2TBSA

Cold-adaption of enzymes: structural comparison between salmon and bovine trypsins
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
222
structure length
222
Chain Sequence
b'IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSDKLQCLNIPILSYSDCNDSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFSDWLTSTMASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Cold adaption of enzymes: structural comparison between salmon and bovine trypsins.
pubmed doi rcsb
source organism Salmo salar
molecule tags Hydrolase(serine proteinase)
total genus 51
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tbsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tbsA02
2OINA 1MZDA 5EW2H 3A87A 4CHAB 1BUIA 4BAQB 2VWLA 4I31A 3UREA 3ZVEA 1IHTH 1KXDA 3RU4T 2FYQA 4X6NA 3SNCA 1SR5C 6ESTA 3A88A 4B75A 1AVGH 4B2AA 1M9UA 1IQLA 3SW2B 1L1JA 5GCHF 1GI1A 3SN8A 3MHWU 7LPRA 2QF3A 1FPCH 4X2YA 1K21H 2V3HH 3SJOA 1L1NA 1DITH 2ZDAH 3QDZB 3U98H 2BDCA 1EZQA 2RDLA 1KDQA 4GAWA 2H9TH 1BIOA 1CA0C 1WOFA 1QCPA 4BTUB 1S81A 4ABJA 3HKIB 3QWCH 4CH2B 4X6PA 3EE0B 3MOCA 2FODA 1LMWB 3A7VA 2Z3CA 1SGRE 4U32A 4FUHA 3F1SB 1RTFB 1MKXK 1D3QB 3GYMA 1ESBA 2G51A 1DWDH 5TCCA 3NKKA 4DT7B 1EJMA 4Y6DA 3BTGE 4AFQA 4HI3A 1G37A 1S6FA 1SQTA 3SI3H 1IQGA 3A81A 4ABAA 3QZQA 3DA9B 1DE7H 3SV2H 4HFPB 2ZTYA 3LGUA 3MH5A 1IOEA 1QQ4A 1PQ7A 1XXFA 2BTCE 3C1KA 3DT0H 2V3OH 2WYGA 1DS2E 2PV9B 1TNIA 1MBQA 3ODDA 1MQ5A 1O30A 2GMTC 4AYVB 4LOYH 2W7SA 3ZVAA 1IHSH 2SGPE 3A82A 2D26C 1C2EA 1SGNE 2QF0A 3UOUA 3MNSA 4OS2A 3OY5U 2FI3E 4O3TA 2GCHG 2VIWA 3A84A 1K9OE 3HGNA 2FOHA 3OTJE 4YZUA 2OUAA 5A0AE 1O3HA 4WF8A 1ZGVA 3GY2A 3MO3A 1HJ8A 1WBGB 2C8YB 1BTZA 1SMFE 2FESH 3GDVA 3PYHA 4AGKA 2HLCA 2ULLA 1THPB 4DJZB 1AHTH 2H5DA 1EZXC 4AORA 4AOQA 4NGAH 1G32B 1GHVH 1PPHE 1HAVB 4VGCC 1F92A 1XKAC 1EKBB 1GMHF 1QURH 2PKAA 2D2DA 2ASUB 3U1JB 2FX6A 3A8DA 4K60A 1D3DB 4X1QU 1W2KH 1P8VC 4XBCA 1FY4A 4JK6A 1GI9B 2BZAA 3S69A 3M5LA 2H1UA 4DCDA 1O2MA 1O3CA 1ARBA 2THFB 5GXPA 1KXBA 1O3OA 3PWBA 4GVUA 3RU4D 1PPEE 3ATKA 2PWXA 1V2JT 3RXKA 2H9HA 2SFAA 