2R93F

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
88
structure length
88
Chain Sequence
TLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 23
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 2r93F00
1IW7E 3EQLE 1I6VE 3K7AF 2NVYF 2BE5E 3DXJE 1TWGF 1I6HF 4LK1E 4XLNE 4A3GF 3S17F 2JA5F 3GTKF 2E2HF 4OINE 2JA6F 5BYHE 4OIQE 4GZYE 1TWFF 3S1MF 5IYDF 4G7OE 3GTQF 5M5YF 2NVXF 3GTMF 5M3FF 2WB1I 4YFKE 4XSXE 4Y7NF 3HOWF 2PPBE 3M4OF 3GTLF 3CQZF 5FLMF 3GTOF 4MEXE 2WAQK 5M3MF 4YFNE 5C3EF 4BXXF 3HOYF 2NVTF 3S14F 2JA7F 3H0GF 5IYBF 1TWHF 3HOZF 2O5JE 4A3JF 2R7ZF 4KMUE 3S16F 4BBSF 2NVQF 4BY1F 4A3IF 3HOUF 1TWAF 2E2JF 2JA8F 5E17E 1Y1VF 4A3FF 3GTGF 2Y0SI 5M5WF 5C44F 1K83F 4Y52F 4G7ZE 4LK0E 2YU9F 3H3VG 3I4NF 4Q5SE 4MQ9E 4OIPE 5IYCF 4OIRE 4A3MF 3WODE 2A68E 3S2DF 4A3KF 2B63F 3FKIF 3GTPF 4YFXE 4Q4ZE 4JK1E 5M5XF 3S1RF 3S1QF 1TWCF 4YG2E 4C3JF 3HOXF 4OIOE 4C3IF 2O5IE 1YNNK 4A3CF 1QKLA 2R92F 2A69E 5TMCE 4XSZE 5IP9F 2VUMF 1I50F 1HQME 4KN4E 3PO3F 2A6EE 5E18E 4A3BF 3I4MF 3PO2F 4A3EF 2E2IF 4MEYE 5C4JF 5FJ8F 3RZDF 3HKZK 4G7HE 1SMYE 2A6HE 4KN7E 3S15F 2CW0E 3S2HF 2PMZK 1WCMF 4A93F 4BY7F 4C3HF 1SFOF 3HOVF 1ZYRE 4BBRF 5TMFE 4A3LF 4C2MF 5D4EE 3RZOF 1YNJK 1I3QF 3M3YF 5D4DE 2R93F 1Y1WF 4AYBK 3GTJF 5D4CE 4LLGE 5C4XF 4XLPE 4A3DF 5IPLE 4X6AF 3S1NF 4ZH4E 1R9TF 5IP7F 4LJZE
chains in the Genus database with same CATH superfamily
1IW7E 2NVYE 3EQLE 5C3EE 1I6VE 3K7AE 3K7AF 2NVYF 2E2IE 4A3EE 2YU9E 2BE5E 3I4ME 3DXJE 1TWGF 1I6HF 4LK1E 4XLNE 3GTGE 3S17F 2JA5F 3GTKF 4A3DE 2E2HF 4A3GF 3GTJE 2R92E 4OINE 1Y1WE 2JA6F 5BYHE 2Y0SH 4OIQE 4GZYE 1TWFF 3S1MF 5IYDF 4BBRE 3GTQE 4G7OE 3HOVE 5IYDE 3GTQF 1SFOE 5M5YF 2NVXF 3GTMF 3HOZE 1TWHE 5M3FF 4BY7E 2WB1I 4YFKE 3S15E 4BXXE 4A3ME 4QIWK 4XSXE 2E2HE 4QIWH 4Y7NF 3HOWF 2PPBE 3M4OF 5IYCE 3GTLF 3CQZF 5FLMF 5C4JE 3GTOF 3GTOE 1EIKA 4MEXE 2WAQK 5M3MF 5FLME 3H3VF 3PO2E 4YFNE 1I50E 2VUME 5C3EF 1K83E 3I4NE 4BXXF 3S1NE 4X6AE 4C3IE 2NVTF 3S14F 2JA7F 3HOYF 3H0GF 5IYBF 1Y1VE 1TWHF 4A3FE 3HOZF 2O5JE 5M5YE 1TWCE 4A3JF 2NVXE 3S1QE 2R93E 1TWAE 2R7ZF 4KMUE 3S16F 2NVQE 3HOUE 4BBSF 2NVQF 4BY1F 4A3IF 3FKIE 1TWAF 3HOUF 2E2JF 