANA 3J7YI 1DTTA 3M30A 1P8GA 5CYQA 4OHYA 2N4DA 2U2FA 4PXBA 3PJWA 3DLHA 3L09A 2EFOA 4MK8A 3DMJB 2FIUA 4UW2A 1N34F 1SI9A 4C4WA 4RNHA 4N77A 4FXWA 3M32B 1FD2A 4ZA1A 4ZHRB 3J81Y 1T02A 4C11B 5DGBA 2L08A 3TUZC 3IWLA 4M5DA 4EBDA 2LLZA 3EYZA 5D4OA 3MM5A 2V8GA 1D9DA 4ZP7A 1TK0A 5U47A 4DHVA 5CZXA 3PX4A 4IUFA 2XEXA 3RGIA 3AHPA 1YRTA 4UQGA 2HWIA 3P5TL 2QT7A 4IO1A 2CQHA 2LXUA 4Y2IA 4NCBA 4Z37A 4ALZA 2JJ4D 2RUGA 4R8UB 3SQGA 5LSOA 2N4CA 1GTEA 1MWZA 2CQPA 2LA4A 4QYZJ 3GSDA 3M2UA 5HBMB 4ELVA 1TKTA 4U6PA 4Y3CA 4U7UK 4WFZA 3LWMA 3QYYA 1O0PA 2Y1IA 1RA6A 2VL1A 1R43A 3MMBB 1J5OB 5KFPA 5E3QA 3U1LA 1HBOB 4P2SA 3MUTP 5IT9Y 2HVIA 5HMYA 3DRPB 5J1NA 1ELOA 4IH5A 4QWBA 1SBRA 2O66A 1S7HA 4I6AA 2C2DA 3DMJA 4X2BA 5KFIA 1CLFA 2V5HG 3M32A 4ZHRA 4KQZA 4NL5A 4C11A 1FNOA 4XDCA 4LSLA 3PFEA 1NJZA 1KVIA 2OLWA 1LFPA 5CD4H 1JIHA 3CIMA 2ASDA 3PXGa 2FC9A 2MZTA 4ES3A 2OTJS 4NA3A 2PDAA 3G86A 1S1XB 1S6QB 3CUNA 4KV8A 5IT0A 4NLOA 4R8UA 5HL7Q 4AL6A 1N5SA 4QR0A 3GIIA 1U1NA 4BDPA 2FPHX 4MKAA 2PE8A 2HYIB 4GKKF 2LECA 3CD5A 2YY3A 3CC7S 5HBMA 2Z2MA 4E98A 2GHVC 5DDQC 2VBYA 2GO9A 1IUJA 3UD3P 2XCAA 3VAFA 1BWEA 3MMBA 2IRUA 1J5OA 2CG4A 2GO8A 1WI6A 3PEJA 1HYSA 4IRDA 4TY9A 4QOTA 4RUHA 4IG3B 1HBOA 1Y0HA 3MPVA 4CH1A 3T9NA 1VQ9S 1HPZB 3DRPA 3LH2S 4NLTA 3FJ2A 7FD1A 3G8SA 4TYBA 2Y1RI 1N32F 4ZMMA 4Q43A 3E8OA 2Q6BA 3Q24A 2PGCA 1GXTA 1XTZA 2OP5A 4WFNQ 1U1MA 2LDIA 5E0OA 2CVEA 3KK2B 1H38A 5F3TA 1DRZA 2DT9A 1REVA 4DLGA 3R1HA 1NK4A 3CULA 2MZ1A 2GMLA 4QU7A 2XSJB 1OS5A 2JOQA 4WE1B 2E1CA 1CPZA 3IR6B 1GX6A 2BACA 1S1XA 2DNOA 4PG4A 3Q8RB 3NNAA 2IJFA 1S6QA 1WF1A 2HQIA 1Y9OA 5L38A 1S9EB 1FO1A 6FD1A 4ERDA 1P1TA 2F1FA 1APSA 1X7VA 2B56A 4X62F 4ILMA 3CJ0A 3BO4A 4DSFA 4FF4A 3K8WA 1SKSA 1JXEA 1M5VC 2VKZG 2GHWA 2GMJA 1JLEB 1TKXB 4DQPA 1G7CB 2ZH7A 4IG3A 1HPZA 2A2CA 3EGZA 4Q8EA 2QLWA 2VZ9A 5F8HA 5C24B 3I0RA 2OKQA 3N28A 3F73A 3DXBA 5I3UA 2U1AA 1N5YB 4NXNF 1OQ3A 2X51A 2DR9A 5FJ4A 2Q43A 1S97A 4NLYA 1A6LA 1SL1A 2E44A 2HRUA 3OHAA 2DGXA 2E5IA 2VPXB 3HK2A 4AXJA 3L7OA 1N5QA 1Q8IA 1UEVA 2MQMA 3KK2A 1T7PA 2MHNA 2JVRA 3GV7B 4YUDA 1RT4B 2OPPB 5F8GA 1IJFB 2XSJA 1NNDA 2LDYA 4WE1A 5FLXY 3LP2B 4I1TA 2L41A 1HNWF 1K0VA 3V4IB 3IR7B 1H2VZ 4RR5A 1WHYA 5DDOC 4NLSA 3QPIA 4O4GB 2QMXA 4C2MA 5D6GA 3CB4A 1UW4A 3C66A 1U49A 1IN0A 4TNOA 2FJEB 5AE2A 2QZ8A 4NWBA 1UA1A 2HPUA 4XIUA 3SCJE 3BEGB 4O4RA 1DQAA 1KQSR 4JI0F 5ITHA 1QSLA 2EVZA 2M5YA 4N41A 4IFYB 1R8AA 1JLEA 4ZPWR 1TKXA 2HHHF 2JEJA 4EYHB 3O44A 4RWWA 3DI6B 2PA3A 4AE5A