2QEXO

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2qexO00
1Q86P 1K73P 1M1KP 1YI2O 1VQKO 1YITL 3OW2N 1KD1M 1N8RM 1YITO 3CCUO 1VQ9L 1VQLL 3CMEO 3CPWN 1VQ9O 3CC2L 1KC8M 1VQLO 3CD6L 1VQOL 1YIJL 1Q7YP 3OW2K 3CC2O 3CCLL 1QVGN 3CD6O 1VQOO 1K8AM 1YIJO 3CC7L 3CCQL 1KQSN 1JJ2N 1S72L 1VQ5L 3CC7O 3CCQO 3CXCK 3CC4L 1VQPL 1YI2L 1VQ8L 1QVGK 1VQ7L 1Q81P 3CC4O 1VQPO 1Q86M 1VQ8O 3CCUL 1K73M 1M1KM 1VQ7O 1JJ2K 1VQ6L 3CMEL 1W2BK 3CCEL 1VQ6O 3CCEO 1VQNL 1M90P 1K9MP 3CCJO 1YHQO 1VQNO 1YJNL 3I56O 3G71O 3CPWK 1YJ9L 1QVFN 1YJNO 1KD1P 1YJ9O 1VQ4O 3CMAL 1Q82M 3CMAO 1KQSK 3CCRO 2QA4L 3G4SL 3CCML 3CCSO 1VQML 2QA4O 1NJIP 3G4SO 2OTLL 3CCMO 1VQMO 3CCJL 1YHQL 1YJWL 2OTLO 2QEXO 3G6EL 3I56L 3G71L 1YJWO 3I55O 3G6EO 1Q7YM 1VQ4L 1N8RP 3CCRL 1KC8P 3CCVL 3CCSL 1QVFK 1Q81M 3CXCN 3CCVO 1K8AP 2OTJL 2QEXL 2OTJO 1NJIM 3CCLO 3I55L 1W2BN 1M90M 1K9MM 1S72O 1Q82P 1VQ5O 1VQKL
chains in the Genus database with same CATH superfamily
1Q86P 1K73P 1M1KP 1YI2O 1VQKO 1YITL 3OW2N 1KD1M 1N8RM 5DQZA 1YITO 3CCUO 1VQ9L 1VQLL 3CMEO 3CPWN 1VQ9O 3CC2L 1KC8M 1VQLO 3CD6L 1VQOL 5DLJA 1YIJL 1Q7YP 3OW2K 3CC2O 3CCLL 1QVGN 3CD6O 1VQOO 4N06A 1K8AM 1YIJO 3CC7L 3CCQL 1KQSN 1JJ2N 1S72L 1VQ5L 3CC7O 3CCQO 4XTKA 3CXCK 3CC4L 5DS6A 1VQPL 1YI2L 1VQ8L 1QVGK 4W8KA 1VQ7L 1Q81P 3CC4O 1VQPO 1Q86M 1VQ8O 3CCUL 5DS5A 1K73M 1M1KM 1VQ7O 1JJ2K 1VQ6L 3CMEL 1W2BK 3CCEL 1VQ6O 3GODA 3CCEO 3NKDA 1VQNL 1M90P 1K9MP 3CCJO 4QDLA 1YHQO 1VQNO 1YJNL 3I56O 3G71O 3CPWK 1YJ9L 1QVFN 1YJNO 1KD1P 4WJ0A 1YJ9O 5DS4A 1VQ4O 3CMAL 4P6IC 1Q82M 3CMAO 1KQSK 3CCRO 2QA4L 3G4SL 3CCML 3CCSO 1VQML 2QA4O 1NJIP 3G4SO 2OTLL 3CCMO 1VQMO 3CCJL 1YHQL 1YJWL 2OTLO 2QEXO 3G6EL 5DQTA 3I56L 3G71L 1YJWO 3I55O 3G6EO 1Q7YM 1VQ4L 1N8RP 3CCRL 1KC8P 3CCVL 3CCSL 1QVFK 1Q81M 3CXCN 3CCVO 1K8AP 2OTJL 2QEXL 2OTJO 1NJIM 3CCLO 2YZSA 3I55L 1W2BN 1M90M 1K9MM 1S72O 1Q82P 1VQ5O 5FCLA 1VQKL
chains in the Genus database with same CATH topology
1Q86P 1K73P 1M1KP 1YI2O 1VQKO 1YITL 3OW2N 1KD1M 1N8RM 5DQZA 1YITO 3CCUO 1VQ9L 1VQLL 3CMEO 3CPWN 1VQ9O 3CC2L 1KC8M 1VQLO 3CD6L 1VQOL 5DLJA 1YIJL 1Q7YP 3OW2K 3CC2O 3CCLL 1QVGN 3CD6O 1VQOO 4N06A 1K8AM 1YIJO 3CC7L 3CCQL 1KQSN 1JJ2N 1S72L 1VQ5L 3CC7O 3CCQO 4XTKA 3CXCK 3CC4L 5DS6A 1VQPL 1YI2L 1VQ8L 1QVGK 4W8KA 1VQ7L 1Q81P 3CC4O 1VQPO 1Q86M 1VQ8O 3CCUL 5DS5A 1K73M 1M1KM 1VQ7O 1JJ2K 1VQ6L 3CMEL 1W2BK 3CCEL 1VQ6O 