2PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptnA02
1ZRBA 4AGJA 1O5BB 3HK6B 3TK9A 4WMEA 1YC0A 2BQWB 1LPZB 1C5VA 1QRWA 5EU8A 5FPYA 2BZ6H 3RMOH 1Z6JH 3SU4A 4ABGA 1ESTA 1JRSA 1EP5A 3A7TA 2RG3A 1YF4A 4X8VH 2ZECA 4O3TA 4IS5A 5A0BA 4OS2A 4D7FA 2ULLA 3RXRA 3BTQE 4UEHH 3VB5A 1N6YA 5I25A 1F92A 1V2ST 1NRNH 3GY5A 1MTNC 1K1PA 1CA0C 3LJJA 3UOPA 2PKSB 2PSXA 1EPTB 1GHAF 1S0RA 4BXWA 1EJAA 1W2KH 1T4UH 1UTLM 4IC6A 4TPIZ 4YM9A 4OS7A 1V2MT 3BG4C 2A7CA 2ASUB 1IHTH 1C5QA 1Y3VA 1DFPA 3FP8E 3MU5A 3GCTF 1JRTA 2HNTF 1NS3A 1KYNA 1GBMA 2ZZUH 2BQ7B 2BX4A 4GUXA 3BTGE 3F9GA 1WAYB 7GCHF 7LPRA 5FX5A 5EPNA 2O8LA 1W0ZU 2Y7XA 3ODDA 4I8JA 4UE7H 1A5GH 3UPEA 3HK3B 1J8AA 3E90B 1KTTB 1GMDF 1EP6A 3S9BA 5GXPA 1GI3A 1Y59T 3V0XA 1C1WH 1QQ4A 1SQTA 1Y3WA 3SORA 2OP9A 1VJAU 3MO9A 3EA8A 4ESTE 6CHAC 2FZZA 3TJNA 1ELBA 1C1QA 1P2OA 2FOGA 1W13U 1FY8E 2PGQB 1THPB 2NWNA 3URCA 2FP7B 1SI5H 2VIPA 1UCYE 1PQ5A 2AMQA 2BB4A 2Y82A 5LGOA 1V2TT 1AFQB 3T26A 5JPMH 1O3DA 2NU4E 1IQFA 2WV4A 1K21H 2SGPE 1A1RA 4KTCA 2FMJA 2ZIQH 1IQNA 3S9CA 1AE5A 2G51A 2A2QH 3NZIA 4B2AA 4A6LA 2BQ6B 2GV6A 1BHXF 2ZHFH 4M7GA 3WY8A 2A45B 1O3NA 5FPSA 3U1JB 1RTKA 1HRTH 5BPEA 1O5CB 2CJIA 1QTFA 5FBEA 1V2RT 5EODA 1GDNA 4FU9A 3PLPA 5LPFA 2NU2E 3SU3A 2TIOA 5AF9H 3M5LA 3UTUH 3SJIA 1K9OE 1CSOE 4ZMAH 5F6MA 4UONA 3IITA 1FIWA 1ZSJA 1W3CA 3MNCA 3V12A 1G36A 3RXQA 1UTPA 1P2KA 3T29A 1OWDA 3HATH 5T6FA 3Q3YA 3M7UA 1MBQA 1HAVB 1DLEA 2XWAA 1FQ3A 4K60A 1O36A 4X0WU 1JBUH 3RXFA 1EAIA 1SB1H 3KCGH 1A0HB 3EYDA 1ELAA 4INLA 4K8YA 3A89A 1VR1H 2F9NA 1QHRB 4BTIB 2CMYA 2PR3A 1O3BA 2K1QA 5HYOA 1O2NA 1ANEA 3SUFA 5SGAE 1J14A 2UUFB 3E8LA 4NZQA 4YLUA 1N1LA 2HWLB 2OQUA 3GCTG 5ETXA 1ZMLA 1SHHB 2Y81A 2HPQH 4DVAU 7GCHG 1NROH 1P2NA 2ZHEH 1N6XA 2V3HH 2IJOB 2H5CA 3ZZ7A 4R0IA 3MH5A 1PPFE 2OC0A 4Y76A 1C1OA 1GMDG 3UR9A 1C2KA 1UK3A 2HRVA 4I8KA 4IBLH 1XUKA 2ALPA 1NFUA 3CENA 1FPHH 1SBWA 3ZZ4A 2ODYB 4B2BA 1OYTH 3LONA 1ANBA 3H7TA 1A4WH 1V2VT 1HAZB 1DOJA 1PPCE 1C5WB 3P17H 3Q3KA 2BLQA 3QZRA 1BZXE 4MG3A 2F9UA 1DUAA 1C1MA 4X2YA 1AVXA 1E37B 2ZGHA 5JBBS 5GDSH 1GJ8B 1QFKH 1P02A 1MKWK 4D9QA 3P95A 3ZZ6A 3SJ9A 2BD5A 1SPJA 1VZQH 1GJDB 2ZNKH 1GG6B 1GI8B 2BDAA 4O97A 3TGIE 2GZ8A 1QIXB 4INKA 2R3UA 1FN8A 1GBEA 4JYVH 1QRZA 1MKXK 3URDA 1H9LB 5DP8A 3GDUA 1IQEA 5CHAB 2AGGX 3FANA 1QBOA 1RIWC 2FO9A 2VJ1A 2C8XB 3TH2H 1UTQA 2Z9GA 3AW0A 3CS7A 2H9HA 3DA9B 3PLBA 1P2IA 2ZTZA 4UFGH 1F5LA 5C67A 1MTSA 1BTUA 1T8MA 1C2JA 2F9BH 2QF3A 3SI4H 3DFJA 1VJ9U 1BCUH 1DS2E 1O32A 2JH0D 5HM2A 3GICB 2SGDE 4GCHF 3FAOA 1C4V2 1WBGB 3H5CB 2FIRH 1IQHA 1O34A 1NTPA 8GCHG 1XVMA 3CP7A 1AFEH 3ZVGA 5DO4H 1CA8B 3Q00A 1S85A 1B0FA 1RD3B 3T5FH 3VPKA 1SLUB 1C2IA 5LPEA 3F9EA 1LHCH 4D9RA 1OWEA 3ATKA 2I6QA 1O39A 2BY9X 4X6NA 3W94A 2J9NA 1QB6A 4ZROA 4WJG2 2AMDA 3GDSA 2BY5X 4BAHB 1GVZA 1P9SA 3QGJA 1GBFA 4WVPE 4CREA 2A5KA 3LU9B 3E6PH 1RFNA 3L6PA 3A87A 2DUCA 2VVUA 3KGPA 1O2GH 2UUJB 3TJVA 4X8TH 1EZUC 4BAKB 1SMFE 1C5RA 1PYTD 2LNCA 4U32A 1TB6H 3NWUA 3RU4E 2J34A 1HPGA 5DP9A 4ISOA 4YT7H 1SC8U 1IQIA 4Y7BA 2GDEH 1YPHC 1W0YH 2PTCE 4YOIA 1T8LA 2GZ9A 2ZU2A 3GCHC 3VGCB 3UQOA 1UVUH 1TNHA 1F0UA 5FXLA 5T6GA 1IQMA 5AFYH 2GCTB 1AZ8A 3T27A 3K65B 1O2RA 1PQ7A 4CH2B 4BNRA 2G4TA 3SUGA 3RC4A 3QN7A 1SFQB 4ABFA 1S81A 1THRH 4IN1A 4Y0ZE 2QYIA 1BBRE 2ZF0H 5C20A 2TBSA 1K1LA 2GCHF 3BF6H 1CHOF 1O5GH 5C3NA 1XXDA 1CT4E 1S84A 2ZGCA 1HDTH 1PPEE 2ZHQH 1HAGE 1L2EA 1VCWA 1WUNH 3PTNA 1L1JA 2STBE 1ZZZA 1EATA 1Z8RA 5EXMA 5EG4A 3DD2H 3FFGA 2SGFE 1AY6H 4BAOB 1D4PB 1GWAA 1W7GH 1UCYK 3LT3A 1C5NH 5EQSA 4MNVA 1P8VC 1UTJA 3M35A 1GI4A 3A83A 1XXFA 2HPPH 4K5ZA 4MNXA 4JK5A 2P95A 3BIUH 1OWHA 6ESTA 2BXTH 3TJUA 1J16A 1DWDH 2FTMA 1HNEE 1J15A 4THNH 2O9QA 1TRYA 2PGBB 2A4OA 5FCKA 1L1GA 4FU7A 3ZV8A 2ANKH 2SGAA 3RXSA 1IHSH 1F0TA 4NIYA 2F91A 1HAIH 2ODQA 1TGCA 5LH8A 2WPJS 4NA8A 1K1MA 1TWXB 2QA9E 1OP8A 2JKHA 3HKJB 1KXFA 1QB9A 3U8OH 1ZHPA 1QCPA 3SU1A 2XYAA 1OWIA 2P94A 1V2WT 1CT0E 2NU3E 3GY4A 2J94A 1EX3A 4MPVA 1PJPA 3BG8A 1GI9B 2FDAA 4AZ2B 4NCYA 1P11E 2BY7X 1O3EA 1C5LH 1EAWA 5G4BA 1QBNA 2Q6GA 3RXPA 4Q7XA 2VIVA 3MI4A 3QTVH 2QXGA 1ZTJA 5DP7A 4NGAH 2PKSC 4ASHA 1GL1A 1UVSH 2KAIB 4AOQA 4IMQA 3A84A 5L30H 2H1UA 1P2QA 2GDDA 4X1SU 3SNCA 2VVVA 2AMPA 3ZZDA 1O2YA 1RXPA 2WPKS 1P01A 4GAWA 2QXJA 2GCHG 2G5NA 1BTZA 1TA2A 1FY3A 1DM4B 2A4QA 4CRBA 2VU8E 1NRSH 1YKTA 3BTDE 4GVUA 2FYQA 3PMAB 1SGDE 2FI3E 3ELAH 2ZTYA 3QLPH 4TY7A 3KQBA 2H9TH 4H6TA 4H6SB 4HGCA 1PPBH 5GIBA 1OKXA 5A09A 3TK5A 3C1KA 3TU7H 4NWLA 1HCGA 3A86A 2YNAA 3TPIZ 3GY8A 3EGKH 2CN0H 1YPJH 3MU8A 3MU0A 1C4U2 4JMYA 1H9IE 4AX9H 5DP4A 1FAKH 2EI7A 1LQDB 1MUEB 2TGPZ 1TNLA 2ZU1A 4ISNA 2QCYA 1BTHH 2ZI2H 3ITIA 4MVNA 5BRRE 2AH4X 1W7XH 4H42U 4DT7B 3DUXH 5DP6A 1SGPE 3SI3H 1EXFA 1KLIH 3TLOA 3FP6E 2WYJA 2G4UA 3KHVA 4JZIA 2Z9IA 2ZP0H 1HAXB 1MQ5A 1XKAC 1AFQC 3A8DA 1O2ZA 1G9IE 3MMGA 3UNRA 2QXIA 4TYDA 3SZNA 1F7ZA 3KN2A 1ZYOA 1PFXC 2VNTA 5JB8S 3RU4D 1AQ7A 1O2OA 3UY9A 2AERH 4YOJA 1T4VH 2EEKA 1UTNA 1HUTH 1HV7A 2GV7A 5F8ZA 2HNTE 3KNXA 2PV9B 1W10U 1MCTA 1Z71A 1GI6A 4CRFA 1KXDA 2OINA 2GKVE 1C2GA 2BZAA 1LHGH 3E0PB 3GYMA 1Q3XA 