2PFFB

Structural insights of yeast fatty acid synthase
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
2006
structure length
2006
Chain Sequence
MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEGHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights of Yeast Fatty Acid Synthase
pubmed doi rcsb
molecule keywords Fatty acid synthase subunit alpha
molecule tags Transferase
total genus 233
structure length 2006
sequence length 2006
chains with identical sequence E, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01575 MaoC_dehydratas MaoC like domain
B PF08354 DUF1729 Domain of unknown function (DUF1729)
B PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
B PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis
B PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta
B PF17951 FAS_meander Fatty acid synthase meander beta sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2420 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB01
3.30.70.2430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB05
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2pffB03
2QO3A 2G2ZA 5CZDA 3SBMA 2VZ8A 3R97A 2C2NA 3HJVA 4RR5A 2PFFB 2QC3A 2H1YA 1MLAA 4QBUA 2G2OA 3TQEA 5DZ6A 3EZOA 2VKZG 2HG4A 3PTWA 5DZ7A 2JFDA 2CUYA 1NM2A 3RGIA 3HMJG 2UV8G 3IM8A 3QATA 3G87A 2G2YA 3HHDA 2VZ9A 3IM9A 2G1HA 4RL1A 5CZCA 2JFKA 2QJ3A 3K89A 3H0PA
chains in the Genus database with same CATH superfamily
3PV8A 4WIQA 4OJGA 3O1LA 3OD2A 2HHUA 4DL5A 2OH2A 3ELHA 5I42A 2N82B 5KFFA 2RQCA 2E1CA 2R8JA 4IYQA 2VBZA 2O66A 4X64J 2ZH8A 1NH8A 3TAPA 3V6DA 2H5JB 1Z1ZA 3RGIA 3M7VA 2GQ2A 3RBDA 2KZMA 2HNDB 3I31A 1JLQB 2QN6B 2AYGA 1AZSB 3KK2B 2J6SA 2CQCA 5C5JA 1WOPA 1LW0A 4HT5A 4F4AA 2YWEA 1RT2B 3HX9A 3MEGB 5F41A 4NLDA 2MY7A 4TY8A 5IV4A 4AQYJ 2EBEA 4QPTA 4XIUA 3PRDA 1M1KT 5DDQC 2B43A 2LXUA 4K4VA 3GIRA 1GTHA 3I5AA 4KPCA 4P7TA 1S6PA 2DGWA 1TL1B 4J9PA 5HQMA 2V2KA 5MAOA 3M2RA 2RKIA 3CMQA 1R6YA 5I42B 3CCTA 1RAHB 3OBIA 3ZO7A 5HROA 1UFKA 4LBPA 2IHR1 4P2MA 3FSYA 3V6DB 2DNKA 4JI0F 1VIXA 5GAGU 3CT9A 2G1DA 2GIFA 3ZTOA 2KG0A 3ZZUA 3NS6A 1KTVA 1U6ZA 1K1QA 3CO0P 5LL6d 4IH6A 3B82A 4PWWA 2RUGA 1LW0B 1H6KX 1KP6A 3W9HA 2LEAA 2VBXA 2PMHA 2NZCA 4TY8B 1EKRA 2D3O1 4W4MA 5IWAJ 3R97A 4YR0A 2R8HA 2QLXA 2A6OA 3MUTP 4J9KA 2OO4A 2NXUA 4X65F 2KRBA 4OYWA 5KOWA 3BYRA 1S6PB 3JXOA 2CZ4A 5KFZA 4GKJF 1GXUA 3G8TA 3M2RB 2RKIB 4RUCA 4C3KA 4USTA 5D6GA 1QSYA 3I4PA 1YBTA 2V94A 4DR5J 3DU5A 3OJUA 3MI7X 2HQCA 1IBMJ 2H51B 3CEDA 2QFJA 1FDAA 5HROB 2N7CA 1X4CA 2IM3A 4LF8F 2F9JA 3HSDA 2LYVA 1Q1KA 4IH7A 1S0VA 2XHWA 4UZBA 1NMEB 4ECWA 5IS2A 1YJ9S 4FKYA 4CYUA 4DR3F 3OTOJ 1YJNS 1SKWA 2LLZA 4TNOA 3B54A 4ANDA 3PJXA 2AJ2A 1X4BA 2HFZA 4Q43A 2G2OA 3BJYA 2AZ1A 1MROA 2IRYA 2EC2A 3D6FB 4QU7A 2BZ2A 2JX2A 5LJ5Y 3D3CJ 4OX7A 3L9ZA 3IWNC 3CIMA 3I0RA 4C8KA 3BGFA 1WDDA 1L3VA 2R7WA 5IT0A 3TZXA 3TUZC 4RBUA 4URQU 4ZVQB 4ECQA 3QGPA 2Z2ZA 3EVMA 3KLIB 2RHQB 3R5CA 1IKYA 4ZVGA 1T9YA 4RNOA 1RT7A 2OLWA 4K4TA 1U47A 4C8MA 4CDIA 4CO0A 5M2RA 4FXVA 1IUJA 3ZTSA 3DRXA 3CC2S 3TQ1A 1UVJA 2XO7A 2P9EA 4DSKA 2V8GA 1RLCL 2EW9A 4ZVUB 1S4EA 4I64A 4CYUB 1GT8A 3HMJG 4MKBA 3M2UA 4CT8A 5F8LA 3OW2R 4DS5A 2AV5A 3C8YA 2XMVA 3ITHA 5IC4B 2M8HA 3ETOA 1MROB 1EQMA 2Z4PA 5ADZA 4HI1A 2QA4S 5DDOC 3PEHA 3R1HA 2R7RA 1YSJA 2DR6A 3G82A 1NRKA 1N88A 3R5GA 3I0RB 2YQ1A 3CGIA 3CD7A 4ZVPB 2EG2A 2VKRA 3CD5A 1BQNA 2KHDA 2XI3A 3R5JB 4F3OA 1RTJA 3OJSA 2M3DA 2XI2A 1REVA 4F26A 3UD5A 5E41A 1HFEL 1ZYQA 1RT7B 3ADAC 3DLJA 5CZDA 1UW9A 2DBBA 2GMHA 2V8HA 5KFDA 1MMLA 2VBYA 3RB0A 1NK8A 2AKWB 3NMAA 1Q8IA 5ETRA 5L1IA 5F8GA 2Z57B 3GU0A 1QDUB 2CJAA 1QJHA 2BOPA 3VGTA 1NK9A 5E33A 3CMES 4NI2A 3M2UB 2ZH9A 2HEKA 3SFUA 1FJEB 3PW5A 4HACA 4N7TA 3ITHB 2N4DA 2GFFA 4U7CA 5D78A 5L38A 4JI7J 4IOAQ 5KFMA 2O3DA 2YTCA 4WU3A 4PAAA 3G82B 2CJXB 1NB7A 1ZZFA 4DS4A 4DQIA 2C2DA 4HR2A 2J9CA 3GCXP 1BQNB 4HTJA 1RK8A 1RTJB 4R5PA 3BN7A 3BO3A 1REVB 2H9ZA 1ACMB 4CLPA 4DR4J 1HIYA 3H20A 2IRXA 2ZBCA 2HK2A 1XMOJ 2XZDB 4RPFA 4U7UD 4TVAB 5KFBA 2LQBA 5GAHU 3TJ8A 4FVMA 4OI3A 4A46A 2PT0A 2B9XA 1MLAA 4C6AA 3PIPQ 4NI2B 1WC6A 4DOZA 2R7OA 1Q5VA 1U2RA 1RWVB 1PC5A 2E1MC 2MKSA 3N9UC 2B4VA 3U02A 4HACB 3EZUA 4K59A 1BQXA 2LCWA 4HKQA 3G8QA 2RJZA 3THVA 2XC9A 5JJBA 3MEDA 4ELUA 5H9FJ 1MU2A 1U1LA 1T05A 3UCUP 1S7HA 2HBYB 4U95A 2DJWA 2GJFA 4A8XA 3TVZA 3BF4A 1XR7A 4PG6A 2V63A 3N6MA 4R5PB 4C9DA 1OQ6A 3GJQB 2C2RA 2DT9A 4V19X 1LQ9A 4A8SA 2ADCA 2W2QP 2XNRA 3DGVA 3CCLS 4U8VA 3QIDA 2HBQB 3K8WA 4I56A 4PXEA 5HSPA 2DGQA 2B4OA 1K44A 3MR6A 2V2ZA 2GHVC 1EX8A 5CCLA 1S1UA 4QW9A 2R42A 3KDNA 4CNZA 4R8UA 3ZZYA 3H5UA 3BBFA 4ZPVR 2WVBA 4DSLA 4OI1A 1IM4A 3HSJA 3WDOA 2VFVA 5F3ZA 3MEDB 2XG8A 2QTWA 1MU2B 5ETNA 4V1Ak 2XLKA 1QSLA 3IR5B 1T05B 3IM8A 2MB0B 5F8NA 4RWXA 1MWYA 3T1HF 4KGVB 3I55S 3WX4A 2HZVA 2PMWA 1EQ0A 4BCAA 3W66A 3LGHA 3PX6A 1VQ9S 2MY8A 2R2TA 4DR7J 2ZBPA 3FSXA 3ENVA 1KQFB 4I6WA 2HS3A 3FBCA 3TJ9A 4K2XA 1U1RA 1S6QA 3P6YC 1VCTA 2BJ3A 2QYGA 1N36J 1S1UB 3MR3A 4OLOA 1UJ4A 4KC5A 4R8UB 3SCJE 4EK2A 2ZJPQ 3FJ2A 5HAOA 5KG7A 1H2TZ 3SCIE 5A8KA 1KHVA 2HSEB 2JFDA 2Y1IA 3QWUA 4ERDA 3C6UA 5CYJA 4Q5VA 1S57A 2WVCA 4F50A 1PJ5A 1VLOA 4ZIVA 2YX4A 1M90T 