3GODA 3CCEO 3NKDA 1VQNL 1M90P 1K9MP 3CCJO 4QDLA 1YHQO 1VQNO 1YJNL 3I56O 3G71O 3CPWK 1YJ9L 1QVFN 1YJNO 1KD1P 4WJ0A 1YJ9O 5DS4A 1VQ4O 3CMAL 4P6IC 1Q82M 3CMAO 1KQSK 3CCRO 2QA4L 3G4SL 3CCML 3CCSO 1VQML 2QA4O 1NJIP 3G4SO 2OTLL 3CCMO 1VQMO 3CCJL 1YHQL 1YJWL 2OTLO 2QEXO 3G6EL 5DQTA 3I56L 3G71L 1YJWO 3I55O 3G6EO 1Q7YM 1VQ4L 1N8RP 3CCRL 1KC8P 3CCVL 3CCSL 1QVFK 1Q81M 3CXCN 3CCVO 1K8AP 2OTJL 2QEXL 2OTJO 1NJIM 3CCLO 2YZSA 3I55L 1W2BN 1M90M 1K9MM 1S72O 1Q82P 1VQ5O 5FCLA 1VQKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 P;  1K73 P;  1M1K P;  1YI2 O;  1VQK O;  1YIT L;  3OW2 N;  1KD1 M;  1N8R M;  1YIT O;  3CCU O;  1VQ9 L;  1VQL L;  3CME O;  3CPW N;  1VQ9 O;  3CC2 L;  1KC8 M;  1VQL O;  3CD6 L;  1VQO L;  1YIJ L;  1Q7Y P;  3OW2 K;  3CC2 O;  3CCL L;  1QVG N;  3CD6 O;  1VQO O;  1K8A M;  1YIJ O;  3CC7 L;  3CCQ L;  1KQS N;  1JJ2 N;  1S72 L;  1VQ5 L;  3CC7 O;  3CCQ O;  3CXC K;  3CC4 L;  1VQP L;  1YI2 L;  1VQ8 L;  1QVG K;  1VQ7 L;  1Q81 P;  3CC4 O;  1VQP O;  1Q86 M;  1VQ8 O;  3CCU L;  1K73 M;  1M1K M;  1VQ7 O;  1JJ2 K;  1VQ6 L;  3CME L;  1W2B K;  3CCE L;  1VQ6 O;  3CCE O;  1VQN L;  1M90 P;  1K9M P;  3CCJ O;  1YHQ O;  1VQN O;  1YJN L;  3I56 O;  3G71 O;  3CPW K;  1YJ9 L;  1QVF N;  1YJN O;  1KD1 P;  1YJ9 O;  1VQ4 O;  3CMA L;  1Q82 M;  3CMA O;  1KQS K;  3CCR O;  2QA4 L;  3G4S L;  3CCM L;  3CCS O;  1VQM L;  2QA4 O;  1NJI P;  3G4S O;  2OTL L;  3CCM O;  1VQM O;  3CCJ L;  1YHQ L;  1YJW L;  2OTL O;  2QEX O;  3G6E L;  3I56 L;  3G71 L;  1YJW O;  3I55 O;  3G6E O;  1Q7Y M;  1VQ4 L;  1N8R P;  3CCR L;  1KC8 P;  3CCV L;  3CCS L;  1QVF K;  1Q81 M;  3CXC N;  3CCV O;  1K8A P;  2OTJ L;  2QEX L;  2OTJ O;  1NJI M;  3CCL O;  3I55 L;  1W2B N;  1M90 M;  1K9M M;  1S72 O;  1Q82 P;  1VQ5 O;  1VQK L; 
#chains in the Genus database with same CATH topology
 1Q86 P;  1K73 P;  1M1K P;  1YI2 O;  1VQK O;  1YIT L;  3OW2 N;  1KD1 M;  1N8R M;  5DQZ A;  1YIT O;  3CCU O;  1VQ9 L;  1VQL L;  3CME O;  3CPW N;  1VQ9 O;  3CC2 L;  1KC8 M;  1VQL O;  3CD6 L;  1VQO L;  5DLJ A;  1YIJ L;  1Q7Y P;  3OW2 K;  3CC2 O;  3CCL L;  1QVG N;  3CD6 O;  1VQO O;  4N06 A;  1K8A M;  1YIJ O;  3CC7 L;  3CCQ L;  1KQS N;  1JJ2 N;  1S72 L;  1VQ5 L;  3CC7 O;  3CCQ O;  4XTK A;  3CXC K;  3CC4 L;  5DS6 A;  1VQP L;  1YI2 L;  1VQ8 L;  1QVG K;  4W8K A;  1VQ7 L;  1Q81 P;  3CC4 O;  1VQP O;  