1GDQA 1TFXA 2VIWA 1TMBH 5FCRA 1TE0A 1Z6EA 2GVFA 1AVGH 1ZPBA 3PROA 4WMDA 2P8OB 5F8TA 4FUHA 3SNDA 1TA6A 3KF2A 2WV5A 1BTXA 3M7TA 3NKKA 2C93B 4K3JA 5K7RA 4X6OA 4NIWA 2GP9B 4CH8B 1KXCA 1P2JA 2QGRA 3LGVA 1MD8A 1TPSA 4NG9H 5GPIB 2Y5GA 1F5KU 1E0FD 1TMTH 4JZDH 4ABEA 1IQGA 1AU8A 2A32A 5FPTA 3E16B 3A8CA 3UREA 4HZHA 1XVOA 2WPLS 5A8XA 3ZZ3A 1J9CH 5EQQA 4AFSA 1QGFA 1TOCB 4OS1A 3S9AA 4MPXA 1NZQH 3M5OA 3SU0A 1AB9B 2B8OH 1PYTC 4XE4A 1ZJDA 1AKSA 3AAVA 3GOVB 1NESE 1GHWH 4Q2KA 3RXDA 1DWBH 3LOXA 3SHCH 1ZPCA 2UUYA 1RGQA 1GBJA 1C9PA 4Y8YA 2QC2A 3AASA 3A8BA 1BBRK 2AYWA 5HMAA 1QURH 2VWOA 4NWKA 1BMAA 2BD2A 3BN9A 1OWKA 3KQDA 3SNAA 1O37A 4BANB 1Z1IA 5L2YH 3RXLA 1B5GH 1G3EA 3AVZA 1QL7A 4JZEH 2IPHA 3E0NB 3L3TA 1EB2A 1GI7B 3ATLA 1OX1A 5L6NH 3RXAA 3DFLA 2W26A 2FOFA 4ZH8A 3FVFB 2WYGA 1ETTH 1C2MA 5A0CA 5TJXA 3GY2A 3SJOA 1GG6C 4FU8A 4B1TA 3EE0B 2BDIA 2QF0A 1C1VH 1PPHE 1XX9A 1C5UA 5F03A 5ABWA 1MCVA 2GT7A 2OUAA 5CHAC 6GCHF 1UJ1A 2ZU5A 3OY5U 1O35A 2VIOA 3F9HA 4ZAEA 1G3BA 3S7KB 3VEQB 8ESTE 1KSNA 2CHAB 4RSPA 1TGSZ 2AIPA 1SGQE 2H9EH 3ATWA 3SV6A 1DSTA 1QL8A 2BY6X 1QA0A 2VB0A 1CO7E 1FY4A 5K0HA 4K2YA 2HALA 5J4SA 1EKBB 1LO6A 3B8JA 1BMNH 7KMEH 1C4Y2 2ZDLA 2ZCHP 2GX4A 1FNIA 2ZHWH 1HJ8A 2H2ZA 2ZTXA 4ZHLU 3K2UA 3A80A 1GDUA 3ENSB 2F9PA 4IMZA 3FZZA 5EPYA 4RN6A 2BHGA 1C5YB 1CBWB 1NRPH 1DANH 1BTPA 3UNSA 1TNIA 4MDSA 1O3KA 1SGNE 2FEQH 1W8BH 1P09A 1BHXB 3PB1E 3TH4H 4CRCA 1B7XB 2QY0B 4A1XA 5DP5A 5A8YA 4GLYA 1EUFA 1KY9A 5T6DA 5GCHG 1A61H 1HFDA 1ESAA 1QJ1B 1SGIB 3LC5A 1P10A 1MKXH 3TGJE 1TONA 5IYTA 1DXWA 3SUEA 2BLVA 1JWTA 4ABBA 1CVWH 3SV9A 1EOJA 4D7GA 1DSUA 8GCHF 3F9FA 3HGNA 1PQ8A 3QK1A 1AE8H 1C5OH 1O30A 1W14U 1K1OA 2ZPSA 3VGCC 1S5SA 1BUIA 4ISHH 3RXUA 4X1QU 5AFZH 4QT8C 4YESB 1GGDB 2G55A 2OC7A 1OP2A 3NCLA 1TPOA 1A7SA 2GCTC 1FJSA 1GBDA 1MU8B 2AGIX 1Y5AT 1KLTA 4ABAA 1QNJA 2O8WA 3ZZ9A 2SNWA 1O3GA 3PM3A 1A3BH 1TGNA 2FOEA 5DPAA 2WINI 1A5IA 2BDHA 5TCCA 1OWJA 1K1IA 1FI8A 2P3UB 1O3HA 1HJ9A 2RA3A 2ANWA 3SGQE 1K28D 1TRNA 4CRDA 4Q7YA 1OP0A 4JZ1A 3V7TA 5A0AE 2ZQ1A 1MQ6A 3M5MA 1DITH 3SGBE 2Q6DA 1ZMJA 2RDLA 4ZUHA 1O0DH 2AFQB 3GISB 1EAXA 2FI5E 4YT6H 3U98H 2F9VA 1UTOA 4DCDA 6GCHG 4UDWH 2J92A 4MLFB 3UWJH 5DKMA 2ZDVH 1ZGIA 3ZVDA 1D3DB 1SHYA 2OCVB 1C2EA 4X8SH 1S82A 1C5TA 1C5ZB 2XBXA 1FPCH 3TK6A 4KTSA 2V3OH 1OSSA 2XC0A 2THFB 3BEUA 1DUEA 4JK6A 8KME2 2D8WA 2OTVA 1SQAA 2PFEA 1XUJA 1VCPA 3BEFB 5E0GA 1TBZH 4I8GA 1AUJA 1NT1A 1YM0A 3ZZBA 1UHBA 1RS0A 2FOBA 2GGVB 2PLXA 1CGHA 1ZLRA 3MYWA 1O5FH 2D2DA 3HGPA 3B23B 4X8UH 2V35A 3MH7A 2TGAA 1CU1A 2ZFTA 4ABHA 3A85A 2ZPRA 5DG6A 4IN2A 2VIDA 3EA9A 8LPRA 4B76A 1ZGVA 3BTKE 4KKDA 2WPMS 2XC4A 1QA7A 4TWWA 3P8NA 1O33A 1MAXA 4BOHA 1GHZA 3SU5A 1GCTB 1XMNB 1CQQA 4I33A 1TNGA 5IDKA 4UD9H 3RXIA 4B73A 4DY7B 2CV3A 1O2MA 2ESTE 1Y8TA 4MTBA 5DGJA 1ORFA 4DIHH 3JZ1B 3RXHA 1GVKB 1BQYA 1TGBA 1GPZA 1FY5A 1O3MA 1O2JA 1L4DA 1QRXA 1TNJA 1AVWA 4F49A 1P05A 1O3JA 2R2MB 1JIMA 3HKIB 3T2NA 2G81E 1RTFB 2XTTB 1JIRA 3HPTB 4NZLA 1QL9A 2P3TB 3ZVEA 1GJ7B 2HLCA 2ZHDA 4ISLA 2ZU4A 4Y8ZA 4JYUH 1ZOMA 1VGCB 2BDCA 1BRUP 1HIAA 1MU6B 1S83A 4CR5A 2BOKA 2B7DH 4Y11E 2D26C 5DJ7A 2BTCE 3JZ2B 3A81A 2QIQA 1SGFG 3UWIA 3EAJA 2VWLA 1QBVH 1MTWA 1Y5BT 1SR5C 1MZDA 2PKAA 4GHQA 1TLDA 3MNXA 1SGYE 1ELVA 2AGEX 1AD8H 3MH4A 4BTTB 3LH3A 1DVAH 4H4FA 1N8OB 4O03A 1V2NT 1EJNA 4YZUA 2H5DA 3RDZA 1DY9A 2FLRH 2W3KA 1YPGH 3PTBA 3RMLH 5EW1H 1AIXH 1ZHMA 2V0BA 4ZKNU 3QZQA 1RJXB 1SFIA 4E06H 1EOLA 3D49H 1D3TB 1UVPA 2GMTB 2A4GA 1FLEE 2UWOA 3ZZ5A 2PSYA 3D62A 1IQJA 2P59A 3VFEA 4I32A 4K1TA 3SNBA 2ZGXH 3SV7A 2ZFQH 3FZDA 3SV2H 1J17T 5GWZA 1GL0E 3MNSA 5E2PA 1Y3UA 4FUCA 1XUHA 4IGDA 1Q31A 3SQHE 1GBTA 2BXUH 3A7WA 1GJ5H 1TX7A 2G00A 3FP7E 1NU9A 1XUFA 1LVYA 4FVDA 1BIOA 1TMUH 1P57B 3AAUA 4DG4A 1BDAA 1GBIA 4ZXXH 1FN6A 1MTUA 1WTGH 1A3EH 1IQKA 4JZFH 2A31A 1G32B 1D9IA 1ZSKA 3RM0H 3P92A 3KIDU 2Z3DA 1H4WA 1JXPA 4NFFA 3PLKA 4U01A 3MO3A 3L33A 1A46H 1GI1A 1OXGA 2BOHB 4KTUA 1YPHE 3A7ZA 2PUXB 4X2XA 1A2CH 2QV1A 2P8OC 3GYLB 1C5PA 1Y3YA 3MFJA 3VB4A 3P8FA 3U69H 4UFEH 4X6MA 1OPHB 4CHAB 2ANYA 1S6HA 3BTWE 5EGMA 1FZZA 1G2MA 1CGIE 9ESTA 4Q7ZA 3RXTA 3EDXB 3LJOA 4XBDA 1WV7H 1KXAA 1PQAA 2HGTH 1G2LA 1GHBF 3OU0A 1EB1H 3LGIA 4DOQA 1C5SA 3TH3H 1GBCA 2FPZA 3EQ0H 1EPTA 1C2FA 3PO1B 4ZKOU 4F4OC 1MTVA 1AB9C 1UHBB 2ZWLH 4INHA 1P12E 2F3CE 3DT0H 1AMHA 1C1PA 2TPIZ 1GBLA 4FUFA 3TVJB 3MOCA 1LVOA 2G8TA 4KGAA 3S69A 1ANDA 5E0JA 1FDPA 2P93A 4AGKA 4AFQA 2H6MA 1THSH 1LPKB 4MPWA 1VITH 2OC1A 3GDVA 1NRQH 1UTKA 1TPPA 1RTLA 1NFWA 1C5MD 2G52A 2GD4B 1SL3A 3MO6A 1C1TA 1G3CA 2HNTC 1LHEH 1WCZA 2W7UA 1C2DA 1TQ7B 3RXKA 4LZ1H 4MNWA 1ZPZA 2SFAA 2ZG0H 1DDJA 1O2PA 2BMGB 2DE9A 3A7VA 1NFYA 1EASA 2BVRH 2YNBA 1NFXA 4Z6AH 5A2MH 1DPOA 1FXYA 1YCPM 2A7JA 4FUEA 1BRBE 5L2ZH 2F83A 4ZXYH 2AS9A 2CHAC 1V2OT 3BTFE 1L1NA 5E0HA 2BYAX 4Y0YE 1HIAB 1VCQA 4AFUA 3O8CA 3RM2H 4AORA 2VWNA 1TNKA 3RXJA 1K1JA 2ZFSA 4X1RU 2ZEBA 2R2WU 2NU0E 2I6SA 5AHGH 3A7XA 4ABDA 1YBWA 3KL6A 4FVBA 3RXBA 1KIGH 2M5TA 2PKAB 1SQOA 1BBRH 1EAUA 4NIXA 3UFAA 5B6OA 1LVBA 3LC3A 2ALVA 1EJMA 2ZO3H 4K1SA 4VGCB 1Z8GA 4ABJA 1GHVH 3UOUA 