4A3KE 2B63E 3S2DE 2JA8F 4A3LF 5E17E 3GTKE 2JA5E 1Y1VF 5IYBE 4A3FF 3GTGF 3H0GE 2Y0SI 2JA7E 5M5WF 5C44F 1K83F 4Y52F 4G7ZE 4LK0E 2YU9F 3H3VG 3I4NF 4Q5SE 5FJ8E 4MQ9E 3RZDE 2WB1H 4Y52E 4A3BE 1R9TE 4OIPE 3PO3E 5IYCF 3GTLE 4OIRE 5IP9E 3HOWE 3M4OE 4A3MF 3WODE 4A3CE 2A68E 3S2DF 4A3KF 2E2JE 3HOXE 2B63F 3FKIF 3GTPF 4YFXE 5M3FE 4C2ME 3GTME 4Q4ZE 4JK1E 5M5XF 2R7ZE 4A3LE 4BBSE 3S1RF 3S1RE 3S1QF 3S1ME 1TWCF 4A3JE 4A93E 1WCME 1TWFE 4YG2E 4C3JF 3GTPE 3HOXF 4OIOE 4C3IF 2NVTE 2O5IE 3HOYE 1YNNK 4A3CF 1QKLA 2R92F 2A69E 5TMCE 3S17E 4XSZE 5IP9F 2VUMF 1I6HE 1I50F 1HQME 4KN4E 3PO3F 2A6EE 5E18E 4A3BF 1DZFA 5M3ME 3I4MF 4A3EF 3PO2F 2E2IF 3CQZE 4MEYE 5C4JF 2WAQH 5FJ8F 3RZDF 3HKZK 4G7HE 4Y7NE 5IP7E 1SMYE 2A6HE 4KN7E 5C44E 2PMZH 2CW0E 5M5WE 3S15F 3S2HF 2PMZK 4C3JE 5C4XE 1WCMF 4A93F 4BY7F 4C3HF 1SFOF 2JA8E 3HKZH 3HOVF 1ZYRE 4BBRF 5TMFE 5M5XE 4A3IE 1I3QE 4C2MF 5D4EE 4BY1E 3M3YE 3RZOE 1YNJK 1I3QF 3M3YF 3S16E 3RZOF 5D4DE 2R93F 1Y1WF 2JA6E 4C3HE 4AYBK 3GTJF 5D4CE 4LLGE 4AYBH 4XLPE 4A3DF 4A3GE 5C4XF 5IPLE 3S2HE 3S14E 1TWGE 4X6AF 3S1NF 4ZH4E 1R9TF 2KRXA 5IP7F 4LJZE
chains in the Genus database with same CATH topology
1IW7E 3EQLE 1I6VE 3K7AF 2NVYF 2BE5E 3DXJE 1TWGF 1I6HF 4LK1E 4XLNE 4A3GF 3S17F 2JA5F 3GTKF 2E2HF 4OINE 2JA6F 5BYHE 4OIQE 4GZYE 1TWFF 3S1MF 5IYDF 4G7OE 3GTQF 5M5YF 2NVXF 3GTMF 5M3FF 2WB1I 4YFKE 4QIWK 4XSXE 4Y7NF 3HOWF 2PPBE 3M4OF 3GTLF 3CQZF 5FLMF 3GTOF 4MEXE 2WAQK 5M3MF 4YFNE 5C3EF 4BXXF 3HOYF 2NVTF 3S14F 2JA7F 3H0GF 5IYBF 1TWHF 3HOZF 2O5JE 4A3JF 2R7ZF 4KMUE 3S16F 4BBSF 2NVQF 4BY1F 4A3IF 3HOUF 1TWAF 2E2JF 2JA8F 5E17E 1Y1VF 4A3FF 3GTGF 2Y0SI 5M5WF 5C44F 1K83F 4Y52F 4G7ZE 4LK0E 2YU9F 3H3VG 3I4NF 4Q5SE 4MQ9E 4OIPE 5IYCF 4OIRE 4A3MF 3WODE 2A68E 3S2DF 4A3KF 2B63F 3FKIF 3GTPF 4YFXE 4Q4ZE 4JK1E 5M5XF 3S1RF 3S1QF 1TWCF 4YG2E 4C3JF 3HOXF 4OIOE 4C3IF 2O5IE 1YNNK 4A3CF 1QKLA 2R92F 2A69E 5TMCE 4XSZE 5IP9F 2VUMF 1I50F 1HQME 4KN4E 3PO3F 2A6EE 5E18E 4A3BF 3I4MF 3PO2F 4A3EF 2E2IF 4MEYE 5C4JF 5FJ8F 3RZDF 3HKZK 4G7HE 1SMYE 2A6HE 4KN7E 3S15F 2CW0E 3S2HF 2PMZK 1WCMF 4A93F 4BY7F 4C3HF 1SFOF 3HOVF 1ZYRE 4BBRF 5TMFE 4A3LF 4C2MF 5D4EE 3RZOF 1YNJK 1I3QF 