2ZDOA 2AJFE 2IDLA 3FZ2A 2R7QA 2CADA 4TKTA 3IM9A 2BX6A 2OPSA 3M9NB 3JSYA 2MLZA 4KFBA 2ZNYA 3UE2A 4GVLA 3SSQA 2Q3PA 3TEHB 2X7IA 2DGXA 3RG6A 4HVZA 3S8SA 3L09A 3V81A 1IBKJ 2FDNA 2ZJRQ 2V5HG 1FCAA 1GTEA 3GYGA 1ULRA 1VLYA 1S6QB 3HD1A 4WU2A 3RZAA 2M8DB 2M52A 3PO4A 1S0NA 4ZN1A 5A8KB 4FKXA 3HT0A 1KQKA 3OVAA 4DPWA 5F3TA 2FJVA 3C6UB 1LOUA 3OXGA 4WFAQ 1AFJA 2KXHA 4UUXA 4ITSA 1NDLA 4OHYA 1W7WA 1KFSA 1F5BA 1HQ2A 4LRBA 3GWCA 1DLOA 1WEXA 3VV2B 2OPSB 4RUBA 2XTJP 1RISA 1B7FA 3RBEA 5BR8J 4M5HA 4F3MA 4KFBB 3VVUA 3PW2A 4FVCA 1JWWA 1FKAF 1UZHA 1YJWS 2GMJA 2DIVA 3POTA 3CCJS 4ZPTR 2HVZA 2AYEA 2FZKB 2JEFA 1X4EA 3V81B 4RKUC 2DNYA 4P73A 5G4DA 2ZEJA 3GYXB 2RQ4A 3DRYA 4RX6A 3W1YC 1NHUA 2PC6A 1FRIA 5J2MA 1R0BG 2FPHX 4NPOA 4G6VB 2J0QD 2K06A 3KUGA 2W7AA 2DY9A 2W24A 4ENOA 4ES1A 1FJ7A 3TQEA 5K8OA 2W7PA 4Y2MA 5IT9Y 4RWWA 2EI5A 3WIUA 5CXTA 2DNMA 4V19J 3HK2A 2AMCB 1Q79A 4OI0A 4PG7A 2JVRA 2CNLB 3CJ4A 2KN4A 1RAFB 1APSA 4BS2A 1RCOB 2VKZG 1DLOB 4DPXA 3SZ2A 4CLUA 2XWYA 1HNWJ 3NWGA 4WK3A 5F9LA 3POTB 3SDEA 1VK3A 3QT5A 2H4YB 1HARA 2ZH3A 2CPIA 6AT1B 1Z4UA 4C8ZA 3JQMA 4ALZA 2RQMA 5J2MB 1U0HA 4KT0C 1IR1A 1T9VA 2UXDJ 5HVGA 1RYSA 3OPKA 1SJ4P 4ZVSB 4IOBA 4KR0B 3HT3A 2FVSA 1S9FA 2GS8A 4AQYF 3QJLA 4JP8A 2G4BA 2QC3A 3VAIA 1RUSA 4CLZA 1N0VC 2E44A 1MW7A 4ZVOB 4URGA 1RT4A 2F1FA 5KG6A 3MHYA 4USJC 2XHCA 6FD1A 3ZTQA 3MPUB 3J7Z5 4Z2XA 4F7VA 3TW0A 4DUZF 4KGMA 2VODA 3SV3A 5B0BA 1QE1A 5KFXA 1WHXA 3M9MB 4DUYF 2EFPA 3IBWA 2MKHA 1RAOA 4PG5A 4C4WA 3BDEA 2BMBA 4TQSA 3RJMB 3SDEB 5AT1B 4LSZB 4H4MA 1S4FA 2BQUA 2APOA 1NJWA 2GAHC 4J7CA 1KLNA 2DR8A 1NDKA 3D6MB 4UOCA 3EICA 3CCSS 4M5JA 1VC5A 4Q8FA 5E3CA 2UU9J 1U0HB 2FTRA 1D9DA 2UVVA 1FWPA 3HPOA 3HULA 3G71S 1S9GA 3GR0A 3GG1A 3TAQA 4DHVA 3K8VA 5D4OA 4YY3F 5IWAF 3WC0A 5DQGA 1UPPA 3A12A 4JI4F 3PR5B 1IWAA 3VAHA 5J2PA 4PR6A 2NXNA 4WYLA 3EZ5A 5M2UA 1F6TA 1TUVA 1W2IA 1RT4B 8ATCB 2DNRA 3WHIA 1WUUA 4ATNA 4FS2A 2KFNA 1QE1B 2DITA 3RW7A 4DR5F 2VPXB 1FRXA 4WBFA 4OZLA 3HZEA 3ZZ0A 3G87A 3CCVS 4H4MB 1HL6A 3I9V9 2JC1A 3MCMA 4ZOSA 4HEA9 2FHKA 2R7XA 3DLGA 1N54B 3BBCA 3OTOF 2KL8A 2C2ZB 1YRUA 2MZSA 4MYUA 1TAUA 4XO0A 1F2HA 4ZJOA 1U4BA 1XC9A 3TVYA 1VJQA 1S72S 2XYHB 3IR7B 1R8CA 2QIFA 3N79A 1S9GB 1WC5A 2HRTA 5H9EJ 2OMLA 5GMKa 2CRLA 2WB4A 3PJ9A 5J2PB 5HANA 4UY8T 3NGTA 1OPIA 3D7SB 2DTJA 1EB0A 5ETQA 4B08A 4CRJA 4E0DA 2J9DA 1EHWA 3O2IA 3MPYA 5L1LA 3WQPA 1XQIA 2F65A 1YBUA 3R27A 2QA2A 3D66A 3FEYB 5H1SV 1I94F 2Z58B 3Q2SC 3CCRS 3GFHA 2HQ3A 1TMJA 2BE2A 5B0CA 2HGNA 3PG9A 4NZ7A 1XMQJ 3G86A 2HHQA 5ETPA 2E9RX 2PA8D 2ZJQQ 1HWJA 3BH6B 3DLGB 1YQHA 2ZOGA 3CJRA 1O51A 3BYPA 2G9OA 2B0GA 3ZFVA 4MMOA 1NPKA 4M95A 1YIJS 4F8RA 2ZFHA 4I68A 1C0TA 4DV1F 4Z7YA 3AQPA 3K5PA 2MDAA 2F4FA 3W3SA 4OJ3A 1SH0A 3K59A 4NEYA 1D3WA 3M8PA 4QIEA 3GSIA 4M94A 4NLSA 2CJ9A 2FJDB 2HHVA 3AJ1A 1KONA 4ZCLA 1OIAA 1BY9A 1J5EF 5J1EA 4CM2A 3FVYA 2MJNA 3PRVA 4ED6A 5FJ4A 4DPTA 5K8PA 2DRBA 1WG5A 3MEEA 5IT9U 1HMVA 1R27B 2CPEA 2VQFF 2IM2A 3MAHA 2DCUB 3P45B 2CAJA 2BE2B 1XK8A 1I51B 1WI6A 3HDSA 3D2WA 1CC7A 3JQKA 1GMUA 1FD2A 1L3SA 3NS7B 2W1BA 4NLRA 3OTCA 5ETSA 5D15A 2UXBJ 4B3SJ 1R3NA 4OYAA 1C0TB 5KG3A 4YP3A 2DYAA 5CH7B 4DV2J 1L3KA 1R8BA 2XNQA 2F3JA 4PABA 1XN9A 2RRAA 3QSIA 4A8KA 5D4LA 3M8PB 2ASYA 4A47A 1HNVA 3M8SA 3TZWA 3LALA 2BDPA 2EWHA 4K4XA 1YDLA 3FRZA 3N0VA 1Q4RA 4G65A 3GJSB 2YKPA 1HWLA 4TY9A 5J1EB 1YTYA 1H7WA 1RAIB 1FESA 4DR4F 4OJHA 3BREA 3O44A 3R2CJ 1JXVA 3X1LB 4PKDB 4ES3A 2GGPA 1P1LA 2AU0A 1GMVA 3MEEB 1HMVB 3D1HA 1XMOF 2BYCA 2IJRA 1RHJB 4FZVA 1VQ4S 4RZRA 3GIKA 1FEHA 2VOPA 2W9BA 2M70A 3RYLA 2AQ4A 2WBRA 3Q2TC 1H73A 5K9FA 4N56A 4B9LA 3L3CA 4C8LA 4DU8A 5HVHA 4C3LA 2MHEA 2HLTA 4KYZA 4CNYA 1WTFA 2NS1B 2FJXA 3CJ3A 2HVEA 1VQMS 4LFAJ 4C2MA 2MJUA 2E7XA 4M5IA 3T9NA 1T95A 1T9UA 1FO1A 3KNAA 2HVIA 1HNVB 4NASA 3RUBL 2NLWA 3HVAA 4JYAJ 4GC6A 4MK7A 5J1PA 2MYFA 4DZ6A 2IM1A 2MPUA 2C2NA 2E5LJ 3Q8QB 3QGGA 1TKDA 2PN6A 2KM8B 2GGPB 2P2CB 1IBLJ 2HBZB 2W01A 2W2NP 4MKVA 3C46A 5SZTA 2DR5A 2QSFA 4IG3A 2R8GA 4QBUA 1ZBTA 4F0HA 1OY6A 4ZHRA 1S6UA 5AJ3J 2N3LA 4EBDA 1VQLS 2W9BB 4NOHA 4MYTA 2JDJA 3OLAA 4OYZA 2BKNA 4JI6F 1JLCA 4DMZA 5DG8A 5GAEU 2MMYA 1MSWD 3H7HB 1PBUA 4HDHA 3ULHA 4OX9J 3F56A 1KOHA 4KJIA 1VQNS 1DQ8A 1SC4B 2OTLS 1PJ6A 1QLNA 3O5TB 4B3RF 1U09A 3FCWA 1BXNA 4QOTA 4USUA 5A6WA 1UVKA 3MFHA 3FGVA 3V6JA 3D67A 2LP4A 1NNDA 1XIQA 1GQEA 4RBTA 4J9RA 1OWXA 4NMLA 2DK2A 4X62J 3QYYA 2E9ZA 3OL8A 1NK6A 2C3YA 2JEJA 2CQ2A 1TL3A 4B9MA 3TRGA 4ZP7A 4O44A 3ZZOA 3TA1A 2QJ3A 4M5DA 4IG3B 2YWKA 3BS9A 3LPEA 1F3VA 3LAMA 4ZMMA 2GO8A 4ZHRB 3IR6B 2F4VJ 3L95X 1T02A 2V9WA 1I6JA 3BN4A 4ED1A 1JLCB 2AX0A 2QFIA 1EETA 3FFIB 3M8WA 2CDQA 4CIOA 2M0GB 3VF0B 4C7QA 2I1RA 3FZBA 3FEZA 2IYGA 5ETVA 1FJGJ 4AMOA 3T6BA 2FVQA 1VR6A 2VC1A 2BW7A 3JSMA 2VG7A 3Q89A 5DO2A 1U1KA 1UJ6A 1RZMA 4J9OA 3D9BA 1HI8A 4UF4A 2UZAA 3R9LA 5CABA 2HWHA 5HJYA 1NDCA 2ZBQA 4WKYA 5K14A 3H90A 2FJEB 4KPYA 4L3KA 1TL3B 5JUMA 3IS9A 1CPZA 3MM9A 4Y2AA 2KTQA 1FWKA 3CCQS 2D74B 2AZ3A 4O44B 4M5DB 2GIRA 2GHWA 2QLFB 3Q8YA 3TZYA 2X3GA 2OAUA 1VC0A 4ID8A 1M0SA 2XYGB 2J0XA 2OFHX 4AE5A 1O5JA 3LOUA 3KFWX 2EEYA 2XYPB 1EETB 3I82A 1NB2A 2FUG9 1VRTA 2B56A 4LR8A 2WSEC 2YNHA 4AMPA 5SUHA 1SL2A 1KFDA 2HHWA 4NLXA 8AT1B 1G4CA 4HDGA 