1CBWC 1O2QA 1WTHD 5JB9S 1DY8A 1X7AC 4A1TA 2A7HA 1AWHB 3BTHE 4FUDA 1H8IH 2HOBA 5JBTA 3TNTA 4LK4A 1GHBG 1ANCA 2XW9A 3ESTA 3F1SB 1KDQA 3MU4A 1GI5A 1LHFH 1ESBA 3RXVA 2BVSH 3SBKA 1D3PB 4D76A 1QY6A 4A7IB 5CE1A 1BA8B 5DP3A 5ESBA 3T28A 3S7HB 2ODPA 2TGDA 1O3AA 4DIIH 1SGFA 3M3TA 1GHYH 3K6YA 2FOMB 2IOTA 4Z0KA 3SJ8A 4CRAA 1TOMH 2UWLA 3MH6A 5F8XA 3ZVBA 1LVMA 1O2XA 2J4IA 4X6PA 5I46H 1QJ6B 1W11U 2BD7A 2CXVA 1HYLA 1E38B 1BMLA 3I77A 1GGDC 3SGAE 1D6RA 2FLBH 5AVDA 2XCFA 5JBCS 2J95A 3IWMA 1E36B 1QQUA 3STJA 4AG1A 5T3HA 1YP9A 2BDBA 4CBOA 2FI4E 1FMGA 4K8BA 1DICA 5GCHF 1Q2WA 4YTAA 4BXSA 3TIUA 1CE5A 1UO6A 2OC8A 2BD8A 1YGCH 4ZHAA 1WU1A 1GCDA 1INCA 1MBMA 1GJ4H 4GSOA 4ZKSU 4OS6A 1P3EA 2FESH 1P03A 2FOCA 4B71A 5E8EH 4AG2A 1C2LA 3SJKA 1IAUA 2XBWA 2W3IA 2B0FA 2WPIS 2YOLA 3LH1A 2B9LA 1C1SA 1ARBA 3V3MA 1MAYA 4OGYA 2V6NA 2VIQA 2JETB 4B2CA 2Q6FA 2ZKSA 2PUQH 3ZV9A 1ELDE 1QJ7B 3KEEA 1XUGA 4IW4E 4BTUB 5LPRA 3T62A 5H4IB 2BY8X 2Y80A 3RLWH 1BJUA 3NXPA 1ABJH 2ZFPH 1O2UA 2WPHS 3RC6A 3RMMH 2R9PA 4E05H 3RXEA 1LQEA 5HGGA 4X1NU 2Z94A 4J1YA 1MH0A 1HJAC 2Y6TA 4K69A 3KQCA 4KELA 1FIZA 2P3FH 4WH8A 2ZDKA 2FS9A 4JCNA 1C1UH 3IG6B 2Z3CA 1T7CA 1AGJA 1DWEH 1KXEA 4B75A 1WQVH 1GCTC 3NK8A 1YCPK 1AO5A 1LKAA 1BTWA 2BD3A 2Y5FA 3SN8A 1GBAA 4XBCA 3E3TA 2A5AA 1E34B 4YO9A 5PTPA 4DW2U 1SLVB 3P6ZB 1DLKB 3SOSA 2AIQA 3MNBA 1WOFA 1EZSC 3RXCA 4Y6DA 1GJBB 1BRAA 1K2I1 2AEIH 2DE8A 4MPUA 1BT7A 2O8TA 4UFDH 3D23A 1P04A 2STAE 1ETRH 3U8RH 1MKWH 1ETSH 2ZDNA 3RLYH 4SGAE 1VGCC 2EC9H 4DJZB 3PMJA 3PMHB 1L4ZA 3I29A 2OLGA 1SG8B 3M3VA 2SNVA 4A92A 2BLOA 4Q80A 2XBYA 1FONA 5E2OA 3QX5H 2G5VA 3K9XB 2SGEE 3RP2A 4GPGA 1D6WA 1YPKH 3BEIB 3SU6A 4ZKRU 4NSYA 1JMOH 2VGCB 1AHTH 1KTSB 1GJCB 1ZR0A 1NC6A 1Z7KA 2XRCA 1E35B 3RUOA 1N8OC 1P0SH 2C4FH 1FV9A 1V6DA 1O5AB 3CS0A 1DT2A 4Y79A 2C8YB 3GCNA 1LCYA 3NPSA 4NFEA 4LZ4B 1BOQA 3RXGA 2BD4A 1UK4A 1TX6A 1Y3XA 2BDGA 1BITA 2ZU3A 3STIA 4K1EA 1P3CA 2GMTC 4XOJA 1HAYB 2BVXH 1KDQB 1ELGA 3G01A 1UMAH 3LGYA 2A4RA 1C1NA 1GHAG 3EA7A 2TGTA 4MQAA 3QTOH 3BTEE 3ZZ8A 1IQLA 2WUBA 2Z9JA 4A1VA 3VXEH 3PYHA 1Y5UT 2GTBA 1TABE 4U2WA 1YPEH 3TITA 2ZPQA 4WXVA 3DHKH 4CRGA 2B5TB 1C5XB 1SGTA 3ZZAA 3NUMA 3KQEA 2ZA5A 3N7OA 1ZRKA 1GMHF 1BMMH 2D1JA 2FS8A 3TJOA 3TGKE 1YYY1 4WWYA 1MTNB 2VVCA 1CA0B 1O2SA 1BTYA 1O3CA 2OBQA 2ZCKP 1FUJA 1D3QB 3UUZA 1S6FA 2XNIA 1H1BA 3F6UH 1T32A 1T8OA 4YOGA 3LGUA 3M3SA 2Z9LA 2PW8H 3OX7U 1V2PT 3PV4A 3AW1A 4KP0A 1XKBC 1AKSB 3U1IB 1FY1A 1WSSH 3LGTA 3GY7A 3BG4B 3VB3A 3P8GA 1HJAB 3UQVA 4BAQB 3UR6A 2XC5A 2PWXA 1V3XA 1LPGB 4XSKU 2GT8A 4CHAC 1P9UA 4DGJA 2ZFFH 3BV9B 1O2VA 2VWMA 4E7NA 3QO6A 4XFQA 3SV8A 3V13A 1Z8JB 1S0QA 6LPRA 4J2YB 1HGTH 3BTTE 2FM2A 1HXFH 1C2HA 3MHWU 5JBAS 2A2XH 1C1RA 1LKBA 1HAPH 4D8NA 1DXPA 3PO1C 4X2WA 2KAIA 3O8BA 4ZHMU 1O5EH 1NPMA 1CT2E 4R8TB 3D65E 4DURA 1O2TA 1ZHRA 2R0LA 6CHAB 3Q3XA 1UCYH 2LPRA 3RXMA 1TGTA 3SHAH 4AYVB 2HVXA 5JDUB 2ILNA 5EW2H 2PHBA 3OY6U 3VXFH 1LTOA 5EQRA 1A0JA 2Y5HA 1U6QA 1NN6A 3GY6A 3RMNH 3R3GB 3MWIU 4FXGH 4NA7A 2FODA 5GJ4B 4WH6A 3U9AH 1P2MA 2O8MA 2ZDAH 3M36A 1TAWA 1O2IA 1O3LA 2OXSA 1AN1E 2UWPA 2FYRA 1UTMA 3ZVAA 4SGBE 5EXLA 1O2LA 3ZVCA 1HBTH 1GBBA 5FBIA 2EA3A 2FWWA 1EZQA 1EQ9A 1O2KA 1YPMH 4LOYH 1K22H 1ZMNA 1UVOA 1BJVA 5DK1A 1GI0A 2CGAA 4AYYB 1F5RA 1TQ0B 3LGWA 1O31A 4TPYA 2BD9A 3PWCA 3QUMP 1NY22 1V2JT 2ZDMA 1GMHG 1GMCF 2QXHA 1GBHA 4I7YH 1ELTA 1M9UA 4PROA 4WMFA 1UK2A 4E7RG 5C1YA 1AZZA 2ZFRH 5EXNA 1W12U 1OYQA 1BB0B 3VB7A 1SLXB 4Y10E 3PWBA 2R0KA 1GHXH 1YPLH 4XBBA 4VGCC 1GJAB 4X1PU 1GJ9B 4Y71A 2EI6A 3SW2B 2W5EA 3GCOA 4A5TS 3LIWA 4NA9H 3OSYA 3I78A 2XWBI 1C9TA 1SSXA 9LPRA 1V2UT 5C1UA 4AFZA 2OD3B 3TNSA 1F0SA 3ZYDA 5ESTE 2RCEA 1H9HE 3SQEE 3PMBB 5J4QA 1TBRH 1O3FA 3RC5A 2OBOA 2BX3A 3SO3A 2NU1E 1LMWB 4YLQH 3RXOA 1NU7B 3E1XB 4OS5A 4I8HA 3U8TH 3BTME 2C3SA 5C5NA 5TCAA 1HXEH 3BIVH 1T31A 4OGXA 3E91A 1T8NA 4MNYA 2Z3EA 3QWCH 1AI8H 3QGNB 2JH5D 5HM9A 3QDZB 1VITF 2W7SA 5C5OA 1O3IA 1G37A 1QR3E 2TRMA 1NO9H 2FOAA 3P70B 2BDYA 4I31A 1RRKA 1DX5M 2Y7ZA 3MU1A 4GCHG 4NIVA 1TIOA 1Z8IB 1SGCA 2P16A 2J2UA 3T25A 1AUTC 1HAHH 4AN7A 4FUBA 2F9OA 1ELCA 3A88A 4Y7AA 3C27B 1RIWB 4O3UA 1ZSLA 1GJ6A 1FAXA 3BSQA 3H7OA 1DE7H 3GY3A 4CBNA 4NSVA 1GI2A 4Y8XA 2ZQ2A 2Q1JA 1V2KT 2O8UA 4JYTA 1L0ZA 2EI8A 3P8OA 1ELEE 1P06A 1OOKB 5JYIA 3A82A 3VB6A 2ZC9H 1O2WA 4RKOB 3RU4T 1NRRH 1ZTLA 3O8DA 5EOKA 5CMXH 2FTLE 5FX6A 2A5IA 4X2VA 1GMCG 2QAAA 2JETC 1AWFH 4OS4A 1WYKA 1SLWB 1A5HA 4U30A 3M61U 4WF8A 3MTYA 1EZXC 1ARCA 1EPTC 4AB9A 1BRCE 2A0QB 5A8ZA 4I8LA 2XCNA 4HI3A 1MD7A 4BAMB 2FXRA 1ABIH 1XM1A 3M37A 1LHDH 1B0EA 3Q76A 4CR9A 2BLWA 5FAHA 2ZGJA 3ZVFA 3B9FH 1CHOG 3A8AA 2Z7FE 3A7YA 3M7QA 3S0NA 1YLCA 3LDXH 3UIRA 1GBKA 1OS8A 3ATMA 1GVLA 1KXBA 4RKJB 5HXFA 1CHGA 3ZYEA 1PPZA 4FUGA 3GCHB 1MZAA 2C8ZB 3K6ZA 4WXIA 3SUDA 1TALA 1LDTT 2SGQE 1HLTH 3M5NA 4GHTA 2C8WB 2VH0A 1MMJN 1QB1A 2A1DB 4FUIA 4ABIA 1SGRE 3LPRA 7ESTE 2OQ5A 1SGEE 5C1XA 1ZJKA 1V2QT 4LXBH 4WY3A 1H8DH 1JOUB 1TYNA 1VITG 2UUKB 3OYPA 2J38A 1ZTKA 5C2ZA 1SOTA 1Z1JA 1ACBE 2BM2A 1O38A 1F2SE 4FUJA 1F0RA 1WQSA 3Q77A 2FOHA 2CF8H 3UNQA 1SVPA 3ATIA 1KLJH 1HAVA 1YLDA 2Z6BD 5FHTA 2CF9H 4AB8A 2FX4A 2JH6D 3LKWA 4TWYA 3OTJE 1CGJE 2IN2A 1O2HA 3ODFA 1DWCH 1V2LT 2C90B 2GZ7A 2VGCC 1UVTH 1G30B 1O3OA 1HB0B 2XXLA 3SU2A 1SOZA 2WUCA 2VINA 4HTCH 1HAOH 1TBQH 1O5DH 2R3YA 4UFFH 2RA0A 2FX6A 1K1NA 4ISIH 3R0FA 3F68H 4TY6A 1XUIA 4XDEA 2ZGBH 1PPGE 3W95A 3ZZCA 2Z9KA 1A0LA 2ZCLP 1NM6A 1YCPH 1ID5H 2VH6A 4B74A 4IC5A 4HFPB 4O9VA 1O3PB 1IOEA 1TRMA 1ELFA 2PTNA 3O8RA 2ANMH 3SNEA 2QN5T 1G3DA 2XBVA 1TPAE 1TX8A