3M3YF 5D4DE 2R93F 1Y1WF 4AYBK 3GTJF 5D4CE 4LLGE 5C4XF 4XLPE 4A3DF 5IPLE 4X6AF 3S1NF 4ZH4E 1R9TF 2KRXA 5IP7F 4LJZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 E;  3EQL E;  1I6V E;  3K7A F;  2NVY F;  2BE5 E;  3DXJ E;  1TWG F;  1I6H F;  4LK1 E;  4XLN E;  4A3G F;  3S17 F;  2JA5 F;  3GTK F;  2E2H F;  4OIN E;  2JA6 F;  5BYH E;  4OIQ E;  4GZY E;  1TWF F;  3S1M F;  5IYD F;  4G7O E;  3GTQ F;  5M5Y F;  2NVX F;  3GTM F;  5M3F F;  2WB1 I;  4YFK E;  4XSX E;  4Y7N F;  3HOW F;  2PPB E;  3M4O F;  3GTL F;  3CQZ F;  5FLM F;  3GTO F;  4MEX E;  2WAQ K;  5M3M F;  4YFN E;  5C3E F;  4BXX F;  3HOY F;  2NVT F;  3S14 F;  2JA7 F;  3H0G F;  5IYB F;  1TWH F;  3HOZ F;  2O5J E;  4A3J F;  2R7Z F;  4KMU E;  3S16 F;  4BBS F;  2NVQ F;  4BY1 F;  4A3I F;  3HOU F;  1TWA F;  2E2J F;  2JA8 F;  5E17 E;  1Y1V F;  4A3F F;  3GTG F;  2Y0S I;  5M5W F;  5C44 F;  1K83 F;  4Y52 F;  4G7Z E;  4LK0 E;  2YU9 F;  3H3V G;  3I4N F;  4Q5S E;  4MQ9 E;  4OIP E;  5IYC F;  4OIR E;  4A3M F;  3WOD E;  2A68 E;  3S2D F;  4A3K F;  2B63 F;  3FKI F;  3GTP F;  4YFX E;  4Q4Z E;  4JK1 E;  5M5X F;  3S1R F;  3S1Q F;  1TWC F;  4YG2 E;  4C3J F;  3HOX F;  4OIO E;  4C3I F;  2O5I E;  1YNN K;  4A3C F;  1QKL A;  2R92 F;  2A69 E;  5TMC E;  4XSZ E;  5IP9 F;  2VUM F;  1I50 F;  1HQM E;  4KN4 E;  3PO3 F;  2A6E E;  5E18 E;  4A3B F;  3I4M F;  3PO2 F;  4A3E F;  2E2I F;  4MEY E;  5C4J F;  5FJ8 F;  3RZD F;  3HKZ K;  4G7H E;  1SMY E;  2A6H E;  4KN7 E;  3S15 F;  2CW0 E;  3S2H F;  2PMZ K;  1WCM F;  4A93 F;  4BY7 F;  4C3H F;  1SFO F;  3HOV F;  1ZYR E;  4BBR F;  5TMF E;  4A3L F;  4C2M F;  5D4E E;  3RZO F;  1YNJ K;  1I3Q F;  3M3Y F;  5D4D E;  2R93 F;  1Y1W F;  4AYB K;  3GTJ F;  5D4C E;  4LLG E;  5C4X F;  4XLP E;  4A3D F;  5IPL E;  4X6A F;  3S1N F;  4ZH4 E;  1R9T F;  5IP7 F;  4LJZ E; 
#chains in the Genus database with same CATH topology