1G6BA 2MKJA 4NWBA 2XY6A 4NLTA 1HHTP 2DH8A 4TLRA 3JSMB 4ECSA 2VG7B 2PSZA 3M8ZA 4Q2MA 1C0UA 3A3PB 1PBAA 3FQKA 4CI0B 3PIOQ 2L08A 1UAWA 1TZ0A 2FHOB 2JH3A 1KLMA 1SPBP 1TKZA 4XTTA 4NA3A 3TA2A 3IS9B 1H74A 1U8WA 3MM9B 1JXLA 3BQ2A 2F5GA 4G3IA 5I4MA 1UEUA 3QQCD 2HG4A 2AJQA 1NPPA 2QSWA 1WSVA 1KQGB 3CC4S 4DV3J 5FLXU 3HHLD 4OZ3A 5MLCV 3LF0A 2AD9A 2HIQA 2QGFB 3BSNA 4E98A 3PJWA 1ITPA 2P6SA 1WEYA 4JI0J 2PO4A 1P27B 3K17A 4QPXA 4DSFA 1R7IA 1VRTB 1Y3KA 2YNHB 3FQLA 3HSGA 3DDIA 3K0JA 4XPEA 2VASA 4LFBF 2RF2A 4O23A 1WJ9A 1K1SA 1U1PA 3EX7B 3M8RA 1N56A 5K8NA 2YWWA 5KFCA 1I1GA 1HNIA 2VC0A 4TYAA 4G1PA 3OFFA 2Q43A 1F5AA 4LVOP 3MM8A 2PE8A 1C0UB 1RAEB 2OMOA 4EBEA 4F4KA 4EZ6A 1RT5A 3PYFA 1JJ4A 4FYYB 4X65J 2FJBB 3T1YF 1KLMB 1TKZB 1HNWF 1H2VZ 4O0IA 2J0SD 3V6KA 4GKJJ 5KFEA 1Y5LB 4C8YA 1Y5NB 1NO8A 1YVFA 2R8IA 4M5GA 2KT5A 5E2QA 2BKOA 3LUYA 4LIWA 4LF8J 1NXIA 1X4AA 3CDBA 3QLHA 4MK9A 2X1FA 4X4SA 3PCOB 4Q7AA 4ECRA 2ERRA 3FEXB 3T19A 4DR3J 2WONA 4DV7F 4UW2A 4QWBA 2HHTA 5KFYA 2RF2B 2W25A 3NCQA 2B4UA 1NSAA 2OIHA 2ZHAA 3TWZA 2MKCA 3W7BA 1X5TA 1HNIB 2VU5A 1Q95G 1QAIA 2CYYA 2V4JA 4ZVEA 1WC0A 3SSSA 5F0WA 4ZS6A 3MM8B 3L7OA 1FKOA 1N5VA 2YVSA 1RT5B 1WC1A 1JLBA 2P5VA 1WEZA 1NK0A 4EBCA 1RWMB 2QE5A 3BO4A 1Z2LA 3R6GB 4CH7A 4KHPJ 3FUYA 3WC2A 2YKMA 4LF4F 4X4QA 3KHLA 3LO3A 3DFEA 4ELTA 2WTFA 2GQQA 1KS2A 5KFGA 1RWUA 1FWLA 3PHTA 1JIHA 5DM7Q 4D3GA 2C3UA 2XM3A 3QLHB 1WC4A 4I0WA 4RUAA 4LR9A 3JAMU 2YNIA 3EDRB 3KMQA 1G2EA 2ZH5A 3MFIA 1ZM2A 2WONB 7AT1B 3NGRA 1HHSA 3M8YA 3KJNB 3OL9A 1WF1A 1HQEA 5IQ6A 1RHUB 1P6TA 2M7SA 3PXGa 5F8JA 2ZC4A 2V4JB 4KH0B 5DLGA 3FKBA 3H5XA 5HQ8A 1FKOB 2DCLA 4CTAA 5HVFA 5LJ3Y 4ED8A 4QR1A 1X0PA 3UQSA 1EP4A 2V68A 2FQQB 3OR1A 1JLBB 4OHZA 3NWRA 3N5BA 1ZA2B 4K4SA 4QZVB 4BWJA 1KRPA 4OHXA 2YKMB 4K0KF 3H25A 2J7KA 3EPGA 1YJ7A 3BV8A 4DFJA 3DOMA 3L4BC 2G0CA 1IKXA 4LIRA 4WZMA 1S1WA 1WD6A 2FLOA 2UP1A 3G9CA 4ZVTB 4ANCA 3L7PA 4P71A 4DPOA 1N34J 2O01C 4OLPA 1U1NA 2V0NA 1NU4A 2JHEA 4JI8F 2E9TA 2YNIB 3UNGC 4EO6A 1GAOA 3QJPA 3DRRA 4NE9C 3A8KA 1KBRA 1HQEB 3DXSX 4BC7A 2V8VA 4NYZA 1W25A 3M2VA 1EIYB 3BR8A 4CTAB 1RGVA 3MR5A 3MMAA 3MZIA 1EP4B 4CM0A 2HVHA 2G2YA 2P6TA 4P10A 1IR0A 2WVDA 3OR1B 3V4MA 2YKQA 4QR0A 3Q24A 5E3AA 3W60A 2ZH6A 4U7UK 3AHPA 3FK4A 1SIZA 2IC3A 1XJWB 4DL2A 4DI6A 4A8OA 2ZH1A 2HPUA 1HD1A 3DOMB 5G0RA 3R7NB 4MKYA 1IKXB 1S1WB 1FRHA 2BM1A 2HW3A 2DR7A 3ZZTA 3NBPA 4YUDA 3PW4A 1LWXA 4O0NA 5KFPA 1IBCB 4YDDB 1RXOB 2BANA 4DDFA 2A18A 5KT4A 3DRRB 4PQUA 4I4BA 4KSEB 5K5MA 2BVZA 1G3OA 4TU9A 3ZZZA 3KG0A 4H4KA 1NEEA 3M2VB 2JOQA 1NK4A 3KDOA 5E3QA 4OZNA 3MMAB 4WTYA 3CDUA 5IV3A 4NRTA 5ETTA 2W8KA 2KB2A 1GH8A 4BWMA 2I5JA 2IC3B 1Q0NA 3RBZA 5CD4A 4P72A 4OX8A 2NYHA 1PG5B 1SQGA 2WW4A 5DRKA 5G0RB 1M5HA 4W92B 2Z0GA 4ETZA 3NBPB 3D68A 2LA6A 5KFRA 3BGOP 2JSXA 3C19A 3ZZRA 2B51A 4LRFA 2W7OA 4DV2F 2BANB 4ZP8A 3GZ7A 1TL5A 2B6AA 4LQ3A 5L9XA 3Q83A 2Y1JA 3PKYA 1GEHA 4J5OA 2D69A 3TVKA 2ZDPA 2A1BA 5LXYA 2IBKA 1CVJA 2E1RA 4DSJA 2ACYA 4FBUA 4LRCA 3BO2A 1M1GA 3S7RA 5DZ6A 1KVIA 2YPZA 4AXIA 3IXQA 2OGUA 2Z30B 1RLDA 3GILA 2JLEA 1FXRA 2HWTA 3DRPA 3Q23A 3AODA 4LQ9A 3T1HJ 3HJVA 2KHCA 3BSOA 2I5JB 3HJFA 4ILLA 2R8KA 1U7LA 1T8EA 4OV6A 4B3MF 2XO6A 1FX2A 4YS2A 3DLKA 3QRRA 3CJ0A 3S6EA 5HMZA 4RW7A 2RS2A 3MDFA 4DR2F 5FIIA 2CPJA 4DLEA 4K7QA 2CQDA 3JB9k 1X5OA 4C8OA 1IR2A 5E7OB 3BH7B 1FX4A 2B6AB 3ZNUA 4JV0A 2PFFB 3HFZB 2JEGA 4RNMA 1D9FA 4JYAF 4NYOA 2RU9A 1IJFB 3QRQA 4CLYA 2DGOA 4CCHA 5F0UA 1NPRA 3TX0A 5A2QU 2ZZMA 1RCXB 2EG1A 3DRPB 4WPAA 1JJ2R 1FERA 2DKOB 2GMLA 5HN0A 3QJJA 3GV7B 3ENAA 2YBVA 2ROPA 5EN1A 4YR2A 2IMOA 4JI5J 4ZCMA 3THTA 5AJ3F 3G6XA 1XBWA 2M5YA 4EEYA 2UVRA 2L48A 3CJKA 4UQTA 3DLKB 4QJVA 4F2SA 2M4MA 1U02A 4A8MP 4RW7B 5K20B 4ECTA 3D3BJ 1RWKB 1NLKL 2CA9A 2W8LA 3P5TL 1JLGA 3AJDA 2J9EA 3CW2C 1DFDA 1DY3A 3T5LA 1CJUA 2MQQA 1TVRA 2FJWA 3CJSA 1KC8T 3DMJA 3H4BA 3UDVA 2IAJA 2LDYA 4WK1A 2ZOFA 3DOKA 4YHHJ 3H2LA 3JS9A 4X62F 5EWFA 2BJ8A 1SJQA 2OUGA 2F8EX 2RE1A 4QQBA 1SC3B 5IFMA 3LAKA 5HL7Q 1F0XA 1RBOB 3J7YU 2ATLA 4U9RA 4O3NA 1NAQA 1XWLA 1ZAXA 3W5YA 3CCZA 4NLYA 2FC9A 2CPHA 3CJKB 2OEJA 2N3OA 1HBOA 4P74A 1CJVA 1YG0A 3KLHA 1JNZB 4DSEA 1KVKA 3TANA 1H2UX 1K47A 2NQPA 2PI5A 2LEPA 1UJ5A 1NKEA 1JLGB 4U6PA 2HNYA 4DPYA 3CCUS 4NMXA 3K5MA 4C11A 2AW0A 3BDPA 4ED3A 4HHJA 1CJUB 3U1MA 3DC2A 3DLBA 2DO0A 3VHQA 3DHWC 4PRFA 1X9MA 2IJNA 1TVRB 3FBEA 3DMJB 4Y28C 2I9SA 3GLJA 4XDCA 1FHTA 4PWDA 2IAJB 4RNHA 1TL7A 2U1AA 4R0EA 4AL7A 3DOKB 2Q1LA 2OD4A 5KG4A 3AD9C 3MCNA 4N5SA 2Z8QA 1VHFA 4DN9A 4IRKA 2Q79A 1BE4A 3OHAA 4HT7A 3VAKA 3SEOA 3IGNA 1X9WA 2Q6CA 1IQTA 5HJXA 1HA1A 2AJ4A 5CAAA 3FMBA 2W2MP 1HBOB 2CZ9A 1O6XA 1CJVB 3UD4P 3KLHB 2L41A 4IR1A 4BHQA 2L3MA 3Q8SB 4LF7F 4ZKAA 3UR0A 5E5NA 4IQXA 4KAIA 2W9CB 2HNYB 2Y1RI 2KXNB 5LMNF 4C11B 3BPDA 4U67Q 1VYAA 2F9DA 2MKKA 3X3UA 3J7AN 1VRUA 2OJ3A 3NS5A 5AE3A 3TJAA 5EWEA 1D1UA 3UCGA 1D8YA 4PWDB 1TL7B 2WSCC 3MPWA 4IO9Q 1XNQF 1ZZNA 4Q45A 5D0HA 2H54B 5F8MA 3MUVP 2K3KA 1LWFA 3HHDA 1S0MA 2BQ3A 2QL9B 4LFCF 1JLAA 4RR5A 3OXFA 5GADI 4UZCA 4DUZJ 1EZZB 4RNNA 2R7SA 4L73A 2XGPA 4DV3F 1R8PA 3LP0A 2C2MB 3D28A 2UV8G 4DUYJ 5IZHA 1HBUA 1HHQA 3QFHA 1OQ3A 4WFZA 5LSOA 3CVKA 5B0AA 1CBKA 1T94A 1HLWA 1WF0A 2Z2LA 3BKUA 4KO0A 2LECA 1WNEA 