chains in the Genus database with same CATH superfamily
1ZRBA 4AGJA 1O5BB 3HK6B 3TK9A 4WMEA 1YC0A 2BQWB 1LPZB 1C5VA 1QRWA 5EU8A 5FPYA 2BZ6H 3RMOH 1Z6JH 3SU4A 4ABGA 1ESTA 1JRSA 2JDID 1EP5A 3A7TA 2RG3A 2EQNA 1YF4A 4X8VH 2ZECA 4O3TA 4IS5A 4YXWD 5A0BA 4OS2A 4D7FA 2ULLA 3RXRA 3BTQE 4UEHH 4ZCNA 3VB5A 1N6YA 5I25A 2PP6A 2LELA 1F92A 1V2ST 1NRNH 3GY5A 1MTNC 1K1PA 1CA0C 3LJJA 3UOPA 2PKSB 2PSXA 1EPTB 3FKSD 1GHAF 2K0QA 1S0RA 4BXWA 1EJAA 1W2KH 1T4UH 1UTLM 4IC6A 4TPIZ 4YM9A 4OS7A 1V2MT 3BG4C 2A7CA 2ASUB 1IHTH 5EIYA 1C5QA 1Y3VA 1DFPA 3FP8E 3MU5A 3GCTF 1JRTA 2HNTF 1NS3A 1KYNA 1GBMA 2KCYA 2BQ7B 2ZZUH 2BX4A 4GUXA 3BTGE 3F9GA 1WAYB 7GCHF 7LPRA 5FX5A 5EPNA 2O8LA 1W0ZU 2Y7XA 3ODDA 4I8JA 4UE7H 5GNDA 1A5GH 3UPEA 3HK3B 1J8AA 3E90B 1KTTB 1GMDF 1EP6A 3S9BA 5GXPA 1GI3A 1Y59T 3V0XA 1C1WH 1QQ4A 1SQTA 3VG8A 3OEED 1Y3WA 3SORA 2OP9A 1VJAU 3MO9A 3EA8A 4ESTE 6CHAC 2YMSD 2FZZA 3TJNA 1ELBA 1C1QA 1P2OA 2FOGA 1W13U 1FY8E 2PGQB 1THPB 2NWNA 3URCA 2FP7B 1SI5H 2VIPA 3SYJA 1UCYE 5IK2D 1PQ5A 2AMQA 2BB4A 2Y82A 5LGOA 1V2TT 1AFQB 3T26A 5JPMH 1O3DA 2NU4E 1IQFA 2WV4A 1K21H 2SGPE 1A1RA 4KTCA 2FMJA 2ZIQH 1IQNA 3S9CA 1AE5A 2G51A 2A2QH 3NZIA 4B2AA 4A6LA 2BQ6B 2GV6A 1BHXF 2ZHFH 4M7GA 3WY8A 2A45B 1O3NA 5FPSA 3U1JB 1RTKA 1HRTH 5BPEA 1O5CB 2CJIA 1QTFA 5FBEA 1V2RT 5EODA 1GDNA 4FU9A 3PLPA 5LPFA 2NU2E 3SU3A 2TIOA 5AF9H 3M5LA 3UTUH 3PRBA 2JJ1D 3SJIA 1K9OE 1CSOE 4ZMAH 5F6MA 4UONA 3IITA 1FIWA 1ZSJA 1W3CA 3MNCA 3V12A 1G36A 2J97A 3RXQA 1UTPA 1P2KA 3T29A 1OWDA 3HATH 5T6FA 3Q3YA 3M7UA 1MBQA 1HAVB 1DLEA 2XWAA 1FQ3A 4K60A 1SQRA 1O36A 4X0WU 1JBUH 3RXFA 1EAIA 1SB1H 3KCGH 1A0HB 3EYDA 1ELAA 4INLA 4K8YA 3A89A 1VR1H 2F9NA 1QHRB 4BTIB 2CMYA 2PR3A 1O3BA 2K1QA 5C17A 5HYOA 1O2NA 1ANEA 3SUFA 5SGAE 1J14A 2UUFB 3E8LA 4NZQA 4YLUA 1N1LA 2HWLB 2OQUA 3GCTG 5ETXA 1ZMLA 2KFWA 1SHHB 2Y81A 2HPQH 4DVAU 7GCHG 1NROH 1P2NA 2ZHEH 3ZIAD 3WWFA 1N6XA 2V3HH 2IJOB 2H5CA 3ZZ7A 4R0IA 3MH5A 1PPFE 2OC0A 4Y76A 1W0KD 1C1OA 1GMDG 3UR9A 1C2KA 1UK3A 2HRVA 4I8KA 4IBLH 1XUKA 2ALPA 1NFUA 3CENA 1FPHH 1SBWA 2WZQA 3OAAD 3ZZ4A 2ODYB 4B2BA 1OYTH 3LONA 1ANBA 3H7TA 1A4WH 1V2VT 1HAZB 1DOJA 1PPCE 1C5WB 3P17H 3Q3KA 2BLQA 3QZRA 1BZXE 4MG3A 2F9UA 1DUAA 1C1MA 2QE7D 1AVXA 1E37B 2ZGHA 4X2YA 5JBBS 5GDSH 1GJ8B 1QFKH 1P02A 1MKWK 4D9QA 3P95A 3ZZ6A 3SJ9A 3OTPA 2BD5A 1SPJA 1VZQH 1GJDB 2ZNKH 1GG6B 1GI8B 2BDAA 4O97A 3TGIE 2GZ8A 1QIXB 4INKA 2R3UA 1FN8A 1GBEA 4JYVH 1QRZA 1MKXK 3URDA 1H9LB 5DP8A 3GDUA 1IQEA 5CHAB 2AGGX 3FANA 1QBOA 1RIWC 2FO9A 2VJ1A 2C8XB 3TH2H 1UTQA 2Z9GA 3AW0A 3CS7A 2H9HA 3DA9B 3PLBA 1P2IA 2ZTZA 4UFGH 1F5LA 5C67A 1MTSA 1BTUA 1T8MA 1C2JA 2F9BH 2QF3A 3SI4H 3DFJA 1VJ9U 1BCUH 1DS2E 1O32A 2JH0D 5HM2A 3GICB 4TT3D 2SGDE 4GCHF 3FAOA 1C4V2 1WBGB 3H5CB 3PV5A 2FIRH 1IQHA 1O34A 1NTPA 8GCHG 1XVMA 2KZ4A 3CP7A 1AFEH 3ZVGA 5DO4H 1CA8B 3Q00A 1S85A 1B0FA 1RD3B 3T5FH 3VPKA 1SLUB 1C2IA 5LPEA 3F9EA 1LHCH 4D9RA 1OWEA 3ATKA 2I6QA 1O39A 2BY9X 4X6NA 3W94A 2J9NA 1QB6A 4ZROA 4WJG2 2AMDA 3GDSA 2BY5X 4BAHB 1GVZA 1P9SA 3QGJA 1GBFA 4WVPE 4CREA 2A5KA 3LU9B 4ACBA 3E6PH 1RFNA 3L6PA 3A87A 2DUCA 2VVUA 3KGPA 1O2GH 2UUJB 3TJVA 4X8TH 1EZUC 4BAKB 1SMFE 5HKKD 1C5RA 1PYTD 2LNCA 4U32A 4RI0A 1TB6H 3NWUA 3RU4E 2J34A 1HPGA 5DP9A 4ISOA 4YT7H 1SC8U 2GJGA 1IQIA 4Y7BA 5CDFE 2GDEH 1YPHC 2V3MA 1W0YH 2PTCE 4YOIA 1T8LA 2GZ9A 2ZU2A 3GCHC 3VGCB 3UQOA 4P00A 1UVUH 1TNHA 1F0UA 5FXLA 5T6GA 1IQMA 5AFYH 2GCTB 1AZ8A 3T27A 3K65B 1O2RA 3OEHD 1PQ7A 4CH2B 4BNRA 2G4TA 3SUGA 1COWD 3RC4A 3QN7A 1SFQB 4ABFA 1S81A 1WDIA 1THRH 4IN1A 3KYFA 4Y0ZE 2QYIA 1BBRE 2ZF0H 5C20A 2TBSA 1K1LA 2GCHF 3BF6H 1CHOF 1O5GH 5C3NA 1XXDA 1CT4E 1S84A 2ZGCA 1HDTH 1PPEE 2ZHQH 1HAGE 1L2EA 1VCWA 1WUNH 3PTNA 1L1JA 2STBE 1ZZZA 1EATA 1Z8RA 5EXMA 5EG4A 3DD2H 3FFGA 2SGFE 1AY6H 4BAOB 2RDEA 1D4PB 1GWAA 1W7GH 1UCYK 3LT3A 5EJLA 1C5NH 5EQSA 4MNVA 1P8VC 1UTJA 3M35A 1GI4A 3A83A 1XXFA 2HPPH 4K5ZA 4MNXA 4JK5A 2P95A 3BIUH 1OWHA 6ESTA 2BXTH 3TJUA 1J16A 1DWDH 2FTMA 2YMSC 1K0HA 1HNEE 5KEDA 1J15A 4THNH 2O9QA 4RT0A 1TRYA 2PGBB 5C0UA 2A4OA 5FCKA 1L1GA 4FU7A 3ZV8A 2ANKH 2SGAA 4TSFD 3RXSA 1IHSH 1E79D 1F0TA 4NIYA 2F91A 1HAIH 1YLNA 2ODQA 1TGCA 5LH8A 2WPJS 4NA8A 1K1MA 1TWXB 2QA9E 1OP8A 2JKHA 3HKJB 4Q63A 1KXFA 1QB9A 3U8OH 1ZHPA 1QCPA 3SU1A 2XYAA 1OWIA 2P94A 1V2WT 1CT0E 2NU3E 1NBME 3GY4A 2J94A 3UB0A 1EX3A 4MPVA 1PJPA 3BG8A 1GI9B 2FDAA 4AZ2B 4NCYA 1P11E 2BY7X 1O3EA 1C5LH 1EAWA 2RFKC 3DSGA 5G4BA 1QBNA 2Q6GA 3RXPA 2EY4C 4Q7XA 2VIVA 3MI4A 3FOAA 3PV2A 3QTVH 2QXGA 1ZTJA 5DP7A 4NGAH 2PKSC 4ASHA 1GL1A 1UVSH 2KAIB 4AOQA 4IMQA 3WW7A 3A84A 5L30H 2H1UA 1P2QA 2GDDA 4X1SU 3SNCA 2VVVA 2AMPA 3ZZDA 1O2YA 1RXPA 