1Q86 M;  1VQ8 O;  3CCU L;  5DS5 A;  1K73 M;  1M1K M;  1VQ7 O;  1JJ2 K;  1VQ6 L;  3CME L;  1W2B K;  3CCE L;  1VQ6 O;  3GOD A;  3CCE O;  3NKD A;  1VQN L;  1M90 P;  1K9M P;  3CCJ O;  4QDL A;  1YHQ O;  1VQN O;  1YJN L;  3I56 O;  3G71 O;  3CPW K;  1YJ9 L;  1QVF N;  1YJN O;  1KD1 P;  4WJ0 A;  1YJ9 O;  5DS4 A;  1VQ4 O;  3CMA L;  4P6I C;  1Q82 M;  3CMA O;  1KQS K;  3CCR O;  2QA4 L;  3G4S L;  3CCM L;  3CCS O;  1VQM L;  2QA4 O;  1NJI P;  3G4S O;  2OTL L;  3CCM O;  1VQM O;  3CCJ L;  1YHQ L;  1YJW L;  2OTL O;  2QEX O;  3G6E L;  5DQT A;  3I56 L;  3G71 L;  1YJW O;  3I55 O;  3G6E O;  1Q7Y M;  1VQ4 L;  1N8R P;  3CCR L;  1KC8 P;  3CCV L;  3CCS L;  1QVF K;  1Q81 M;  3CXC N;  3CCV O;  1K8A P;  2OTJ L;  2QEX L;  2OTJ O;  1NJI M;  3CCL O;  2YZS A;  3I55 L;  1W2B N;  1M90 M;  1K9M M;  1S72 O;  1Q82 P;  1VQ5 O;  5FCL A;  1VQK L; 
#chains in the Genus database with same CATH homology
 1Q86 P;  1K73 P;  1M1K P;  1YI2 O;  1VQK O;  1YIT L;  3OW2 N;  1KD1 M;  1N8R M;  5DQZ A;  1YIT O;  3CCU O;  1VQ9 L;  1VQL L;  3CME O;  3CPW N;  1VQ9 O;  3CC2 L;  1KC8 M;  1VQL O;  3CD6 L;  1VQO L;  5DLJ A;  1YIJ L;  1Q7Y P;  3OW2 K;  3CC2 O;  3CCL L;  1QVG N;  3CD6 O;  1VQO O;  4N06 A;  1K8A M;  1YIJ O;  3CC7 L;  3CCQ L;  1KQS N;  1JJ2 N;  1S72 L;  1VQ5 L;  3CC7 O;  3CCQ O;  4XTK A;  3CXC K;  3CC4 L;  5DS6 A;  1VQP L;  1YI2 L;  1VQ8 L;  1QVG K;  4W8K A;  1VQ7 L;  1Q81 P;  3CC4 O;  1VQP O;  1Q86 M;  1VQ8 O;  3CCU L;  5DS5 A;  1K73 M;  1M1K M;  1VQ7 O;  1JJ2 K;  1VQ6 L;  3CME L;  1W2B K;  3CCE L;  1VQ6 O;  3GOD A;  3CCE O;  3NKD A;  1VQN L;  1M90 P;  1K9M P;  3CCJ O;  4QDL A;  1YHQ O;  1VQN O;  1YJN L;  3I56 O;  3G71 O;  3CPW K;  1YJ9 L;  1QVF N;  1YJN O;  1KD1 P;  4WJ0 A;  1YJ9 O;  5DS4 A;  1VQ4 O;  3CMA L;  4P6I C;  1Q82 M;  3CMA O;  1KQS K;  3CCR O;  2QA4 L;  3G4S L;  3CCM L;  3CCS O;  1VQM L;  2QA4 O;  1NJI P;  3G4S O;  2OTL L;  3CCM O;  1VQM O;  3CCJ L;  1YHQ L;  1YJW L;  2OTL O;  2QEX O;  3G6E L;  5DQT A;  3I56 L;  3G71 L;  1YJW O;  3I55 O;  3G6E O;  1Q7Y M;  1VQ4 L;  1N8R P;  3CCR L;  1KC8 P;  3CCV L;  3CCS L;  1QVF K;  1Q81 M;  3CXC N;  3CCV O;  1K8A P;  2OTJ L;  2QEX L;  2OTJ O;  1NJI M;  3CCL O;  2YZS A;  3I55 L;  1W2B N;  1M90 M;  1K9M M;  1S72 O;  1Q82 P;  1VQ5 O;  5FCL A;  1VQK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...