2J7UA 4FXWA 4D3HA 2Y3YA 2KZZA 3A8JA 4CLWA 2NUHA 1RAJA 1X31C 3W5XA 4ECVA 2DB1A 1VRUB 4RW6A 4P6QA 1F1BB 1SQEA 5U47A 1YGYA 1WWHA 3ZTPA 2B3TB 4YY3J 3VGSA 1RI7A 3SBMA 2C1EB 4JI4J 5B0GA 3MR2A 5D77A 3W63A 2DNOA 2VPWB 3D0IE 5DS7A 1LWFB 1YBAA 2PIIA 2YY3A 4YFUA 5FDLA 2J5AA 2HQGA 4CO4A 3PFEA 1JLAB 1YJRA 3O3LA 2GC8A 4Y2IA 1RHMB 4DLGA 3LP0B 1UEVA 3BGUA 1HBUB 1M5VC 2HIYA 5KFUA 1S77D 4ZPWR 2CJYB 2LU1A 4ZJLA 2CQBA 1SKSA 3JSBA 4TN2A 4KO0B 3ENQA 3UDEA 2BJ9A 3KJQB 1XR5A 4LF9F 8RUCA 2IA6A 3AXKA 4RW6B 3RAMA 3GJTB 3MXHP 1ZTTA 2DNPA 5KT3A 1SI9A 2XZWA 1SH3A 4F25A 3MM6A 2OHDA 2GJIA 3K89A 5THWA 2D1CA 5KFIA 2VDHA 3DCAA 4WCEQ 3HFVA 4QW8A 1N8RT 1FI4A 4DR6F 4KHPF 1NJYA 5FDLB 2V34A 2J8SA 2MQLA 2LQJA 3KLEA 1V5VA 4CO5A 2CWKA 4B9TA 1NJIT 1LFPA 1F9FA 1Q53A 1I94J 3NXZA 4RW8A 4ED7A 1NZAA 1XNRF 1OY8A 5LSLA 2H1YA 1RWOB 2BACA 3CCWA 4Y00A 2HHXA 2CPFA 3A8EA 3M1VA 3LGNA 4WP9A 4DV1J 4CLFA 3D1QA 2W2OP 1VMBA 2NXEA 4QR2A 2DXEA 3AOBA 4NL5A 1DRZA 2B4PA 2JEIA 4PEOA 1RP5A 3MM6B 3FBBA 4OZ2A 3DN9A 5GMDA 4X4VA 7FDRA 2POKA 1XEZA 2C42A 4F4ZA 2ASDA 1Y7PA 2HRYA 1HD0A 2DXDA 1T11A 2X1AA 3TUIC 4UOGA 1G1XA 1J5EJ 3EGWB 1U1QA 1WG1A 3RU0A 3OT9A 1IKYB 3KLEB 3SXLA 3U27A 3AD8C 2QO3A 4I2QA 4MIAA 3GB0A 1TUGB 1Q7LB 3CSKA 2NREA 4M1KA 2VQFJ 2C3PA 4RW8B 1N34F 3OTDA 3PYEA 1JJCB 3TYTA 2BRKA 3D1OA 3HD2A 3NP5A 5AXMA 3J7A1 3M1VB 1WHYA 1NDPA 3O8WA 4LR7A 2R7TA 2CXEA 1RKJA 4QIGA 1RU2A 1AROP 4RL1A 1VQSA 2ASLA 1JXEA 1WHVA 2Q6BA 1AFIA 2ROEA 4UOFA 3HM9A 1FNMA 3FSIA 4NLPA 5GAGI 3VR1A 1MNEA 4OHVA 3QSYB 3S1TA 2CPDA 4L6V3 2HWIA 1QVFR 3FNNA 2ZHOA 1PAEX 3CC7S 4USWA 4JUZA 1VOMA 4I2QB 4K5SA 5C7PA 1ICEB 2MQ8A 3SCKE 2D9PA 3T5KA 4QCLA 1T3NA 2D9OA 3KKFA 3Q86A 1FE0A 4FYXB 1FFWB 2VIHA 4B9NA 3RR8A 4ZLNA 4N41A 3C66A 3NAHA 4DUTA 4K4YA 4ED5A 1KOOA 3Q8RB 2ASJA 5C25A 3RAQA 2CPYA 2DIUA 2HZAA 2J76E 3HVWA 2EFOA 1R0CB 4ZVRB 4DL4A 1D09B 3NL0A 4OZ1A 5KFSA 3KG4A 4H4OA 4A8FA 2VFTA 4ZPAA 1U1MA 1NBEB 3I5CA 4KHMA 4DV6F 2H5EA 1GFWB 2J6TA 4RO0A 4Z7CA 4LBIA 2XEXA 4GC7A 2GO9A 2VZ8A 1OO0B 1UKUA 2KYXA 1FTCA 5DDPC 4X66J 2MKIA 3N5FA 2VPZB 2DPIA 1HWIA 4F4WA 2QT7A 4RNFA 2QYCA 4OL8A 2WCXA 1C1CA 4LF5F 3MF5A 3P5BP 5BYRA 2CDRB 1YLXA 1OSCA 4OX6A 4ZLLA 2FGOA 4JI6J 5B0DA 1PYSB 4ZPBA 2UVUA 1VIOA 1QSSA 3EDQB 2GIQA 1O0PA 5C25B 3AAWB 4O4RA 2IMWP 3TR5A 3MWBA 1PIEA 2ZM6J 3TI0A 1VBYA 2BJ7A 4N8NA 2DEJA 1IXKA 3H40A 2GVDA 2IYIA 4H4OB 4B3RJ 1TV6A 1X60A 2HAFA 3ZTRA 3NNCA 3W61A 3D6TB 1EKSA 5KFWA 1DURA 3CCMS 1AA1B 3QAUA 4FP9A 2VG5A 4E8UA 4PXBA 1HW8A 3R6LB 4K50A 1RWWB 1NZ8A 3SI8A 2KFZA 1FRKA 3SQOP 2B9YA 2VD3A 1T9XA 5KTQA 4KH1B 1FDNA 2ZBIA 3TX8A 2J8AA 3AQOA 1C1CB 2CWXA 4OI4A 3IG1A 5F8HA 4HTIA 4HHHA 4X4UA 3LA0A 4YEAA 2XWXA 2RDJA 2DGVA 2XMWA 3KJVA 2DISA 5EUHA 4USIA 4R25A 1S6OA 3VZIA 1HR0F 2JWNA 2UVWA 3IGVA 1R8AA 4WTOB 1PJ7A 1NJZA 2GVDB 2YWHA 1GX5A 3MMCA 1U24A 2FVPA 2VG6A 1TV6B 2QX0A 2HQIA 2U2FA 5LOQA 2RB7A 1KKHA 2P8IA 3TP2A 2VG5B 2ZHBA 4QWCA 4JI5F 3A8IA 1GMWA 1VISA 4DL6A 2RU3A 1RTIA 5B7WA 1B7YB 5A6PA 4QWDA 3BSCA 3IG1B 2NSCA 1WC3A 1NKCA 4M8LA 4TLQA 3BQ1A 5A8RA 1JKHA 2B5JA 3NGSA 3KJVB 5CZCA 5GADU 4PWUA 2BE7D 3LWMA 3DLHA 1LK5A 2WAQD 2W4PA 1MN7A 2QG9B 1S12A 2NXCA 4J9QA 3LGMA 4C0HA 1WELA 2COLA 3F73A 1N33F 5KFQA 1YJTA 1FNOA 4YHHF 4OI2A 3MMCB 4WFNQ 2VG6B 2I2YA 1K0TA 3FCVA 3TUPA 1X4FA 3QT8A 2A6MA 1HBMA 5L39A 1T03A 3BGLA 4HHUA 1OS5A 1YWXA 4IR9A 5B0EA 5CYQA 2AX1A 3QATA 3QO9A 2HQFA 3AT1B 3F0NA 4WF9Q 1B70B 4ILRA 2VQEJ 4DL3A 4KRWA 1FA0A 1SL1A 3KOAA 3A3NB 2CNOB 3H5SA 5DQHA 4WP3A 2NZ4A 1RTIB 3EM1A 4Y6IA 4FPIA 5D4PA 2F63A 4RBVA 3QGHA 1RA6A 1ZPWX 5A8RB 2MSSA 4A4JA 1JKHB 3HHLC 3JQJA 4B9VA 2B5JB 4OJ1A 1PAUB 5DZ7A 3EXCX 5C24A 4OHWA 3EYZA 4KGZB 4O3QA 2M88A 3CJQA 1VQKS 2VDIA 3UFCX 3AA9A 2YNFA 4BBYA 3GFXA 4LFBJ 2L9WA 2WVFA 1KTQA 4ED2A 3GIIA 1HBMB 1YKWA 4NZ0A 5HQLA 1T03B 5DGBA 3DHXA 2UXCF 3GFZA 1ZM3A 1YK9A 2WSFC 3H4DA 3RAXA 5CYQB 5EDWA 1AT1B 3QO9B 1RTZA 2W4CA 2HZCA 2SXLA 3T1YJ 4AMNA 4K5RA 2GA7A 4RUHA 3LP2A 2LA4A 4L76A 3MOZA 5KG1A 2OPRA 2AP6A 3HKZD 3CTRA 5KFTA 2D3ZA 2E5GA 3FC9A 4MJKA 5CQGA 4N8OA 5JVHQ 3RBXA 4R0JA 1VBZA 2LU2A 4RW4A 4NZ6A 4EUVA 3QRPA 5ETMA 1NK7A 3OHBA 4ZA1A 5C24B 1QUVA 2HAIA 1L5UA 3CD6S 2MQNA 7FD1A 1JLFA 4DV7J 4FXDA 1WKJA 2YNFB 3GYNA 2ZUGA 3MMJA 2RAQA 1UA1A 5HMYA 5L9NA 4C8NA 3QT7A 4EZ9A 3D0HE 2ROGA 4JV1A 3MM5A 1NSPA 2V6AA 4AUKA 1GK8A 1X5PA 2CPZA 4L72B 1EAYC 3QT6A 1TELA 4PQAA 2EK1A 3MCSA 2BRLA 1Y11A 1AB8A 5D8HB 3ICLA 3UWTA 3LP2B 1RBAA 2KJVA 3OVBA 4P2FA 2E7WA 4DSIA 1UWAA 1W2BR 4LF4J 1ZOTA 4QIVA 1FXLA 1SUQA 2OPRB 2ZD1A 4KBIA 2ACMA 1NSKL 2QL7B 1K9MT 4H4KC 3GIMA 2RUSA 3P8BB 3Q8PB 1U26A 4X4NA 1I5OB 1YZ6A 2J7WA 3ILLA 4RW4B 3IWXA 2FB0A 4UT4A 2VHGA 4CLTA 3IAM9 4U96A 3ZZPA 3R7BB 2FHJA 1JLFB 3CIZA 3BGRA 1MG7A 1IVZA 1VI7A 4UQGA 1GXTA 2E1PA 1HYSA 2ZVSA 4KTQA 2FGCA 3MM5B 2XB2D 2XMUA 1QTNB 3D4JA 1E6YA 3H8YA 2HRUA 2HLUA 2R2RA 2YX7A 3ISNC 4X4OA 4MK8A 1HQUA 3LTOA 3VGVA 4QWAA 4Q44A 4FS1A 2ZH4A 4FBTA 4WE1A 3PKMA 2YWGA 4K0KJ 1S1XA 1SUQB 2ZD1B 2OI2A 2MZ1A 3MTKA 3KHRA 5CCMA 4PXDA 3R2DJ 5KT6A 5LSRA 1H72C 2EVZA 2CQGA 3RTVA 2BJDA 4JI8J 5I3QA 5GVQA 2E5IA 1HBNA 4CO2A 2GVZA 3B8HA 1HNXF 3BGRB 2E5HA 3I9ZA 2VBWA 3NEKA 3UPFA 3HXMA 5KFJA 1N52B 4FYDA 2J0WA 1RHRB 3VQSA 1HYSB 4CO1A 