2WPKS 1P01A 4GAWA 3GS9A 2QXJA 2GCHG 2G5NA 1BTZA 1TA2A 1FY3A 1DM4B 2A4QA 4CRBA 2VU8E 1NRSH 1YKTA 3BTDE 4GVUA 2FYQA 3PMAB 1SGDE 2FI3E 3ELAH 2ZTYA 3QLPH 4TY7A 3KQBA 2H9TH 4H6TA 4H6SB 4HGCA 1PPBH 5GIBA 1OKXA 5A09A 3TK5A 3C1KA 3TU7H 4NWLA 1HCGA 3A86A 2YNAA 3TPIZ 3GY8A 3EGKH 2CN0H 1YPJH 3MU8A 3MU0A 1C4U2 4JMYA 1H9IE 4AX9H 5DP4A 1FAKH 2EI7A 1LQDB 1MUEB 2TGPZ 1TNLA 2ZU1A 4ISNA 2QCYA 1BTHH 2ZI2H 3ITIA 4MVNA 5BRRE 2AH4X 1W7XH 4H42U 4DT7B 3DUXH 5DP6A 1SGPE 3SI3H 1EXFA 1KLIH 3TLOA 3FP6E 2WYJA 2G4UA 3KHVA 4JZIA 2Z9IA 2ZP0H 1HAXB 1MQ5A 1XKAC 1AFQC 3A8DA 1O2ZA 5DN6D 1G9IE 3MMGA 3UNRA 2QXIA 4TYDA 3SZNA 1F7ZA 3KN2A 1ZYOA 1PFXC 4F55A 2VNTA 5JB8S 3RU4D 1AQ7A 1O2OA 3UY9A 2AERH 4YOJA 1T4VH 2EEKA 1UTNA 1HUTH 1HV7A 2GV7A 5F8ZA 2HNTE 2W6ID 2PV9B 3KNXA 1W10U 1MCTA 1Z71A 1GI6A 4CRFA 1KXDA 2OINA 2GKVE 1C2GA 2BZAA 1LHGH 3E0PB 3GYMA 1Q3XA 1E1RD 1GDQA 1TFXA 2VIWA 1TMBH 5FCRA 1TE0A 1Z6EA 2GVFA 1AVGH 1ZPBA 2IPQX 3PROA 4P02A 4WMDA 2P8OB 5F8TA 1SKYE 4FUHA 3SNDA 3FN8A 1TA6A 3KF2A 2WV5A 1BTXA 3M7TA 3NKKA 2C93B 4K3JA 5K7RA 4X6OA 4NIWA 2GP9B 4CH8B 1KXCA 1P2JA 2QGRA 3LGVA 1MD8A 1TPSA 4NG9H 5GPIB 2Y5GA 1F5KU 4OM9A 1E0FD 1TMTH 4JZDH 4ABEA 1IQGA 1AU8A 2A32A 3CNRA 5FPTA 3E16B 3A8CA 3NRLA 3UREA 4HZHA 1XVOA 2WPLS 5A8XA 3ZZ3A 1J9CH 5EQQA 4AFSA 1QGFA 1TOCB 4OS1A 3S9AA 4MPXA 1NZQH 3M5OA 3SU0A 1AB9B 2B8OH 1PYTC 4XE4A 1ZJDA 1AKSA 3AAVA 3GOVB 1NESE 1GHWH 4Q2KA 3RXDA 1W0JD 1DWBH 3LOXA 3SHCH 1ZPCA 2UUYA 1RGQA 3F3BA 1GBJA 1C9PA 4Y8YA 2QC2A 3AASA 3A8BA 1BBRK 2AYWA 5HMAA 1QURH 2VWOA 4NWKA 1VKYA 1BMAA 2BD2A 3BN9A 3F2GA 1OWKA 3KQDA 3SNAA 1O37A 4BANB 1Z1IA 5L2YH 3RXLA 1B5GH 1G3EA 3AVZA 1QL7A 4JZEH 2IPHA 3E0NB 3L3TA 1EB2A 1GI7B 3ATLA 3U28C 5C94A 1OX1A 5L6NH 3RXAA 3DFLA 2W26A 2FOFA 4ZH8A 3FVFB 2WYGA 1ETTH 1C2MA 5A0CA 5TJXA 3GY2A 3SJOA 1GG6C 4FU8A 4B1TA 3EE0B 2BDIA 2QF0A 1C1VH 1PPHE 1XX9A 1NBMD 1C5UA 3KYGA 5F03A 5ABWA 1MCVA 2GT7A 2OUAA 5CHAC 6GCHF 1UJ1A 2ZU5A 3OY5U 1O35A 2VIOA 3F9HA 4ZAEA 1G3BA 3S7KB 3VEQB 8ESTE 1KSNA 2CHAB 4RSPA 1TGSZ 2AIPA 1SGQE 2H9EH 3ATWA 4Z1MD 3SV6A 1DSTA 1QL8A 2BY6X 1QA0A 2VB0A 1CO7E 1FY4A 2JJ2D 3N99A 5K0HA 4K2YA 2HALA 5J4SA 1EKBB 1LO6A 3B8JA 4AC9A 1BMNH 7KMEH 2WHXA 1C4Y2 2ZDLA 2ZCHP 2GX4A 1FNIA 2ZHWH 1HJ8A 2H2ZA 2ZTXA 4ZHLU 3K2UA 3A80A 1GDUA 3ENSB 2F9PA 4IMZA 3FZZA 5EPYA 1WXRA 4RN6A 2BHGA 1MABB 1C5YB 1CBWB 1NRPH 1DANH 1BTPA 3UNSA 1TNIA 4MDSA 1O3KA 1SGNE 2L6OA 2FEQH 1W8BH 1P09A 1BHXB 3PB1E 3TH4H 4CRCA 1B7XB 2QY0B 4A1XA 5DP5A 5A8YA 4GLYA 1EUFA 1KY9A 5T6DA 5GCHG 1A61H 1HFDA 1ESAA 1QJ1B 1SGIB 3LC5A 1P10A 1MKXH 3TGJE 1TONA 5IYTA 1DXWA 3SUEA 2BLVA 1JWTA 4ABBA 1CVWH 3DCLA 3SV9A 1EOJA 4D7GA 1DSUA 2WPDD 8GCHF 3F9FA 3HGNA 1PQ8A 3QK1A 1AE8H 3N7EA 1C5OH 1O30A 1W14U 1K1OA 2ZPSA 3F0OA 3VGCC 1S5SA 1BUIA 4ISHH 3RXUA 4X1QU 5AFZH 4QT8C 4YESB 1GGDB 2G55A 2OC7A 1OP2A 3NCLA 1TPOA 1A7SA 2GCTC 1FJSA 1GBDA 1MU8B 2AGIX 1Y5AT 1KLTA 4ABAA 1QNJA 2O8WA 3ZZ9A 2SNWA 1O3GA 3PM3A 1A3BH 1TGNA 2FOEA 5DPAA 2WINI 1A5IA 2BDHA 5TCCA 1OWJA 1K1IA 1FI8A 2P3UB 1O3HA 1HJ9A 2RA3A 2ANWA 1H8ED 3SGQE 1K28D 1TRNA 4CRDA 4Q7YA 1OP0A 4JZ1A 3V7TA 5A0AE 2ZQ1A 1MQ6A 3M5MA 1DITH 3SGBE 2Q6DA 1ZMJA 2RDLA 4ZUHA 1O0DH 2AFQB 3GISB 1EAXA 2FI5E 4YT6H 3U98H 2F9VA 1UTOA 4DCDA 6GCHG 4UDWH 2J92A 4MLFB 3UWJH 5DKMA 2ZDVH 1ZGIA 3ZVDA 1D3DB 1SHYA 2KM0A 2OCVB 1C2EA 4X8SH 1S82A 1C5TA 1C5ZB 2XBXA 1FPCH 3TK6A 4KTSA 2V3OH 1OSSA 2XC0A 2THFB 3BEUA 1DUEA 4JK6A 8KME2 2D8WA 2OTVA 1SQAA 2PFEA 1XUJA 1VCPA 3BEFB 5E0GA 1TBZH 4I8GA 1AUJA 1NT1A 1YM0A 3ZZBA 1UHBA 1RS0A 2FOBA 2GGVB 2PLXA 1CGHA 1ZLRA 3MYWA 4Q4LA 1O5FH 5DSFA 2D2DA 3HGPA 3B23B 4X8UH 2V35A 3MH7A 2TGAA 1CU1A 2ZFTA 4ABHA 3A85A 2ZPRA 5DG6A 4IN2A 2VIDA 3EA9A 8LPRA 4B76A 1ZGVA 3BTKE 4KKDA 2WPMS 5KECA 2XC4A 1QA7A 4I86A 4TWWA 3P8NA 1O33A 1MAXA 4BOHA 1GHZA 3SU5A 1GCTB 1XMNB 1CQQA 4I33A 1TNGA 5IDKA 4UD9H 3RXIA 4B73A 4DY7B 1OHHD 2CV3A 2HLDD 1O2MA 2KCOA 2ESTE 1Y8TA 4MTBA 5DGJA 1ORFA 4DIHH 3JZ1B 3RXHA 1GVKB 1BQYA 1TGBA 1GPZA 1FY5A 1O3MA 1O2JA 1L4DA 2AHME 3UAIC 1QRXA 1TNJA 1AVWA 4F49A 1P05A 1O3JA 2R2MB 1JIMA 3HKIB 3T2NA 2G81E 1RTFB 2XTTB 1JIRA 3HPTB 4NZLA 1QL9A 2P3TB 3ZVEA 1GJ7B 2V7QD 2HLCA 2ZHDA 4ISLA 2ZU4A 4Y8ZA 4JYUH 1ZOMA 1VGCB 2BDCA 1BRUP 1HIAA 1MU6B 1S83A 4CR5A 2BOKA 2B7DH 4Y11E 2D26C 5DJ7A 2BTCE 3JZ2B 3A81A 5B6LA 2QIQA 1SGFG 3UWIA 3EAJA 2VWLA 1QBVH 1MTWA 1Y5BT 1SR5C 1MZDA 2PKAA 4GHQA 1TLDA 3MNXA 1SGYE 1ELVA 2AGEX 1AD8H 3MH4A 4BTTB 3LH3A 1DVAH 4H4FA 1N8OB 4O03A 5F53A 1V2NT 1EJNA 4YZUA 2H5DA 3RDZA 1DY9A 2FLRH 2W3KA 3KQ5A 1YPGH 3PTBA 3RMLH 5EW1H 1AIXH 1ZHMA 2V0BA 4ZKNU 3QZQA 1RJXB 1SFIA 2OK5A 4E06H 5HIZA 4F48B 1EOLA 3D49H 1D3TB 1UVPA 2GMTB 1EFRD 2A4GA 1FLEE 2UWOA 3ZZ5A 2PSYA 3D62A 1IQJA 2P59A 3VFEA 4I32A 4K1TA 4XD7D 3SNBA 2ZGXH 3SV7A 2ZFQH 3FZDA 3SV2H 1J17T 5GWZA 1GL0E 3MNSA 5E2PA 1Y3UA 4FUCA 1XUHA 4IGDA 1Q31A 3F0PA 3SQHE 1GBTA 2BXUH 3A7WA 1GJ5H 1TX7A 2G00A 3FP7E 1NU9A 1XUFA 1LVYA 4FVDA 1BIOA 1TMUH 1UW7A 1P57B 3AAUA 4DG4A 1BDAA 1GBIA 4ZXXH 1FN6A 1MTUA 1WTGH 1A3EH 1IQKA 4JZFH 2A31A 1G32B 1D9IA 1ZSKA 3RM0H 3P92A 3KIDU 2Z3DA 1H4WA 1YWUA 1JXPA 3DSOA 