 1IW7 E;  2NVY E;  3EQL E;  5C3E E;  1I6V E;  3K7A E;  3K7A F;  2NVY F;  2E2I E;  4A3E E;  2YU9 E;  2BE5 E;  3I4M E;  3DXJ E;  1TWG F;  1I6H F;  4LK1 E;  4XLN E;  3GTG E;  3S17 F;  2JA5 F;  3GTK F;  4A3D E;  2E2H F;  4A3G F;  3GTJ E;  2R92 E;  4OIN E;  1Y1W E;  2JA6 F;  5BYH E;  2Y0S H;  4OIQ E;  4GZY E;  1TWF F;  3S1M F;  5IYD F;  4BBR E;  3GTQ E;  4G7O E;  3HOV E;  5IYD E;  3GTQ F;  1SFO E;  5M5Y F;  2NVX F;  3GTM F;  3HOZ E;  1TWH E;  5M3F F;  4BY7 E;  2WB1 I;  4YFK E;  3S15 E;  4BXX E;  4A3M E;  4QIW K;  4XSX E;  2E2H E;  4QIW H;  4Y7N F;  3HOW F;  2PPB E;  3M4O F;  5IYC E;  3GTL F;  3CQZ F;  5FLM F;  5C4J E;  3GTO F;  3GTO E;  1EIK A;  4MEX E;  2WAQ K;  5M3M F;  5FLM E;  3H3V F;  3PO2 E;  4YFN E;  1I50 E;  2VUM E;  5C3E F;  1K83 E;  3I4N E;  4BXX F;  3S1N E;  4X6A E;  4C3I E;  2NVT F;  3S14 F;  2JA7 F;  3HOY F;  3H0G F;  5IYB F;  1Y1V E;  1TWH F;  4A3F E;  3HOZ F;  2O5J E;  5M5Y E;  1TWC E;  4A3J F;  2NVX E;  3S1Q E;  2R93 E;  1TWA E;  2R7Z F;  4KMU E;  3S16 F;  2NVQ E;  3HOU E;  4BBS F;  2NVQ F;  4BY1 F;  4A3I F;  3FKI E;  1TWA F;  3HOU F;  2E2J F;  4A3K E;  2B63 E;  3S2D E;  2JA8 F;  4A3L F;  5E17 E;  3GTK E;  2JA5 E;  1Y1V F;  5IYB E;  4A3F F;  3GTG F;  3H0G E;  2Y0S I;  2JA7 E;  5M5W F;  5C44 F;  1K83 F;  4Y52 F;  4G7Z E;  4LK0 E;  2YU9 F;  3H3V G;  3I4N F;  4Q5S E;  5FJ8 E;  4MQ9 E;  3RZD E;  2WB1 H;  4Y52 E;  4A3B E;  1R9T E;  4OIP E;  3PO3 E;  5IYC F;  3GTL E;  4OIR E;  5IP9 E;  3HOW E;  3M4O E;  4A3M F;  3WOD E;  4A3C E;  2A68 E;  3S2D F;  4A3K F;  2E2J E;  3HOX E;  2B63 F;  3FKI F;  3GTP F;  4YFX E;  5M3F E;  4C2M E;  3GTM E;  4Q4Z E;  4JK1 E;  5M5X F;  2R7Z E;  4A3L E;  4BBS E;  3S1R F;  3S1R E;  3S1Q F;  3S1M E;  1TWC F;  4A3J E;  4A93 E;  1WCM E;  1TWF E;  4YG2 E;  4C3J F;  3GTP E;  3HOX F;  4OIO E;  4C3I F;  2NVT E;  2O5I E;  3HOY E;  1YNN K;  4A3C F;  1QKL A;  2R92 F;  2A69 E;  5TMC E;  3S17 E;  4XSZ E;  5IP9 F;  2VUM F;  1I6H E;  1I50 F;  1HQM E;  4KN4 E;  3PO3 F;  2A6E E;  5E18 E;  4A3B F;  1DZF A;  5M3M E;  3I4M F;  4A3E F;  3PO2 F;  2E2I F;  3CQZ E;  4MEY E;  5C4J F;  2WAQ H;  5FJ8 F;  3RZD F;  3HKZ K;  4G7H E;  4Y7N E;  5IP7 E;  1SMY E;  2A6H E;  4KN7 E;  5C44 E;  2PMZ H;  2CW0 E;  5M5W E;  3S15 F;  3S2H F;  2PMZ K;  4C3J E;  5C4X E;  1WCM F;  4A93 F;  4BY7 F;  4C3H F;  1SFO F;  2JA8 E;  3HKZ H;  3HOV F;  1ZYR E;  4BBR F;  5TMF