1YJUA 4IDKA 2VFRA 3E3XA 2IVFB 1OMSA 3W8PA 1E6YB 3NRBA 1J2VA 4GKKF 3A3OB 2KT3A 2V2VA 3NGKA 3SSRA 2K3IA 2YPYA 5J2NA 3UDCA 1TK8A 1GX6A 2FHMA 1HQUB 3KLIA 5KG2A 2MXYA 3AH6A 3GV5B 4YB6A 4YB1P 3KUHA 2BE9B 2RSQA 2CFXA 5CZXA 5HLFA 4WE1B 4F3QA 4UY85 1S1XB 1T7PA 1D8ZA 1JQGA 1BGXT 2EKNA 2HNZA 3KUEA 3GJRB 3QZ8A 1I3OB 3BB5A 1VC6A 1ZA1B 3B4MA 1CEZA 3QNWB 1P1TA 2E66A 1AUDA 2YKAA 3AFGA 1RSCA 1ZTWA 4ZJQA 1Q82T 1ELOA 3QIPA 1HBNB 4EWTA 4AYBD 2GVZB 3H2VE 3N01A 3R5AA 2Y0SD 2LQ9A 2XMKA 3GE9A 2DHSA 4FDFA 3HF5A 1S1TA 2H4WB 2IDEA 4ANEA 3TZZA 5EGYA 4K2JA 2HK3A 2RQKA 2K2PA 4IDKB 2WVEA 4P9SA 3IWLA 3D54A 2LFVA 3UCZP 2IVYA 4QYZJ 1Q16B 2VICA 4M5NA 4ECXA 2K7KA 4MIBA 5J2NB 1TUWA 1KR4A 1K73T 3M6XA 1RBLA 2MQMA 1J5OA 2XLJA 4P75A 5HLFB 2OPQA 4WYWA 2GZOA 4NA2A 2CVIA 2DPJA 2AF6A 4DX7A 1S48A 3MD1A 1X7VA 2HNZB 4DV4J 4NLWA 2DGTA 3R7SB 4WXOA 1UFLA 3NMRA 1WOSA 3LWLA 2GCFA 4JI3F 4MIWA 4OYOA 3QIPB 4M63A 2RDIA 3BKTA 2YQ3A 2GAGC 1KNZA 1JJHA 2X1GA 3SCLE 1TU0B 2KG1A 1N5TA 1RHQB 1X9SA 2JZ5A 1OSDA 3HVRA 4FYVB 1S1TB 2KYZA 4CT9A 5FLXY 4HL9A 3DXBA 1S79A 2GW8A 2VUGA 4YOEA 1VQ8S 4I67A 2MZTA 3J80U 4ED0A 1DBDA 2JC0A 3CO9A 3RB4A 1X8DA 5LMUF 2XSJA 1J5OB 3NNAA 2VPYB 9ATCB 4XAKA 1FJCA 3UI3A 2I38A 2R9LA 2OPQB 2MTLA 3HCXA 1UVMA 2UUCF 3DI6A 5IT4A 5KAKA 4B3OA 4J9LA 4B3MJ 2V2QA 2YNGA 4Z37A 3J81U 4LT6A 3H59A 2XSFA 1KQSR 2KVQE 1SL0A 1XR6A 3U7JA 4N47A 4XK8C 4DR2J 3CCES 2C28A 1RJJA 3T6JA 3HFKA 3MAQA 4CP5A 3ET6A 4I1TA 3GMGA 5KFAA 5EWGA 1Y9OA 1RT1A 1A6LA 3A4TA 3MPDA 4LMZA 3BSAA 1PSDA 2XCPA 2RHSB 3PTWA 4TXSA 2DXFA 3DDNA 1SV5A 3PW0A 2HFSA 2J9DE 4J90A 1ZPVA 4KB7A 2VJUA 2B8PA 4X66F 2YKOA 2XSJB 1MWQA 1NCLA 3OXLA 3NCRA 5AXKA 1JMTA 2G1HA 4KGXB 2QZ8A 3NAIA 3T5JA 1U49A 1FD8A 1X4HA 2DVIA 3DI6B 5HP1A 4B3OB 2YNGB 2MZRA 3AOCA 3UDLA 4ZPDA 1SQFA 2IIHA 2RIJA 4GO5X 1SJRA 3PY8A 2CJKA 1KN6A 1UVIA 2QV6A 1FTRA 3M9OB 3B78A 3Q8UA 2CQ0A 3ET6B 2ZM6F 3TAMA 1UMJA 1RT1B 1K8AT 5HBMA 3H2UB 3NOCA 1U25A 4C98A 4DCOB 5L1JA 1VS3A 4XDDA 5KT2A 2X3DA 2CQ1A 1BUXA 1U6FA 3GQCA 3QWPA 3WBZA 1YX2A 1SV5B 2D3UA 4JV5F 3V2UC 4NA1A 5IC6B 1OYEA 2WW8A 1R43A 4FF1A 1E6VA 5CA5A 1X4DA 2GJ2A 3CB4A 3KLFA 1P8GA 4H54A 3TOQA 1OY9A 2XS5A 3M6UA 1A7GE 4J37A 4L74A 1RTDA 3JAMY 2VONA 2LXFA 4LUBA 4ZDNA 3GV8B 1PO6A 1R0AA 5HP1B 2KXFA 3R8YA 4HH0A 1CG2A 5KFLA 3SQGA 2M9KA 3M30A 1IKVA 5A8WA 4QYRA 2X1BA 1SJ3P 1RT3A 3PEJA 4F0KA 4J9SA 3RRKA 2ADBA 2CZVC 3TAMB 1U8SA 3HI9A 1R31A 1UP1A 2YXLA 5HBMB 3C15A 4NXMF 2XMAA 3FDSA 5D0RA 1DHMA 2CKWA 2EXUA 3SYZA 1F3FA 3KNGA 4YN3B 1QY7A 2NPIA 3MMBA 1UZDA 5A76A 3DDKA 3MTJA 1FRLA 1JNRB 1E6VB 4X84A 3T41A 2F8MA 3I96A 3KJFB 3KLFB 4NEZA 1U2CA 2NYIA 3IBFB 4Q0BA 2B8QA 1R8HA 1M5SA 3VGUA 3C14A 1RTDB 4PZVA 4DFMA 1Q5YA 2Y1LB 2ZNZA 4MKAA 2EFNA 3DLEA 4RLEA 3CE8A 1M5PC 1R0AB 2B7BB 1WTBA 1FVQA 2ZKUA 2HFVA 4DX5A 3G6ES 4USKA 3SQGB 2XLIA 2OKQA 4EMDA 3M30B 2ZUAA 2XZTB 1IKVB 5A8WB 2O1PA 2AHOB 4OYBA 3CJ8A 3DU6A 4LF7J 1RT3B 5LXRA 3R3TA 3LPYA 1VHIA 2EC0A 4JB8B 5LMNJ 3EGZA 2DHAA 3C15B 1RABB 3R1LA 3VAMA 1T9TA 5HMXA 1DQAA 4MT1A 2RS8A 3MMBB 3IP0A 4P52A 2CQIA 1XNQJ 3GFYA 3PW7A 1VJWA 2VFUA 5KFOA 4Q0BB 5J2QA 5K14B 1B64A 5T41A 2Y0BB 2VQEF 3C14B 3GG0A 1SC6A 4LFCJ 3C16A 2OSQA 2O5DA 1SB6A 3DLEB 1UCNA 3IFEA 2HFUA 5AXLA 4PG8A 5B08A 2CNNB 1BC6A 2R7UA 5HK4A 2WB1D 4CH0S 3GTYX 1RWNB 2N7YA 3ISZA 4JI2J 2CQPA 2GNKA 1FXDA 1NUEA 2ABYA 2HGMA 1LFWA 1YI2S 3OV7A 1C4CA 1B4SA 2IRUA 2L9DA 4UTGA 4O3OA 4ZVFA 1TFYA 4NLUA 4YQWA 1LWEA 3H98A 3JSRA 1SVDA 2OSRA 3AY0A 5DG9A 2RVJA 3PM9A 4PUOA 5GAEI 1NKBA 4DEZA 5AE1A 4MTPA 5J2QB 1VQPS 1PYOB 4F4XA 2CG4A 2HFNA 1ZM4A 3EVWA 3C16B 2FZGB 3N28A 3J81j 4OQJA 2GX8A 2M2BA 1S7IA 2W9AA 2MHNA 5F8IA 5DJBA 2AWZA 2O67A 2QLBB 4ICLA 3U1LA 4DF4A 4P2SA 4WJBA 2ZBRA 2DH9A 1YZ7A 3I4HX 2IA0A 4LVNP 2YH0A 3D6HB 4ZCKA 1Y10A 2EKYA 5HO4A 1TQLA 4LF1A 1Q78A 2ZWPA 1D9AA 2DHGA 4DV5F 1DZ5A 3RRHA 4LF9J 2RILA 4B9SA 2WZ1A 2LEBA 4EYHB 3M32A 2HHHF 4LRAA 1X4GA 2BJ1A 1ZAVA 2UUAJ 1T3OA 4OYIA 1LWEB 3VWSA 1OPZA 1HWUA 1FF2A 3UR3C 2ALYB 4OYMA 5C2CA 5DGAA 1N5QA 2E7VA 4PUOB 5KFVA 2PMZD 3V6HA 3GIJA 4DR6J 3BR9A 4F36A 1FE4A 4OIXA 2FZCB 3OQ2A 1IKWA 3DOLA 1AUSL 3US5A 1Y4ZB 4X64F 4ILMA 3H5YA 3JTNA 4USMA 1X0FA 4ICLB 2FVRA 4DR1J 3EVOA 2FVCA 1FDDA 3CUNA 1NSQA 4AL6A 1AXQA 1XNRJ 5M2PA 3HO1A 1TFWA 4J9NA 3PVXA 1VQOS 1H38A 2RDDA 2I6WA 5JMNA 3IBCB 2F40A 2B7CB 5A2QY 2ILZA 2DH7A 3T1AA 3J7ZT 3IRWP 1PCAA 1GNKA 3IN5A 4Y2CA 3OL6A 2GQCA 3ISND 1FK9A 1JB0C 1RHKB 3M32B 1YITS 3AOAA 1QM9A 3QZ7A 1S0OA 1UFWA 4I6YA 1NM2A 3IA0A 3Q22A 1V3RA 4ECUA 3BM7A 3E01A 5HATA 2LQ8A 2JLGA 1IN0A 2GHPA 5DG7A 2JLFA 1LXJA 2DNHA 4A8QA 1IKWB 3DOLB 3W64A 2CQ3A 2NSBA 1IM6A 2F7VA 3TO8A 3W8GA 1KSPA 1Y3JA 3QFWA 2OPPA 2AT1B 2JJ4D 2IFXA 2A2DA 1V9OA 3K5OA 3SFGA 1CULA 2CQHA 1CS4A 4CZCA 3HHKA 3G96A 5ETLA 1RE1B 4Y65A 4I6AA 2BUNA 4WP8A 4O3PA 1K0VA 2KH9A 4Y3CA 5AXNA 3NNHA 2AYMA 4ECZA 1V3SA 2QMUB 2ZZTA 1FK9B 2CJQA 1AW0A 3MECA 3HKWA 2HFOA 5E3PA 1BMQB 2DHHA 4CWBA 4A8YA 5KFHA 3ZNJ1 1EJ7L 2I0XA 5RUBA 1VQ7S 5C2GA 3K7RA 3OFHA 3E01B 1KVJA 2BBEA 2W4DA 2HHSA 4X4PA 1HNZJ 1HPZA 3MR7A 4DJBA 4N76A 5ITHA 4NLQA 2K8GA 4I2PA 4ECYA 1TL4A 1IBMF 3R5BA 2V9KA 2OEMA 3EWGA 3W5ZA 5DQIA 5KT5A 4EFAC 4TU8A 1U0SA 2OPPB 4ZN3A 3CMAS 1IWGA 2IM0A 2AIRB 4ZLPA 2EFQA 