4NFFA 2K8IA 3PLKA 4U01A 3MO3A 3L33A 1A46H 1GI1A 1OXGA 2BOHB 4KTUA 1YPHE 3A7ZA 2PUXB 4X2XA 1A2CH 2QV1A 2P8OC 3GYLB 1C5PA 1Y3YA 1H8HD 3MFJA 3VB4A 3P8FA 3U69H 4UFEH 2W6JD 4X6MA 1OPHB 4CHAB 2ANYA 1S6HA 3BTWE 5EGMA 3FO8D 1FZZA 1G2MA 1CGIE 9ESTA 4Q7ZA 3RXTA 3EDXB 3LJOA 4XBDA 1WV7H 1KXAA 1PQAA 2HGTH 1G2LA 1GHBF 3OU0A 1EB1H 3LGIA 4DOQA 1C5SA 3TH3H 1GBCA 2FPZA 3EQ0H 1EPTA 1C2FA 3PO1B 4ZKOU 4F4OC 1MTVA 1AB9C 1UHBB 2ZWLH 4INHA 1P12E 2F3CE 3DT0H 1AMHA 1C1PA 2TPIZ 3H09A 1GBLA 4FUFA 3TVJB 3MOCA 1LVOA 2KCPA 1S6LA 2G8TA 2KR7A 4KGAA 3S69A 1ANDA 5E0JA 1FDPA 2P93A 4AGKA 4AFQA 2H6MA 1THSH 1LPKB 4MPWA 1VITH 4HG6A 2OC1A 3GDVA 2HVYB 1NRQH 1UTKA 1TPPA 1RTLA 1NFWA 1KMHB 1C5MD 2G52A 2GD4B 1SL3A 3MO6A 1C1TA 1G3CA 2HNTC 1LHEH 1WCZA 3AK5A 2W7UA 1C2DA 1TQ7B 3RXKA 4LZ1H 4MNWA 1ZPZA 2SFAA 2ZG0H 1DDJA 1O2PA 2BMGB 2DE9A 3A7VA 1NFYA 1EASA 2BVRH 2YNBA 1NFXA 4Z6AH 5A2MH 1DPOA 1FXYA 1YCPM 2A7JA 2WSSD 1BRBE 4FUEA 2F83A 4ZXYH 5L2ZH 2AS9A 2CHAC 1V2OT 3BTFE 1L1NA 5E0HA 2BYAX 4Y0YE 1HIAB 1VCQA 2WV9A 4AFUA 3RM2H 4AORA 2VWNA 3O8CA 1TNKA 3RXJA 1K1JA 2ZFSA 4X1RU 2ZEBA 2R2WU 2NU0E 2I6SA 5AHGH 3A7XA 4ABDA 1YBWA 3KL6A 4FVBA 3RXBA 1KIGH 2M5TA 2PKAB 1SQOA 1BBRH 1EAUA 4NIXA 3UFAA 5B6OA 1LVBA 3LC3A 2ALVA 1EJMA 2ZO3H 4K1SA 4VGCB 1Z8GA 4ABJA 1GHVH 3UOUA 1CBWC 1O2QA 1WTHD 5JB9S 1DY8A 1X7AC 4A1TA 2A7HA 1AWHB 3BTHE 4FUDA 1H8IH 2HOBA 5JBTA 3TNTA 4LK4A 1GHBG 1ANCA 2XW9A 2F43B 3ESTA 3F1SB 1KDQA 3MU4A 1GI5A 1LHFH 1ESBA 3RXVA 2BVSH 3SBKA 1D3PB 4D76A 1QY6A 4A7IB 5CE1A 1BA8B 5DP3A 5ESBA 3T28A 3S7HB 2ODPA 2TGDA 1O3AA 4DIIH 1SGFA 3M3TA 1GHYH 3K6YA 2FOMB 2IOTA 4Z0KA 3SJ8A 3W1EA 4B6FA 4CRAA 1TOMH 2UWLA 3MH6A 5F8XA 3ZVBA 1LVMA 1O2XA 2J4IA 4X6PA 4XRNA 5I46H 1QJ6B 1W11U 2BD7A 2CXVA 1HYLA 1E38B 1BMLA 3I77A 1GGDC 3SGAE 1D6RA 2FLBH 5AVDA 2XCFA 5JBCS 2J95A 3IWMA 1E36B 1QQUA 3STJA 4AG1A 5T3HA 1YP9A 2BDBA 4CBOA 2FI4E 1FMGA 4K8BA 1DICA 5GCHF 1Q2WA 4YTAA 2QF5A 4BXSA 3TIUA 1CE5A 1UO6A 2OC8A 2BD8A 1YGCH 4ZHAA 1WU1A 1GCDA 1INCA 1MBMA 1GJ4H 4GSOA 4ZKSU 4OS6A 1P3EA 2FESH 1P03A 2FOCA 4B71A 5E8EH 4AG2A 1C2LA 3SJKA 2IJD1 1IAUA 2XBWA 2W3IA 2B0FA 2WPIS 2YOLA 3LH1A 2B9LA 1C1SA 1ARBA 3EE7A 3V3MA 1MAYA 4OGYA 2V6NA 2VIQA 2JETB 4B2CA 2Q6FA 2ZKSA 2PUQH 3ZV9A 1ELDE 1QJ7B 3KEEA 1XUGA 4IW4E 4BTUB 5LPRA 3T62A 5H4IB 2BY8X 2Y80A 3RLWH 1BJUA 3NXPA 1ABJH 2ZFPH 1O2UA 2WPHS 3RC6A 3RMMH 3PRDA 2R9PA 4E05H 1FX0B 5EJZA 3RXEA 1LQEA 5HGGA 4X1NU 2Z94A 4J1YA 1MH0A 1HJAC 2Y6TA 4K69A 3KQCA 4KELA 5C0TA 1FIZA 2P3FH 4WH8A 2ZDKA 2FS9A 4B6EA 4JCNA 1C1UH 3IG6B 2Z3CA 5FL7D 1T7CA 1AGJA 1DWEH 1KXEA 4B75A 1WQVH 1GCTC 3NK8A 1YCPK 1AO5A 1LKAA 1BTWA 2BD3A 2Y5FA 3SN8A 1GBAA 4XBCA 3E3TA 2A5AA 1E34B 4YO9A 5PTPA 4DW2U 1SLVB 3P6ZB 1DLKB 3SOSA 2AIQA 3MNBA 1WOFA 1EZSC 3RXCA 4Y6DA 1GJBB 1BRAA 1K2I1 2AEIH 2DE8A 4MPUA 1BT7A 2O8TA 4UFDH 3D23A 1P04A 2STAE 1ETRH 3U8RH 1MKWH 1ETSH 2ZDNA 3RLYH 4DT4A 4SGAE 1VGCC 2EC9H 4DJZB 3PMJA 3PMHB 1L4ZA 3I29A 2OLGA 1SG8B 3M3VA 2SNVA 4A92A 3F2FA 2BLOA 4Q80A 2XBYA 1FONA 5E2OA 3QX5H 2G5VA 3K9XB 2SGEE 3RP2A 4GPGA 1D6WA 1YPKH 3BEIB 3SU6A 4ZKRU 3F2HA 4NSYA 1JMOH 2VGCB 1AHTH 1KTSB 1GJCB 1ZR0A 1NC6A 1Z7KA 2XRCA 1E35B 3RUOA 1N8OC 1P0SH 2C4FH 1FV9A 2F4LA 1V6DA 1O5AB 3CS0A 1DT2A 4Y79A 2C8YB 1E1QD 3GCNA 1LCYA 3NPSA 4NFEA 3DSPA 4LZ4B 1BOQA 3RXGA 2BD4A 1UK4A 1TX6A 1Y3XA 2BDGA 1BITA 2VBCA 2ZU3A 3STIA 4K1EA 1P3CA 2GMTC 4XOJA 1HAYB 2BVXH 1KDQB 1ELGA 3G01A 1UMAH 3LGYA 2A4RA 1C1NA 1GHAG 3EA7A 2TGTA 4MQAA 3QTOH 3BTEE 3ZZ8A 1IQLA 2WUBA 3OE7D 2Z9JA 4A1VA 3VXEH 3PYHA 1Y5UT 2GTBA 1TABE 4U2WA 4FETA 1YPEH 3TITA 2ZPQA 4WXVA 3DHKH 4CRGA 2B5TB 1C5XB 1SGTA 3ZZAA 3NUMA 3KQEA 2ZA5A 3N7OA 1ZRKA 1GMHF 1BMMH 2D1JA 2FS8A 3TJOA 3TGKE 1YYY1 4WWYA 1MTNB 2VVCA 1CA0B 1O2SA 1BTYA 1O3CA 2OBQA 2ZCKP 1FUJA 1D3QB 3UUZA 1S6FA 2XNIA 1H1BA 3F6UH 1T32A 1T8OA 4YOGA 3LGUA 3M3SA 2Z9LA 2PW8H 3OX7U 1V2PT 3PV4A 3AW1A 4KP0A 1XKBC 1AKSB 3U1IB 1FY1A 1WSSH 3LGTA 3GY7A 3BG4B 3VB3A 3P8GA 1HJAB 3UQVA 2LP6A 4BAQB 1YY3A 2KX4A 3UR6A 2XC5A 2PWXA 1V3XA 1LPGB 4XSKU 2GT8A 4CHAC 1P9UA 4DGJA 4RT1A 2ZFFH 2XOKD 3BV9B 1O2VA 2VWMA 4E7NA 3QO6A 4XFQA 3SV8A 4ASUD 4FOUC 3V13A 1Z8JB 1S0QA 6LPRA 4J2YB 1HGTH 3BTTE 2FM2A 1HXFH 1C2HA 3MHWU 5T1VA 5JBAS 2A2XH 1C1RA 1LKBA 5EJ1A 1HAPH 4D8NA 1DXPA 3PO1C 4X2WA 2KAIA 3O8BA 4ZHMU 1O5EH 1NPMA 1CT2E 2JIZD 4R8TB 3D65E 4DURA 1O2TA 1ZHRA 2R0LA 6CHAB 3Q3XA 1UCYH 2LPRA 3RXMA 1TGTA 3SHAH 4AYVB 2HVXA 5JDUB 2ILNA 5EW2H 2PHBA 3OY6U 3VXFH 1LTOA 5EQRA 1A0JA 2Y5HA 1U6QA 1NN6A 3GY6A 3RMNH 5CHBA 3R3GB 3MWIU 4FXGH 4NA7A 2FODA 5GJ4B 4WH6A 3U9AH 1P2MA 2O8MA 2ZDAH 3M36A 1TAWA 1O2IA 1O3LA 2OXSA 1AN1E 2UWPA 2FYRA 1UTMA 3ZVAA 4SGBE 5EXLA 1O2LA 3ZVCA 1HBTH 1GBBA 5FBIA 2EA3A 2FWWA 2XNDD 1EZQA 1EQ9A 1O2KA 1YPMH 1BMFD 1K22H 1ZMNA 1UVOA 4LOYH 1BJVA 5DK1A 1GI0A 2CGAA 4AYYB 1F5RA 1TQ0B 3LGWA 1O31A 4TPYA 2BD9A 3PWCA 3QUMP 1NY22 1V2JT 2ZDMA 1GMHG 1GMCF 2QXHA 1GBHA 4I7YH 1ELTA 1M9UA 4PROA 4WMFA 1UK2A 4E7RG 5C1YA 1AZZA 2ZFRH 2J98A 5EXNA 1W12U 1OYQA 1BB0B 3VB7A 1QZ8A 1SLXB 4Y10E 3PWBA 2R0KA 1GHXH 1YPLH 4XBBA 4VGCC 1GJAB 4X1PU 1GJ9B 4Y71A 3SZEA 2EI6A 3SW2B 