E;  5M5X E;  4A3I E;  1I3Q E;  4C2M F;  5D4E E;  4BY1 E;  3M3Y E;  3RZO E;  1YNJ K;  1I3Q F;  3M3Y F;  3S16 E;  3RZO F;  5D4D E;  2R93 F;  1Y1W F;  2JA6 E;  4C3H E;  4AYB K;  3GTJ F;  5D4C E;  4LLG E;  4AYB H;  4XLP E;  4A3D F;  4A3G E;  5C4X F;  5IPL E;  3S2H E;  3S14 E;  1TWG E;  4X6A F;  3S1N F;  4ZH4 E;  1R9T F;  2KRX A;  5IP7 F;  4LJZ E; 
#chains in the Genus database with same CATH homology
 1IW7 E;  3EQL E;  1I6V E;  3K7A F;  2NVY F;  2BE5 E;  3DXJ E;  1TWG F;  1I6H F;  4LK1 E;  4XLN E;  4A3G F;  3S17 F;  2JA5 F;  3GTK F;  2E2H F;  4OIN E;  2JA6 F;  5BYH E;  4OIQ E;  4GZY E;  1TWF F;  3S1M F;  5IYD F;  4G7O E;  3GTQ F;  5M5Y F;  2NVX F;  3GTM F;  5M3F F;  2WB1 I;  4YFK E;  4QIW K;  4XSX E;  4Y7N F;  3HOW F;  2PPB E;  3M4O F;  3GTL F;  3CQZ F;  5FLM F;  3GTO F;  4MEX E;  2WAQ K;  5M3M F;  4YFN E;  5C3E F;  4BXX F;  3HOY F;  2NVT F;  3S14 F;  2JA7 F;  3H0G F;  5IYB F;  1TWH F;  3HOZ F;  2O5J E;  4A3J F;  2R7Z F;  4KMU E;  3S16 F;  4BBS F;  2NVQ F;  4BY1 F;  4A3I F;  3HOU F;  1TWA F;  2E2J F;  2JA8 F;  5E17 E;  1Y1V F;  4A3F F;  3GTG F;  2Y0S I;  5M5W F;  5C44 F;  1K83 F;  4Y52 F;  4G7Z E;  4LK0 E;  2YU9 F;  3H3V G;  3I4N F;  4Q5S E;  4MQ9 E;  4OIP E;  5IYC F;  4OIR E;  4A3M F;  3WOD E;  2A68 E;  3S2D F;  4A3K F;  2B63 F;  3FKI F;  3GTP F;  4YFX E;  4Q4Z E;  4JK1 E;  5M5X F;  3S1R F;  3S1Q F;  1TWC F;  4YG2 E;  4C3J F;  3HOX F;  4OIO E;  4C3I F;  2O5I E;  1YNN K;  4A3C F;  1QKL A;  2R92 F;  2A69 E;  5TMC E;  4XSZ E;  5IP9 F;  2VUM F;  1I50 F;  1HQM E;  4KN4 E;  3PO3 F;  2A6E E;  5E18 E;  4A3B F;  3I4M F;  3PO2 F;  4A3E F;  2E2I F;  4MEY E;  5C4J F;  5FJ8 F;  3RZD F;  3HKZ K;  4G7H E;  1SMY E;  2A6H E;  4KN7 E;  3S15 F;  2CW0 E;  3S2H F;  2PMZ K;  1WCM F;  4A93 F;  4BY7 F;  4C3H F;  1SFO F;  3HOV F;  1ZYR E;  4BBR F;  5TMF E;  4A3L F;  4C2M F;  5D4E E;  3RZO F;  1YNJ K;  1I3Q F;  3M3Y F;  5D4D E;  2R93 F;  1Y1W F;  4AYB K;  3GTJ F;  5D4C E;  4LLG E;  5C4X F;  4XLP E;  4A3D F;  5IPL E;  4X6A F;  3S1N F;  4ZH4 E;  1R9T F;  2KRX A;  5IP7 F;  4LJZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...