4DG1A 2NUUG 1AYEA 1RWXB 1CULB 2V4RA 3KK3A 2ZWOA 1CS4B 3A13A 2XULA 1T0TV 3H0PA 3JYTA 2AEMA 1SXLA 2ZOMA 4ZCIA 2DY1A 2RD5C 3KTQA 3OFEA 2IVMA 4B02A 4URSA 4BLGA 1SJFA 1CLFA 2AEFA 2K1RA 4C48A 2BM0A 4WKRA 3MECB 2A10A 4B3TJ 2DGUA 2MGZA 2CNKB 5FD1A 4Q2LA 2B9WA 4FNHA 4P7VA 5HI7A 1SCJB 5EHHA 1HPZB 3DLLQ 3TUJC 4DV6J 4I69A 4DU7A 1REGX 1TKTA 1UTAA 4I2PB 4LSLA 4ZLJA 1RA7A 5KG0A 3NGUA 1FKPA 2DGSA 4LSNA 4IH5A 2MLYA 3PFOA 2CPXA 2OELA 4DV4F 2AJ0A 3PR4A 4GO7X 3PYGA 4DG1B 3GPAA 1OYDA 4NLVA 1N32J 4LF5J 1S76D 2YWFA 4DL7A 1CC8A 2VA2A 3KK3B 1Z2ZA 1QUPA 1ZS6A 3MUMP 3N6LA 3JYTB 2Z2MA 2MQPA 1UVLA 2ZVIA 4LF6J 3RB6A 4PQUB 3E51A 1Q8LA 2V69A 1LKZA 3O6QA 2ZH2A 1DTTA 1A0OB 1RQ0A 3IMQJ 3HP6A 1V6HA 1PGZA 3MGJA 2K1RB 4NXNJ 1UVNA 2VZ9A 3KYLA 1L3UA 9RUBA 3K5NA 2MGZB 1WF2A 3ONQA 2BR0A 2BOAA 2NR0A 2NPFA 2AEJA 4ZITA 2D3OR 4JI1J 2A0FB 2MZQA 1S97A 4KGKA 1TKTB 2DNLA 1TTHB 3CDWA 4LSLB 4S0MA 2FC8A 2C3MA 4AFFA 2UUBJ 1FKPB 4LSNB 4DX6A 3HVTA 4RJVA 4IRDA 4IUFA 1QD1A 2YQ0A 2KU7A 1F2GA 1VRQC 3G2XA 2XMTA 3UW1A 1B0VA 5ETOA 2HHPA 3MEKA 2QLWA 4DQPA 3PNIA 2XS7A 4NLGA 5T7LA 2QL5B 2G0IA 4KHRA 2F8HA 1SJ1A 5D0EA 1CJKA 1SKRA 2DD8S 1S99A 4JI7F 1Y00A 1HR0J 3RRGA 1DTTB 2FYXA 3W2WA 5D3GA 1PC4A 1BWEA 4NYPA 1FVSA 1RKIA 3BZQA 1QTMA 5BXIA 3P3DA 1S49A 1KDNA 2KVIA 3D0GE 5DM6Q 3CDAA 1LNQA 2NCKL 1FT8A 1HKAA 1LEOA 2GV1A 2RT3A 4J91A 2RRBA 2JNJA 1C4AA 2MZJA 2HKEA 3ENWA 2CIMA 4DCJB 1ZH5A 2ZZNA 4KIAA 3NKYA 3HVTB 3EJMA 2QMXA 3W9IA 4ZPCA 1SBRA 3I32A 1FRMA 3F44A 3R5DA 1S9EA 4N77A 4M5KA 3S01A 4FPRA 2H65B 3CPWR 1RU1A 2CG8A 5T7LB 1J27A 1CJKB 1HW9A 2MQOA 2DEIA 1XTZA 3IAS9 1UW4A 2G0JA 2VH7A 3W2WB 5D3GB 3FMWA 3V5RA 5CD4H 2VA3A 2C3OA 2RH3A 2R2UA 1N33J 1NHKL 2Y9HA 1FDBA 3CJ2A 1WDTA 4OI6A 2DRAA 4CLSA 2AYBA 2PI4A 4EU0A 3MM7A 1KHWA 2YH1A 2KKHA 3G4SS 2PEBA 4DXLA 2FLNA 1ZETA 5IM0A 3MOJB 1L3TA 4MFBA 3OUYA 4IG0A 1IQZA 3I6PA 2LQ5A 2KDOA 1TP7A 3C3LA 1UWBA 3LANA 3QGIA 2Q66A 1RDRA 1ZM9A 1IJEB 5JVGQ 4W98A 1S9EB 3FFIA 4FNIA 2BXJA 5KOXA 3CJTA 3VZHA 4C0OC 3EXYA 3OTBA 3D5MA 2PD1A 4WIIA 1DQ9A 2HS0A 4IRCA 4FN5A 2LKZA 1QAYA 4AL5A 2C2KB 4OYPA 3I87A 4ZP9A 3CULA 3G6YA 2E29A 4M5MA 3EMTA 4CLLA 3MM7B 2UXCJ 2BJEA 1YHQS 2IJFA 1VGYA 3MCOA 5IM0B 4DR7F 2LXIA 1C1BA 4MFBB 3OUYB 1WACA 4IG0B 2BW2A 1UWBB 3T9ZA 4KY3A 4PPDA 1N36F 3T5HA 3PZPA 1WHWA 3M05A 3VAJA 4KQZA 2QEXS 2LDIA 1SC1B 2VV5A 3VAFA 1N5YA 1M5OC 4LF2A 4IFYA 3KG1A 1MWZA 2R3VA 4PXCA 3BPSP 1BD6A 4DV0J 2V4QA 3U1NA 3OLBA 2XBPA 3NCPA 2VOOA 5IQQA 3WZ0A 3PO5A 3MURP 4L3NA 1RWPB 1SIWB 4BDPA 5EX0A 3UNYA 1DTQA 4J9VA 1UL3A 3OL7A 4G1QA 2KJWA 5JXSA 4DFPA 1ROFA 2JL9A 1RAGB 1C1BB 1IBKF 2RRNA 3HHNB 3IC1A 5DLFA 1LW2A 3EPIA 1F9EB 2R4FA 2ILYA 2IPOB 3ILOA 4JI2F 2YX1A 3V4IA 2Z2YB 2BKPA 3T3FA 2UUWA 2UUTA 3OTEA 4WFBQ 4F67A 2G2ZA 5BYQA 4X2BA 4OV1A 1WKLA 3E2EA 1N5YB 2PA3A 2KRRA 4IFYB 2EFVA 1YJVA 3P96A 1TKXA 3MAAA 1W26A 1WSRA 1TK0A 3Q8VA 4J9UE 3DYAA 1M5KC 2ZE2A 1O8BA 3AB2B 4HI2A 3VTIA 4C3MA 4Y34A 4DF8A 1FFSB 5DDRC 1PILA 1B3TA 4DBQA 4EGLA 3C2PA 2NXJA 4IO1A 3LH2S 2OEKA 4OZ5A 1Q81T 3FCHA 5BR8F 4A8WA 1DTQB 4KE5A 3B6BA 3I5BA 3LP1A 2MKYA 4G1QB 4OFZA 1RYRA 4B9UA 2H5IB 2VFSA 5IXUA 3TNVA 3FRYA 4PG4A 3DKDA 2XS2A 4RW9A 5KG5A 3KK1A 2AGOA 2QA1A 4PCQA 1LW2B 4QIWD 3ILIA 1NH7A 1RTHA 5ETKA 2VB6A 2PFDA 2YKNA 4IFVA 1DAXA 5I3PA 2ZC3A 2BQRA 1OJ4A 3BQ0A 3V4IB 2OD6A 4QU6A 3KHHA 5F9NA 1T9WA 4DWIA 3DM2A 2P9CA 2QMWA 5E3RA 4EI2A 3J7YI 3G8SA 2KM8C 3P49B 3FBFA 3B4DA 3H42A 5BYSA 2V50A 1TKXB 2FY1A 2UUAF 3MAAB 1HWKA 3DYAB 1HNXJ 2ZE2B 3AXMA 5H9FK 1LK7A 1Y5IB 3QBCA 2V8PA 1N4LA 2X51A 4J9MA 1H0HB 6FDRA 1PKUA 2CUYA 3PX4A 2G13A 3QAEA 1N48A 2ZITA 4JV2A 4GKKJ 1P9YA 4I7FA 2JFKA 3EE3A 3LP1B 3HHEA 4DFKA 3L7UA 5L8RC 1JK9B 1RADB 4OMFG 1XERA 1FFGB 3IRXA 3KMSA 4DR1F 5C42A 2HVDA 4RW9B 2W2PP 3KK1B 3G6VA 1TMMA 4YB5A 2EK6A 4GMKA 4DL0C 4FF2A 3CD0A 4KKOA 1RTHB 1FRJA 2AGPA 2YKNB 4IFVB 2UXDF 2DNZA 3CNQP 1URNA 1ZAWA 3DM2B 4TU7A 4AMMA 2RNEA 5IOLA 2XQCA 3IO1A 1TAQA 3PACA 4L75A 4F02A 2BV3A 1H98A 1TR0A 3W62A 3ETMA 3OVSA 2HQDA 1CJTA 4Q8EA 3PX0A 5CZVA 3M8QA 1B0TA 1MN9A 4JBCA 2DHXA 3QPIA 5KFNA 1BWVA 3UD3P 1X5SA 2ALZA 4DX8H 3GSDA 4I7FB 4NLOA 5I3UA 3DRSA 3NGDA 3IRXB 4EYIB 5C42B 4Y2KA 1MMDA 1A9NB 3RR7A 3W65A 2CJBA 3AA8A 3K57A 1S10A 3VQTA 2UU9F 1NJXA 4KKOB 2L9NA 4U8YA 2D7SA 4FF3A 2DO4A 3PDNA 2WRMA 4DN0A 3VALA 2ZKTA 2BEFA 4YMEA 4F4YA 4PPZA 1LWCA 4JI3J 3I0SA 2QRRA 2FIUA 1B99A 3SV4A 5T14A 5L1KA 4HYKA 4DZDA 1CJTB 4WWSA 4NRUA 4LJMA 5B0FA 1M1HA 1H7XA 3M8QB 1HNZF 3HHLA 3AB4B 4RU2A 3AJ2A 3ZXWA 2HMIA 4XPCA 4DPUA 1QAJA 3AD7C 2VF3A 1VDHA 2FY8A 2DNGA 4JOUA 5I3UB 1QVGR 5LMUJ 3DRSB 1FNXH 2AJ1A 2C22A 2EBGA 3C6TA 2PEHA 2UUCJ 3BBBA 4ZIWA 3MPVA 3CWJA 1BLUA 3I56S 1S1VA 2QA4G 1UPMB 2Y8YA 3HLUA 4MAKA 3JTPA 1GMWD 1S59A 1R89A 2VL1A 2N4CA 1LWCB 3OR2A 3I0SB 3K2YA 4EO8A 4B3TF 2K7JA 3KLGA 5K8MA 4ZVHA 1KD1T 1DJ0A 5E0OA 4ED4A 4PYDA 2V67A 2I8EA 5KFKA 2WBMA 2XY7A 3HHLB 3KLVA 3M6VA 4WFYA 4YDXA 4NX9A 1VQ6S 2OFGX 2HMIB 3MD3A 1JLEA 4IOCQ 2J6UA 3W2VA 1WI8A 5A0YA 3WIVA 2CQ4A 2ZH7A 1H3DA 4P2XA 3OSPA 1XMQF 1RT6A 3C6TB 2FLPA 1F5CA 1HI1A 3EUNA 1N32F 4UUWA 4NCAA 2XCAA 2ATCB 4UOHA 1S1VB 3BEGB 4F04B 3VAGA 3JTOA 2HURA 2A3JA 3E8OA 2HS4A 4LF6F 4DCPB 2DNNA 2LVWA 2OTJS 4NXNF 2EFGA 3OR2B 1U2FA 1LV5A 