2W5EA 3GCOA 4A5TS 3LIWA 4NA9H 3OSYA 3I78A 2XWBI 1C9TA 1SSXA 9LPRA 1V2UT 5C1UA 4AFZA 2OD3B 3TNSA 1F0SA 3ZYDA 5ESTE 2RCEA 1H9HE 3SQEE 3PMBB 5J4QA 1TBRH 1O3FA 3RC5A 2OBOA 2BX3A 3SO3A 5KGOA 2NU1E 1LMWB 4YLQH 3RXOA 1NU7B 3E1XB 4OS5A 4I8HA 3U8TH 3BTME 2C3SA 5C5NA 5TCAA 1HXEH 3BIVH 1T31A 4OGXA 3E91A 1T8NA 4MNYA 2Z3EA 3QWCH 1AI8H 3QGNB 2JH5D 5HM9A 3QDZB 1VITF 2W7SA 5C5OA 1O3IA 1G37A 1QR3E 2TRMA 1NO9H 2FOAA 3P70B 2BDYA 4I31A 1RRKA 1DX5M 2Y7ZA 3MU1A 4GCHG 4NIVA 2KCAA 1TIOA 1Z8IB 1SGCA 2P16A 2J2UA 3T25A 1AUTC 1HAHH 4AN7A 2J5UA 4FUBA 2F9OA 1ELCA 3A88A 4Y7AA 2L74A 3C27B 1RIWB 4O3UA 1ZSLA 1GJ6A 1FAXA 3BSQA 3H7OA 1DE7H 3GY3A 4CBNA 4NSVA 1GI2A 4Y8XA 2ZQ2A 2Q1JA 1V2KT 2O8UA 4JYTA 3MQKC 1L0ZA 2EI8A 3P8OA 1ELEE 1P06A 1OOKB 5JYIA 3A82A 3VB6A 2ZC9H 1O2WA 4RKOB 2CK3D 3RU4T 1NRRH 1ZTLA 3O8DA 5EOKA 5CMXH 2FTLE 5FX6A 2A5IA 4X2VA 1GMCG 5HIYA 2QAAA 2JETC 1AWFH 4OS4A 1WYKA 1SLWB 1A5HA 4U30A 3M61U 4WF8A 3MTYA 1EZXC 1ARCA 1EPTC 4AB9A 1BRCE 2A0QB 5A8ZA 4I8LA 2QF4A 2XCNA 3N7DA 4HI3A 1MD7A 4BAMB 2FXRA 1ABIH 1XM1A 3M37A 1LHDH 1B0EA 3Q76A 4CR9A 2BLWA 5FAHA 2ZGJA 3ZVFA 2M2AA 3B9FH 1CHOG 3A8AA 2Z7FE 3A7YA 3M7QA 3S0NA 1YLCA 3LDXH 3UIRA 1GBKA 1OS8A 3ATMA 1GVLA 1KXBA 4RKJB 4ACAA 5HXFA 1CHGA 3ZYEA 1PPZA 4FUGA 3GCHB 1MZAA 2C8ZB 3K6ZA 4WXIA 3SUDA 1TALA 1LDTT 2SGQE 1HLTH 3M5NA 4GHTA 2C8WB 2VH0A 1MMJN 1QB1A 2A1DB 4FUIA 4ABIA 1SGRE 3LPRA 7ESTE 2OQ5A 1SGEE 3OFND 5C1XA 1ZJKA 1V2QT 4LXBH 4WY3A 1H8DH 1JOUB 1TYNA 1VITG 2UUKB 3OYPA 2J38A 1ZTKA 5C2ZA 1SOTA 4M9FA 1Z1JA 1ACBE 2BM2A 1O38A 1F2SE 4FUJA 1F0RA 1WQSA 3Q77A 2FOHA 2CF8H 3UNQA 1SVPA 3ATIA 1KLJH 1HAVA 1YLDA 2Z6BD 5FHTA 2CF9H 4AB8A 3WWBA 2FX4A 2JH6D 3LKWA 2J98B 4TWYA 3OTJE 1CGJE 2IN2A 1O2HA 3ODFA 1DWCH 1V2LT 2C90B 2GZ7A 2VGCC 1UVTH 1G30B 1O3OA 1HB0B 2XXLA 3SU2A 1SOZA 2WUCA 2VINA 4HTCH 1HAOH 1TBQH 1O5DH 2R3YA 4UFFH 2RA0A 2FX6A 1K1NA 4ISIH 2YMSB 3R0FA 3F68H 4TY6A 1XUIA 4XDEA 2ZGBH 1PPGE 3W95A 3ZZCA 2Z9KA 1A0LA 2ZCLP 1NM6A 1YCPH 1ID5H 2VH6A 4B74A 4IC5A 4HFPB 4O9VA 1O3PB 1IOEA 1TRMA 1ELFA 2PTNA 3O8RA 2ANMH 3SNEA 2QN5T 1G3DA 2XBVA 1TPAE 1TX8A
chains in the Genus database with same CATH topology
1ZRBA 4AGJA 1O5BB 3HK6B 3TK9A 4WMEA 1YC0A 2BQWB 1LPZB 1C5VA 1QRWA 5EU8A 5FPYA 2BZ6H 3RMOH 1Z6JH 3SU4A 4ABGA 1ESTA 1JRSA 1EP5A 3A7TA 2RG3A 1YF4A 4X8VH 2ZECA 4O3TA 4IS5A 5A0BA 4OS2A 4D7FA 2ULLA 3RXRA 3BTQE 4UEHH 3VB5A 1N6YA 5I25A 1F92A 1V2ST 1NRNH 3GY5A 1MTNC 1K1PA 1CA0C 3LJJA 3UOPA 2PKSB 2PSXA 1EPTB 1GHAF 1S0RA 4BXWA 1EJAA 1W2KH 1T4UH 1UTLM 4IC6A 4TPIZ 4YM9A 4OS7A 1V2MT 3BG4C 2A7CA 2ASUB 1IHTH 1C5QA 1Y3VA 1DFPA 3FP8E 3MU5A 3GCTF 1JRTA 2HNTF 1NS3A 1KYNA 1GBMA 2ZZUH 2BQ7B 2BX4A 4GUXA 3BTGE 3F9GA 1WAYB 7GCHF 7LPRA 5FX5A 5EPNA 2O8LA 1W0ZU 2Y7XA 3ODDA 4I8JA 4UE7H 1A5GH 3UPEA 3HK3B 1J8AA 3E90B 1KTTB 1GMDF 1EP6A 3S9BA 5GXPA 1GI3A 1Y59T 3V0XA 1C1WH 1QQ4A 1SQTA 1Y3WA 3SORA 2OP9A 1VJAU 3MO9A 3EA8A 4ESTE 6CHAC 2FZZA 3TJNA 1ELBA 1C1QA 1P2OA 2FOGA 1W13U 1FY8E 2PGQB 1THPB 2NWNA 3URCA 2FP7B 1SI5H 2VIPA 1UCYE 1PQ5A 2AMQA 2BB4A 2Y82A 5LGOA 1V2TT 1AFQB 3T26A 5JPMH 1O3DA 2NU4E 1IQFA 2WV4A 1K21H 2SGPE 1A1RA 4KTCA 2FMJA 2ZIQH 1IQNA 3S9CA 1AE5A 2G51A 2A2QH 3NZIA 4B2AA 4A6LA 2BQ6B 2GV6A 1BHXF 2ZHFH 4M7GA 3WY8A 2A45B 1O3NA 5FPSA 3U1JB 1RTKA 1HRTH 5BPEA 1O5CB 2CJIA 1QTFA 5FBEA 1V2RT 5EODA 1GDNA 4FU9A 3PLPA 5LPFA 2NU2E 3SU3A 2TIOA 5AF9H 3M5LA 3UTUH 3SJIA 1K9OE 1CSOE 4ZMAH 5F6MA 4UONA 3IITA 1FIWA 1ZSJA 1W3CA 3MNCA 3V12A 1G36A 3RXQA 1UTPA 1P2KA 3T29A 1OWDA 3HATH 5T6FA 3Q3YA 3M7UA 1MBQA 1HAVB 1DLEA 2XWAA 1FQ3A 4K60A 1O36A 4X0WU 1JBUH 3RXFA 1EAIA 1SB1H 3KCGH 1A0HB 3EYDA 1ELAA 4INLA 4K8YA 3A89A 1VR1H 2F9NA 1QHRB 4BTIB 2CMYA 2PR3A 1O3BA 2K1QA 5HYOA 1O2NA 1ANEA 3SUFA 5SGAE 1J14A 2UUFB 3E8LA 4NZQA 4YLUA 1N1LA 2HWLB 2OQUA 3GCTG 5ETXA 1ZMLA 1SHHB 2Y81A 2HPQH 4DVAU 7GCHG 1NROH 1P2NA 2ZHEH 1N6XA 2V3HH 2IJOB 2H5CA 3ZZ7A 4R0IA 3MH5A 1PPFE 2OC0A 4Y76A 1C1OA 1GMDG 3UR9A 1C2KA 1UK3A 2HRVA 4I8KA 4IBLH 1XUKA 2ALPA 1NFUA 3CENA 1FPHH 1SBWA 3ZZ4A 2ODYB 4B2BA 1OYTH 3LONA 1ANBA 3H7TA 1A4WH 1V2VT 1HAZB 1DOJA 1PPCE 1C5WB 3P17H 3Q3KA 2BLQA 3QZRA 1BZXE 4MG3A 2F9UA 1DUAA 1C1MA 4X2YA 1AVXA 1E37B 2ZGHA 5JBBS 5GDSH 1GJ8B 1QFKH 1P02A 1MKWK 4D9QA 3P95A 3ZZ6A 3SJ9A 2BD5A 1SPJA 1VZQH 1GJDB 2ZNKH 1GG6B 1GI8B 2BDAA 4O97A 3TGIE 2GZ8A 1QIXB 4INKA 2R3UA 1FN8A 1GBEA 4JYVH 1QRZA 1MKXK 3URDA 1H9LB 5DP8A 3GDUA 1IQEA 5CHAB 2AGGX 3FANA 1QBOA 1RIWC 2FO9A 2VJ1A 2C8XB 3TH2H 1UTQA 2Z9GA 3AW0A 3CS7A 2H9HA 3DA9B 3PLBA 1P2IA 2ZTZA 4UFGH 1F5LA 5C67A 1MTSA 1BTUA 1T8MA 1C2JA 2F9BH 2QF3A 3SI4H 3DFJA 1VJ9U 1BCUH 1DS2E 1O32A 2JH0D 5HM2A 3GICB 2SGDE 4GCHF 3FAOA 1C4V2 1WBGB 3H5CB 2FIRH 1IQHA 1O34A 1NTPA 8GCHG 1XVMA 3CP7A 1AFEH 3ZVGA 5DO4H 1CA8B 3Q00A 1S85A 1B0FA 1RD3B 3T5FH 3VPKA 1SLUB 1C2IA 5LPEA 3F9EA 1LHCH 4D9RA 1OWEA 3ATKA 2I6QA 1O39A 2BY9X 4X6NA 3W94A 2J9NA 1QB6A 4ZROA 4WJG2 2AMDA 3GDSA 2BY5X 4BAHB 1GVZA 1P9SA 3QGJA 1GBFA 4WVPE 4CREA 2A5KA 3LU9B 3E6PH 1RFNA 3L6PA 3A87A 2DUCA 2VVUA 3KGPA 1O2GH 2UUJB 3TJVA 4X8TH 1EZUC 4BAKB 1SMFE 1C5RA 1PYTD 2LNCA 4U32A 1TB6H 3NWUA 3RU4E 2J34A 1HPGA 5DP9A 4ISOA 4YT7H 1SC8U 1IQIA 4Y7BA 2GDEH 1YPHC 1W0YH 2PTCE 4YOIA 1T8LA 2GZ9A 2ZU2A 3GCHC 3VGCB 3UQOA 1UVUH 1TNHA 1F0UA 5FXLA 5T6GA 1IQMA 5AFYH 2GCTB 1AZ8A 3T27A 3K65B 1O2RA 1PQ7A 4CH2B 4BNRA 2G4TA 3SUGA 3RC4A 3QN7A 1SFQB 4ABFA 1S81A 1THRH 4IN1A 4Y0ZE 2QYIA 1BBRE 2ZF0H 5C20A 2TBSA 1K1LA 2GCHF 3BF6H 1CHOF 1O5GH 5C3NA 1XXDA 1CT4E 1S84A 2ZGCA 1HDTH 1PPEE 2ZHQH 1HAGE 1L2EA 1VCWA 1WUNH 3PTNA 1L1JA 2STBE 1ZZZA 1EATA 1Z8RA 5EXMA 5EG4A 3DD2H 3FFGA 2SGFE 1AY6H 4BAOB 1D4PB 1GWAA 1W7GH 1UCYK 3LT3A 1C5NH 5EQSA 4MNVA 1P8VC 1UTJA 3M35A 1GI4A 3A83A 1XXFA 2HPPH 4K5ZA 4MNXA 4JK5A 2P95A 3BIUH 1OWHA 6ESTA 2BXTH 3TJUA 1J16A 1DWDH 2FTMA 1HNEE 1J15A 4THNH 2O9QA 1TRYA 2PGBB 2A4OA 5FCKA 1L1GA 4FU7A 3ZV8A 2ANKH 2SGAA 3RXSA 1IHSH 1F0TA 4NIYA 2F91A 1HAIH 2ODQA 1TGCA 5LH8A 2WPJS 4NA8A 1K1MA 1TWXB 2QA9E 1OP8A 2JKHA 3HKJB 1KXFA 1QB9A 3U8OH 1ZHPA 1QCPA 3SU1A 2XYAA 1OWIA 2P94A 1V2WT 1CT0E 2NU3E 3GY4A 2J94A 1EX3A 4MPVA 1PJPA 3BG8A 1GI9B 2FDAA 4AZ2B 4NCYA 1P11E 2BY7X 1O3EA 1C5LH 1EAWA 5G4BA 1QBNA 2Q6GA 3RXPA 4Q7XA 2VIVA 3MI4A 3QTVH 2QXGA 1ZTJA 5DP7A 4NGAH 2PKSC 4ASHA 1GL1A 1UVSH 2KAIB 4AOQA 4IMQA 3A84A 5L30H 2H1UA 1P2QA 2GDDA 4X1SU 3SNCA 2VVVA 2AMPA 3ZZDA 1O2YA 1RXPA 2WPKS 1P01A 4GAWA 2QXJA 2GCHG 2G5NA 1BTZA 1TA2A 1FY3A 1DM4B 2A4QA 4CRBA 2VU8E 1NRSH 1YKTA 3BTDE 4GVUA 2FYQA 3PMAB 1SGDE 2FI3E 3ELAH 2ZTYA 3QLPH 4TY7A 3KQBA 2H9TH 4H6TA 4H6SB 4HGCA 1PPBH 5GIBA 1OKXA 5A09A 3TK5A 3C1KA 3TU7H 4NWLA 1HCGA 3A86A 2YNAA 3TPIZ 3GY8A 3EGKH 2CN0H 1YPJH 3MU8A 3MU0A 1C4U2 4JMYA 1H9IE 4AX9H 5DP4A 1FAKH 2EI7A 1LQDB 1MUEB 2TGPZ 1TNLA 2ZU1A 4ISNA 2QCYA 1BTHH 2ZI2H 3ITIA 4MVNA 5BRRE 2AH4X 1W7XH 4H42U 4DT7B 3DUXH 5DP6A 1SGPE 3SI3H 1EXFA 1KLIH 3TLOA 3FP6E 2WYJA 2G4UA 3KHVA 4JZIA 2Z9IA 2ZP0H 1HAXB 1MQ5A 1XKAC 1AFQC 3A8DA 1O2ZA 1G9IE 3MMGA 3UNRA 2QXIA 4TYDA 3SZNA 1F7ZA 3KN2A 1ZYOA 1PFXC 2VNTA 5JB8S 3RU4D 1AQ7A 1O2OA 3UY9A 2AERH 4YOJA 1T4VH 2EEKA 1UTNA 1HUTH 1HV7A 2GV7A 5F8ZA 2HNTE 3KNXA 2PV9B 1W10U 1MCTA 1Z71A 1GI6A 4CRFA 1KXDA 2OINA 2GKVE 1C2GA 2BZAA 1LHGH 3E0PB 3GYMA 1Q3XA 1GDQA 1TFXA 2VIWA 1TMBH 5FCRA 1TE0A 1Z6EA 2GVFA 1AVGH 1ZPBA 3PROA 4WMDA 2P8OB 5F8TA 4FUHA 3SNDA 1TA6A 3KF2A 2WV5A 1BTXA 3M7TA 3NKKA 2C93B 4K3JA 5K7RA 4X6OA 4NIWA 2GP9B 4CH8B 1KXCA 1P2JA 2QGRA 3LGVA 1MD8A 1TPSA 4NG9H 5GPIB 2Y5GA 1F5KU 1E0FD 1TMTH 4JZDH 4ABEA 1IQGA 1AU8A 2A32A 5FPTA 3E16B 3A8CA 3UREA 4HZHA 1XVOA 2WPLS 5A8XA 3ZZ3A 1J9CH 5EQQA 4AFSA 1QGFA 1TOCB 4OS1A 3S9AA 4MPXA 1NZQH 3M5OA 3SU0A 1AB9B 2B8OH 1PYTC 4XE4A 1ZJDA 1AKSA 3AAVA 3GOVB 1NESE 1GHWH 4Q2KA 3RXDA 1DWBH 3LOXA 3SHCH 1ZPCA 2UUYA 1RGQA 1GBJA 1C9PA 4Y8YA 2QC2A 3AASA 3A8BA 1BBRK 2AYWA 5HMAA 1QURH 2VWOA 4NWKA 1BMAA 2BD2A 3BN9A 1OWKA 3KQDA 3SNAA 1O37A 4BANB 1Z1IA 5L2YH 3RXLA 1B5GH 1G3EA 3AVZA 1QL7A 4JZEH 2IPHA 3E0NB 3L3TA 1EB2A 1GI7B 3ATLA 1OX1A 5L6NH 3RXAA 3DFLA 2W26A 2FOFA 4ZH8A 3FVFB 2WYGA 1ETTH 1C2MA 5A0CA 5TJXA 3GY2A 3SJOA 1GG6C 4FU8A 4B1TA 3EE0B 2BDIA 2QF0A 1C1VH 1PPHE 1XX9A 1C5UA 5F03A 5ABWA 1MCVA 2GT7A 2OUAA 5CHAC 6GCHF 1UJ1A 2ZU5A 3OY5U 1O35A 2VIOA 3F9HA 4ZAEA 1G3BA 3S7KB 3VEQB 8ESTE 1KSNA 2CHAB 4RSPA 1TGSZ 2AIPA 1SGQE 2H9EH 3ATWA 3SV6A 1DSTA 1QL8A 2BY6X 1QA0A 2VB0A 1CO7E 1FY4A 5K0HA 4K2YA 2HALA 5J4SA 1EKBB 1LO6A 3B8JA 1BMNH 7KMEH 1C4Y2 2ZDLA 2ZCHP 2GX4A 1FNIA 2ZHWH 1HJ8A 2H2ZA 2ZTXA 4ZHLU 3K2UA 3A80A 1GDUA 3ENSB 2F9PA 4IMZA 3FZZA 5EPYA 4RN6A 2BHGA 1C5YB 1CBWB 1NRPH 1DANH 1BTPA 3UNSA 1TNIA 4MDSA 1O3KA 1SGNE 2FEQH 1W8BH 1P09A 1BHXB 3PB1E 3TH4H 4CRCA 1B7XB 2QY0B 4A1XA 5DP5A 5A8YA 4GLYA 1EUFA 1KY9A 5T6DA 5GCHG 1A61H 1HFDA 1ESAA 1QJ1B 1SGIB 3LC5A 1P10A 1MKXH 3TGJE 1TONA 5IYTA 1DXWA 3SUEA 2BLVA 1JWTA 4ABBA 1CVWH 3SV9A 1EOJA 4D7GA 1DSUA 8GCHF 3F9FA 3HGNA 1PQ8A 3QK1A 1AE8H 1C5OH 1O30A 1W14U 1K1OA 2ZPSA 3VGCC 1S5SA 1BUIA 4ISHH 3RXUA 4X1QU 5AFZH 4QT8C 4YESB 1GGDB 2G55A 2OC7A 1OP2A 3NCLA 1TPOA 1A7SA 2GCTC 1FJSA 1GBDA 1MU8B 2AGIX 1Y5AT 1KLTA 4ABAA 1QNJA 2O8WA 3ZZ9A 2SNWA 1O3GA 3PM3A 1A3BH 1TGNA 2FOEA 5DPAA 2WINI 1A5IA 2BDHA 5TCCA 1OWJA 1K1IA 1FI8A 2P3UB 1O3HA 1HJ9A 2RA3A 2ANWA 3SGQE 1K28D 1TRNA 4CRDA 4Q7YA 1OP0A 4JZ1A 3V7TA 5A0AE 2ZQ1A 1MQ6A 3M5MA 1DITH 3SGBE 2Q6DA 1ZMJA 2RDLA 4ZUHA 1O0DH 2AFQB 3GISB 1EAXA 2FI5E 4YT6H 3U98H 2F9VA 1UTOA 4DCDA 6GCHG 4UDWH 2J92A 4MLFB 3UWJH 5DKMA 2ZDVH 1ZGIA 3ZVDA 1D3DB 1SHYA 2OCVB 1C2EA 4X8SH 1S82A 1C5TA 1C5ZB 2XBXA 1FPCH 3TK6A 4KTSA 2V3OH 1OSSA 2XC0A 2THFB 3BEUA 1DUEA 4JK6A 8KME2 2D8WA 2OTVA 1SQAA 2PFEA 1XUJA 1VCPA 3BEFB 5E0GA 1TBZH 4I8GA 1AUJA 1NT1A 1YM0A 3ZZBA 1UHBA 1RS0A 2FOBA 2GGVB 2PLXA 1CGHA 1ZLRA 3MYWA 1O5FH 2D2DA 3HGPA 3B23B 4X8UH 2V35A 3MH7A 2TGAA 1CU1A 2ZFTA 4ABHA 3A85A 2ZPRA 5DG6A 4IN2A 2VIDA 3EA9A 8LPRA 4B76A 1ZGVA 3BTKE 4KKDA 2WPMS 2XC4A 1QA7A 4TWWA 3P8NA 1O33A 1MAXA 4BOHA 1GHZA 3SU5A 1GCTB 1XMNB 1CQQA 4I33A 1TNGA 5IDKA 4UD9H 3RXIA 4B73A 4DY7B 2CV3A 1O2MA 2ESTE 1Y8TA 4MTBA 5DGJA 1ORFA 4DIHH 3JZ1B 3RXHA 1GVKB 1BQYA 1TGBA 1GPZA 1FY5A 1O3MA 1O2JA 1L4DA 1QRXA 1TNJA 1AVWA 4F49A 1P05A 1O3JA 2R2MB 1JIMA 3HKIB 3T2NA 2G81E 1RTFB 2XTTB 1JIRA 3HPTB 4NZLA 1QL9