4CO3A 4ZP6A 3KLGB 1N0UA 1QAXA 1V3ZA 1EARA 4JV5J 4JI1F 2C2OB 1U45A 3UN2A 2H3EB 2CVEA 2UUBF 1WG4A 1JLEB 4LREA 1Y0HA 1HI0P 3W2VB 5A0YB 4IKAA 1VBKA 4YR3A 1DARA 4BC9A 1KWMA 4ID5A 1RT6B 2E1AA 4O3SA 2PDAA 2KO1A 3NLCA 1WKKA 3NG8A 3ZC4A 5J1NA 1BQMA 1N5SA 3RW6A 3CF5Q 2UXBF 4F0MA 4ES2A 4C97A 4B3SF 2WHOA 1Q7YT 2XY5A 4E2FB 3A1YG 1BHNA 2EPIA 4GRSA 3KWMA 3LQVA 1RACB 2XGQA 2PGCA 4AD6A 4KV8A 2HGLA 3DGPA 4NXMJ 1F9HA 4TYBA 5B09A 4NCGA 4WZQA 4C0BA 1U48A 3TA0A 4G1IA 4OYXA 3SIPB 2JRSA 2DR9A 1MMNA 4USVA 5L46A 3UVJA 3K58A 1YRTA 3EGVA 2FD2A 2P9GA 3KXDA 2VJVA 2D41A 2B9EA 1UA0A 2FJAB 2LMIA 1NK5A 1WORA 4X4TA 1U1OA 1VQYA 4USHA 3N6NA 4ID5B 2BABA 2MLXA 4O4GA 3P4UB 1WOOA 5EX3A 2R7VA 1URRA 4ZK7M 1CQMA 4GVBA 3PRBA 1N6QA 1BQMB 1UETA 2C2EA 3GONA 1Q8BA 3UO0A 2FLLA 4CQ1A 5DETA 4LFAF 4ELVA 3PYDA 4X4RA 5LM7E 2WOMA 1Q8KA 2R2SA 3GR1A 2MEWA 1VK8A 4KV8B 3DGPB 4Y0FA 5GMEA 1LXNA 4NCGB 3M4XA 3DNCA 1U6BA 4QWEA 4TQRA 3VVTA 1TK5A 4K8RA 5D0GA 2OP5A 1SH2A 5GAHI 3M6WA 2E5LF 2DRDA 4WFXA 4RU9A 3NY0A 2FHJD 2WK4A 4DQSA 2HYIB 3UVJB 4NCBA 1GXLA 1IBLF 1NHVA 3SMZA 1S5ZA 2AGQA 1CQNA 4K4ZA 5HMWA 3EZOA 3NOGA 1V5IB 4AT1B 1D0EA 4HH1A 2A2CA 5LT5A 4O4GB 3TARA 2Z56B 2DNQA 4M5LA 2E5JA 3EGNA 4DQRA 4GVBB 1Q86T 1N6QB 1XMBA 3GP9A 4ETXA 5CHCB 4OX9F 1SKUB 3K5LA 4ER8A 2WOMB 3CDEA 3WX8A 1VBXA 2UV8A 5H9EK 3OSNA 3KHGA 3CJ5A 2QLJB 4PYAA 4FYWB 3GCWP 3HSZA 2MSTA 2IBOA 4CH1A 1VFJA 1F60B 3Q0AA 1UEKA 2XMJA 4FF4A 5CYMA 3QMQA 4HLBA 3N4WA 5AE2A 4O3RA 2KT2A 1JX4A 4AXJA 1PYTA 3TEGA 1CSJA 2RMLA 1C2PA 4IQMA 4W90B 1KEKA 2V8DA 5D4NA 3W9JA 3UN5A 2F4VF 4F2RA 1VQ5S 3PHEA 3OFGA 1FEEA 2KI2A 1P9QC 1RB0A 2KFYA 1YRXA 4LBHA 2IY5B 2HNDA 1RAAB 3BKFA 1JLQA 2JVOA 1AZSA 3HZGA 4LRDA 2BA9A 4K4UA 2W9CA 5KT7A 3KK2A 3J80Y 4QIFA 5BJRA 3CXCR 1FJGF 1B0PA 4OZJA 3ILJA 3THPA 1RT2A 3MEGA 4DV5J 4DV0F 1R6VA 3UN3A 4WXWA 4OZ0A 2Y8WA 2XMMA 2HHHJ 4K4WA 3VCDA 3LW5C 2HBRB 1G7CB 3RB3A 4A48A 4YB7A 4CLKA 4DQQA 4QYZK 3F41A 2H48B 4MH8A 1TL1A 4B17A 5CYMB 3J81Y
chains in the Genus database with same CATH topology
1QLNA 3O5TB 3PV8A 4K4YA 4ED5A 2OPPA 2JJ4D 4B3RF 1U09A 4QOTA 4OJGA 1KOOA 2IFXA 5A6WA 3O1LA 1UVKA 3Q8RB 2A2DA 2HHUA 2ASJA 1V9OA 3MFHA 4DL5A 5C25A 3FGVA 3K5OA 3SFGA 3V6JA 5I42A 3RAQA 2OH2A 2CPYA 2N82B 2DIUA 2J76E 3HVWA 1NNDA 2EFOA 1GQEA 4RBTA 5KFFA 1OWXA 2CQHA 2RQCA 4J9RA 2E1CA 4DL4A 4NMLA 2R8JA 4CZCA 3HHKA 2DK2A 4IYQA 2VBZA 3G96A 3QYYA 2O66A 3NL0A 4OZ1A 2ZH8A 2E9ZA 3OL8A 1NK6A 1NH8A 4Y65A 2C3YA 2BUNA 4I6AA 5KFSA 3V6DA 3TAPA 1Z1ZA 4O3PA 3KG4A 2CQ2A 2JEJA 1TL3A 1K0VA 4H4OA 4B9MA 4A8FA 2VFTA 4ZPAA 3RGIA 3TRGA 2KH9A 1U1MA 4Y3CA 2GQ2A 3I5CA 3RBDA 2KZMA 4ZP7A 5AXNA 4KHMA 2HNDB 4O44A 4DV6F 3NNHA 3ZZOA 2H5EA 2AYMA 4ECZA 3I31A 3TA1A 1JLQB 1V3SA 2J6TA 2QJ3A 1FK9B 4M5DA 2AYGA 4IG3B 2XEXA 2YWKA 4GC7A 2GO9A 2CJQA 2VZ8A 1AW0A 3BS9A 1OO0B 3MECA 3HKWA 1UKUA 2HFOA 3KK2B 2J6SA 3LAMA 4ZMMA 2CQCA 5E3PA 2GO8A 5C5JA 4ZHRB 3IR6B 4A8YA 5KFHA 2KYXA 1LW0A 1FTCA 2I0XA 3L95X 5DDPC 4HT5A 1T02A 2V9WA 1I6JA 2YWEA 3BN4A 1RT2B 3HX9A 3MEGB 5F41A 2MKIA 4NLDA 1VQ7S 3K7RA 2MY7A 3E01B 3N5FA 1JLCB 2AX0A 3OFHA 4ED1A 1KVJA 1EETA 2BBEA 4TY8A 2W4DA 2HHSA 2VPZB 4X4PA 2DPIA 3FFIB 1HPZA 1HWIA 2CDQA 4F4WA 4CIOA 2M0GB 2QT7A 4DJBA 4N76A 2EBEA 4QPTA 4XIUA 5ITHA 4RNFA 2QYCA 4NLQA 4OL8A 2K8GA 3PRDA 2WCXA 1C1CA 3VF0B 3MF5A 4C7QA 2I1RA 4LF5F 3FZBA 3FEZA 4I2PA 2IYGA 5DDQC 1M1KT 4ECYA 2LXUA 1TL4A 2B43A 1IBMF 4K4VA 1GTHA 3R5BA 2V9KA 3I5AA 5BYRA 4P7TA 1S6PA 2DGWA 1TL1B 1OSCA 3T6BA 4OX6A 2FVQA 5DQIA 5KT5A 4EFAC 2VC1A 2FGOA 4TU8A 4J9PA 5B0DA 2V2KA 5MAOA 2OPPB 4ZPBA 2UVUA 3JSMA 3CMAS 1VIOA 1QSSA 2VG7A 3M2RA 2IM0A 2GIQA 2RKIA 5DO2A 4ZLPA 1U1KA 1UJ6A 2EFQA 4DG1A 1R6YA 1O0PA 4J9OA 5C25B 2NUUG 3AAWB 4O4RA 5I42B 1HI8A 2IMWP 3TR5A 3CCTA 3MWBA 2V4RA 3OBIA 2UZAA 3KK3A 3TI0A 1VBYA 2HWHA 2XULA 5HROA 4N8NA 1IXKA 3H40A 4WKYA 2IYIA 3H0PA 3JYTA 2IHR1 5K14A 1SXLA 2FJEB 2ZOMA 4ZCIA 3FSYA 3V6DB 4KPYA 2RD5C 3KTQA 2DNKA 1TL3B 4H4OB 3OFEA 1VIXA 1TV6A 3IS9A 4JI0F 5GAGU 5JUMA 3MM9A 1CPZA 4Y2AA 3CT9A 2G1DA 2KTQA 3CCQS 2IVMA 2D74B 4B02A 2KG0A 4URSA 3ZZUA 3NNCA 4O44B 3NS6A 1SJFA 1CLFA 4M5DB 5KFWA 1KTVA 2K1RA 2GIRA 1U6ZA 1K1QA 1DURA 2BM0A 2GHWA 4WKRA 3MECB 3CCMS 2A10A 3QAUA 2X3GA 4FP9A 4IH6A 2OAUA 5LL6d 1VC0A 3B82A 4ID8A 2VG5A 4E8UA 2DGUA 4PXBA 1M0SA 2MGZA 2RUGA 1HW8A 1LW0B 2J0XA 2OFHX 5FD1A 4K50A 4Q2LA 1H6KX 2B9WA 4AE5A 1O5JA 3SI8A 2KFZA 4FNHA 3LOUA 1FRKA 2LEAA 3KFWX 4P7VA 2B9YA 5HI7A 2VBXA 2VD3A 2PMHA 1EETB 4TY8B 5EHHA 5KTQA 3I82A 1FDNA 1HPZB 3DLLQ 2ZBIA 3TUJC 2FUG9 4I69A 3TX8A 1VRTA 2B56A 2WSEC 2J8AA 2YNHA 1TKTA 3AQOA 3R97A 4YR0A 2R8HA 2QLXA 1C1CB 5SUHA 4OI4A 3MUTP 4I2PB 4LSLA 3IG1A 4J9KA 2OO4A 1SL2A 1RA7A 1KFDA 5F8HA 2NXUA 4X65F 2KRBA 4HTIA 5KOWA 5KG0A 2HHWA 4X4UA 4NLXA 1FKPA 2DGSA 4HDGA 1G6BA 4IH5A 1S6PB 2MKJA 4LSNA 4YEAA 3PFOA 2CPXA 4NWBA 2XWXA 2RDJA 2DGVA 2XY6A 2XMWA 4NLTA 3KJVA 1HHTP 2DISA 4DV4F 5EUHA 2CZ4A 4USIA 2DH8A 4TLRA 4R25A 3JSMB 2AJ0A 5KFZA 1S6OA 4GO7X 3PR4A 4ECSA 1GXUA 2VG7B 2PSZA 3G8TA 4GKJF 3M2RB 4Q2MA 2RKIB 1C0UA 3VZIA 4RUCA 1HR0F 4DG1B 4C3KA 4NLVA 5D6GA 1S76D 1QSYA 3FQKA 2JWNA 4CI0B 2UVWA 2YWFA 3I4PA 3PIOQ 2V94A 4DL7A 3IGVA 2L08A 1CC8A 2VA2A 1UAWA 3DU5A 3OJUA 3KK3B 1Z2ZA 3MI7X 1R8AA 1QUPA 1TZ0A 2FHOB 3CEDA 2JH3A 2QFJA 1FDAA 5HROB 1NJZA 3MUMP 3N6LA 2N7CA 1X4CA 1KLMA 2IM3A 1GX5A 2YWHA 4LF8F 3JYTB 1TKZA 2F9JA 2Z2MA 3MMCA 1U24A 2FVPA 2VG6A 4NA3A 2LYVA 3TA2A 2MQPA 3IS9B 1TV6B 1UVLA 3MM9B 1JXLA 3RB6A 4PQUB 1Q1KA 3E51A 4IH7A 3BQ2A 1Q8LA 2XHWA 1S0VA 1LKZA 2HQIA 4G3IA 4ECWA 2U2FA 5I4MA 1UEUA 3O6QA 2HG4A 1DTTA 5IS2A 2ZH2A 2AJQA 2QSWA 1RQ0A 1YJ9S 3HP6A 1V6HA 1KQGB 3MGJA 1PGZA 3CC4S 2RB7A 4DR3F 2K1RB 3HHLD 1UVNA 2VZ9A 3KYLA 1YJNS 1SKWA 2LLZA 1L3UA 3TP2A 4TNOA 5MLCV 3K5NA 3LF0A 2VG5B 3PJXA 2ZHBA 2MGZB 2HIQA 2AD9A 1WF2A 4QWCA 3BSNA 4E98A 3ONQA 4JI5F 3PJWA 1X4BA 2HFZA 2P6SA 4Q43A 2BR0A 2G2OA 1WEYA 2PO4A 3BJYA 1P27B 1MROA 2IRYA 2NR0A 2NPFA 4QU7A 4QPXA 2D3OR 2BZ2A 4DSFA 1R7IA 2JX2A 5LJ5Y 2MZQA 1S97A 4DL6A 1VRTB 4KGKA 4OX7A 2RU3A 1Y3KA 2YNHB 3FQLA 3K0JA 1TKTB 3IWNC 1RTIA 3CIMA 3I0RA 2DNLA 5B7WA 4XPEA 2VASA 5A6PA 4QWDA 4C8KA 3BSCA 3CDWA 3IG1B 3BGFA 4LSLB 4LFBF 1L3VA 2NSCA 2R7WA 2FC8A 2RF2A 5IT0A 4O23A 1NKCA 4M8LA 2C3MA 4TLQA 3BQ1A 4AFFA 3TUZC 1FKPB 1K1SA 5A8RA 4LSNB 4RBUA 3EX7B 1U1PA 4URQU 3M8RA 1JKHA 1N56A 2B5JA 3QGPA 5K8NA 4ECQA 3HVTA 3KJVB 5KFCA 1I1GA 1HNIA 2VC0A 4TYAA 4G1PA 3OFFA 2Q43A 3KLIB 4IRDA 4IUFA 1F5AA 4LVOP 5CZCA 2KU7A 3R5CA 4PWUA 5GADU 1IKYA 1F2GA 3LWMA 4ZVGA 3MM8A 1LK5A 2PE8A 2WAQD 2W4PA 3DLHA 1C0UB 4RNOA 3UW1A 2OMOA 2XMTA 1RT7A 4EBEA 1B0VA 2OLWA 4F4KA 2HHPA 4K4TA 4EZ6A 3MEKA 2QLWA 1RT5A 4J9QA 1U47A 3LGMA 4DQPA 1JJ4A 4C0HA 4C8MA 1WELA 2COLA 3F73A 1N33F 2FJBB 3PNIA 5M2RA 4CO0A 5KFQA 4FXVA 3T1YF 1IUJA 3DRXA 1KLMB 1YJTA 1TKZB 3CC2S 2XS7A 4NLGA 1HNWF 1FNOA 5T7LA 4YHHF 1H2VZ 3MMCB 4OI2A 3TQ1A 4O0IA 2J0SD 4WFNQ 4KHRA 2VG6B 2F8HA 3V6KA 1SJ1A 2I2YA 1UVJA 2XO7A 1K0TA 1X4FA 2P9EA 1HBMA 1SKRA 5KFEA 5L39A 1Y5LB 2DD8S 1S99A 4DSKA 4C8YA 4JI7F 1Y00A 2V8GA 3RRGA 1T03A 3BGLA 1DTTB 1OS5A 3W2WA 5D3GA 1PC4A 1Y5NB 2EW9A 1YWXA 4IR9A 1BWEA 1NO8A 1YVFA 4I64A 2R8IA 5B0EA 1GT8A 5CYQA 3HMJG 4MKBA 4NYPA 3M2UA 4CT8A 2AX1A 2KT5A 5F8LA 1FVSA 1RKIA 5E2QA 3OW2R 4DS5A 3QATA 3BZQA 3QO9A 3TO8A 1QTMA 3LUYA 2AV5A 4LIWA 4WF9Q 3C8YA 3P3DA 1S49A 1X4AA 3CDBA 2KVIA 2XMVA 3QLHA 4MK9A 3ITHA 3D0GE 4ILRA 5DM6Q 2M8HA 3ETOA 3CDAA 4DL3A 2X1FA 1MROB 4X4SA 2Z4PA 5ADZA 4KRWA 4Q7AA 4ECRA 4HI1A 2QA4S 5DDOC 3PEHA 3R1HA 1FA0A 1SL1A 3KOAA 2R7RA 1YSJA 2ERRA 1FT8A 1NRKA 3FEXB 3H5SA 3T19A 5DQHA 1N88A 2WONA 2NZ4A 4DV7F 1RTIB 2GV1A 2RT3A 3I0RB 4Y6IA 3CGIA 5D4PA 2RRBA 3CD7A 4RBVA 4UW2A 4QWBA 2HHTA 1C4AA 2EG2A 2RF2B 2VKRA 2MZJA 5KFYA 2W25A 3CD5A 1BQNA 2KHDA 3NCQA 3QGHA 1RA6A 2CIMA 3ENWA 1ZPWX 2XI3A 5A8RB 1ZH5A 2B4UA 2MSSA 4A4JA 4KIAA 2ZZNA 1JKHB 3HHLC 4F3OA 1RTJA 2B5JB 2ZHAA 2OIHA 4B9VA 4OJ1A 2MKCA 3NKYA 1X5TA 2M3DA 3W7BA 3HVTB 3OJSA 3EXCX 5DZ7A 1HNIB 2XI2A 5C24A 1QAIA 4OHWA 3EYZA 2CYYA 2V4JA 2QMXA 4ZVEA 1REVA 4F26A 4O3QA 5F0WA 3SSSA 5E41A 1HFEL 3MM8B 4ZS6A 4ZPCA 2M88A 3L7OA 1ZYQA 1FKOA 1VQKS 3UFCX 1N5VA 1RT7B 1SBRA 3AA9A 3I32A 2YVSA 2YNFA 3DLJA 5CZDA 4BBYA 3GFXA 1RT5B 2DBBA 1FRMA 2L9WA 3F44A 3R5DA 1S9EA 4N77A 2GMHA 1JLBA 3S01A 2P5VA 2V8HA 4FPRA 5KFDA 1MMLA 1WEZA 1KTQA 1NK0A 2VBYA 4EBCA 3CPWR 3RB0A 2QE5A 1NK8A 5T7LB 4ED2A 3NMAA 1Q8IA 3BO4A 5L1IA 1Z2LA 4CH7A 5F8GA 3GIIA 1HW9A 2MQOA 1XTZA 1HBMB 3WC2A 2YKMA 4LF4F 3IAS9 1UW4A 2CJAA 1QJHA 4NZ0A 2VH7A 1T03B 5DGBA 2BOPA 3DHXA 1NK9A 2UXCF 3W2WB 3GFZA 5D3GB 1ZM3A 2WSFC 5E33A 3CMES 3FMWA 3V5RA 4X4QA 3H4DA 3RAXA 5CYQB 5CD4H 3KHLA 3LO3A 3DFEA 4ELTA 3M2UB 2WTFA 5EDWA 2GQQA 2ZH9A 2C3OA 1KS2A 2RH3A 3QO9B 5KFGA 2R2UA 2W4CA 2VA3A 2HZCA 2SXLA 1RWUA 4K5RA 3SFUA 1FJEB 3PW5A 1JIHA 1FDBA 2GA7A 3CJ2A 4RUHA 5DM7Q 4D3GA 3LP2A 4OI6A 2DRAA 2C3UA 3QLHB 4I0WA 2LA4A 3ITHB 2N4DA 2AYBA 4RUAA 3MOZA 2PI4A 5KG1A 3T3FA 2GFFA 4U7CA 5D78A 4EU0A 5L38A 4IOAQ 3MM7A 2OPRA 5KFMA 2O3DA 2AP6A 3HKZD 2YNIA 2YTCA 3CTRA 4WU3A 1KHWA 5KFTA 2YH1A 2KKHA 3KMQA 3G4SS 2D3ZA 2E5GA 1G2EA 2ZH5A 3MFIA 1ZM2A 2WONB 1NB7A 1ZZFA 1HHSA 2FLNA 4DS4A 4DQIA 4MJKA 2C2DA 5CQGA 1ZETA 5IM0A 2J9CA 4N8OA 5JVHQ 3OL9A 4R0JA 1VBZA 1BQNB 2LU2A 4RW4A 1WF1A 3MOJB 4NZ6A 1HQEA 1L3TA 4EUVA 4HTJA 1NK7A 5IQ6A 1RK8A 1RTJB 4R5PA 1P6TA 3OHBA 2M7SA 4MFBA 3PXGa 3BN7A 3OUYA 5F8JA 4IG0A 3BO3A 1IQZA 3I6PA 4ZA1A 2LQ5A 5C24B 2ZC4A 2KDOA 1QUVA 2V4JB 5DLGA 1TP7A 1REVB 2HAIA 1L5UA 3C3LA 1UWBA 2H9ZA 5HQ8A 3CD6S 3H5XA 2MQNA 7FD1A 1FKOB 3LANA 2DCLA 4CTAA 1JLFA 3H20A 3QGIA 5LJ3Y 2Q66A 4FXDA 4ED8A 2YNFB 4QR1A 1RDRA 1ZM9A 3GYNA 2IRXA 2ZUGA 1X0PA 3UQSA 1IJEB 5JVGQ 3MMJA 1EP4A 1UA1A 2ZBCA 5HMYA 1S9EB 3FFIA 3OR1A 5L9NA 4C8NA 1JLBB 4FNIA 2BXJA 4OHZA 4EZ9A 5KOXA 3VZHA 3D0HE 2ROGA 4C0OC 3N5BA 4K4SA 4JV1A 4QZVB 4BWJA 3EXYA 3MM5A 1KRPA 3OTBA 5KFBA 2LQBA 4AUKA 5GAHU 4OHXA 2YKMB 4K0KF 3H25A 3D5MA 4FVMA 1X5PA 2CPZA 4L72B 2PD1A 4OI3A 2J7KA 3EPGA 4A46A 4PQAA 2EK1A 2PT0A 4WIIA 3MCSA 4DFJA 3DOMA 1DQ9A 2HS0A 2B9XA 4IRCA 4FN5A 2G0CA 3PIPQ 1IKXA 4LIRA 4WZMA 1MLAA 2LKZA 2BRLA 1QAYA 1S1WA 1WD6A 2FLOA 4AL5A 4DOZA 2R7OA 1U2RA 2UP1A 3G9CA 1PC5A 2E1MC 2MKSA 3N9UC 3I87A 2B4VA 3U02A 5D8HB 3EZUA 3ICLA 4K59A 3L7PA 3LP2B 3UWTA 4ZP9A 4DPOA 3CULA 2KJVA 2O01C 4OLPA 1U1NA 3OVBA 1BQXA 2LCWA 4HKQA 3G8QA 2E7WA 2RJZA 3THVA 2V0NA 3G6YA 1NU4A 2E29A 2XC9A 5JJBA 2JHEA 4DSIA 3MEDA 1W2BR 4ELUA 1ZOTA 4QIVA 4JI8F 1FXLA 1SUQA 3MM7B 2OPRB