5EXNA 1GL1A 2HGTH 1K1MA 1CA0B 1ZR0A 3BTFE 3SV8A 2WUCA 3PLKA 5L6NH 1ID5H 1SB1H 2BDHA 4FU9A 7KMEH 2GV6A 2BY5X 1RFNA 3TNSA 1GBMA 3T2NA 1XVOA 2AYWA 1T8NA 1UHBB 4IC6A 1Q2WA 2PUXB 2AMPA 1GMDG 1W12U 1KSNA 1U6QA 2A31A 4PROA 4BTIB 3GY3A 4IMQA 3RXGA 2WPLS 3MH4A 3M5NA 2FLRH 4X8UH 2P16A 1V2RT 4I32A 4I8HA 1UTQA 5LPEA 1OP8A 2FS9A 3SU5A 1WQVH 1NN6A 3RDZA 1S82A 3DHKH 3ZZDA 3A7WA 1O33A 1GHAF 5FX5A 1O34A 2B7DH 1V2TT 3RXAA 3U9AH 3VB6A 2Y80A 1K1NA 2BVSH 1XM1A 2TRMA 1F0SA 3RXDA 1JRSA 4JZIA 1W14U 1SGCA 4YO9A 1C4Y2 5JB9S 4BAKB 4JMYA 8GCHF 4A5TS 2QAAA 1AFQC 2Y81A 5T6DA 1ZPBA 3RXSA 3FFGA 2Q1JA 1MTUA 1O3FA 1YPKH 4UDWH 2ZFQH 3BN9A 1UVOA 4K1EA 5G4BA 1GJ8B 2NU4E 2VIPA 3TK6A 3UY9A 2SGAA 1C5RA 5HXFA 3QN7A 4VGCB 1P12E 1GI8B 4YT7H 2AERH 1ZOMA 1IQMA 1BBRK 5HMAA 2O8WA 1RJXB 2A7CA 2WPMS 3VXFH 1QBNA 4K69A 3S9BA 4TPYA 2XBVA 4LK4A 2C8ZB 5C1YA 3STJA 2VWNA 2VVUA 1C5YB 2ZECA 1O5DH 2AIQA 1L4DA 1NY22 2F9BH 1O35A 1L0ZA 1QB6A 1O39A 2GV7A 3ATLA 2ZFRH 2A0QB 3VEQB 3S9CA 1TA2A 2HWLB 2XWBI 1NPMA 4INHA 2G00A 5E2OA 1HAVA 1VCPA 4MNWA 2LNCA 1EJAA 2ZFFH 1NRNH 1CHOG 1C4U2 1GI4A 4X8VH 3UIRA 1TFXA 3OSYA 2P94A 3RMMH 3O8BA 3V7TA 1P2NA 1EUFA 3AAVA 1C5WB 1ZHRA 1ZTLA 2G52A 3TNTA 2ODPA 5C2ZA 4CRAA 1A0LA 3SGQE 3MWIU 4BANB 1OWKA 2HNTC 4ZKRU 3CP7A 2XC4A 2ZPQA 5EU8A 1Z1JA 1C5OH 2BX4A 1UVPA 1CA8B 1ZGIA 4IC5A 1O3EA 1F2SE 3UOPA 1LVOA 1TNGA 3M61U 1YPHC 2IJOB 4HZHA 1O2IA 1L2EA 2BY8X 3H5CB 1MTVA 1H9IE 2XWAA 4X6MA 1HXEH 4Z0KA 4Q7ZA 1NZQH 1UHBA 1MD7A 7GCHF 1HB0B 3A8CA 1RD3B 1GHWH 1BTHH 4Q2KA 4AFZA 1OWIA 2I6QA 1HDTH 1BTYA 2P95A 3GCTF 1FJSA 2TIOA 3V0XA 2HOBA 4NIVA 3IG6B 4ZUHA 2BD5A 1C2IA 5DPAA 1S84A 2P93A 2WPJS 1LVMA 2CGAA 4BAMB 4JZ1A 1Y5AT 4NZQA 2GX4A 1W10U 1BTXA 3RXIA 4FVBA 5DJ7A 1HAIH 3M7TA 1YCPK 2JKHA 1FAKH 4D9RA 4Q80A 1N6XA 1EXFA 1YPJH 2ZU5A 1NFUA 1XVMA 2WUBA 4TWWA 3MMGA 2XRCA 5A2MH 4XOJA 1T8OA 4IGDA 1BRCE 1DT2A 2A5KA 2BD3A 5J4QA 1AZZA 4FXGH 4CBNA 3I29A 3M37A 5C5OA 2FMJA 1HRTH 1K1OA 3SHCH 3VFEA 1O3PB 3BEUA 1GL0E 1OXGA 2B5TB 4BTTB 2P3FH 5A0BA 2FOGA 1HXFH 2FZZA 4J1YA 2GCTC 1O3MA 1IQEA 5AFYH 2ZGBH 4X6OA 1CQQA 1MTSA 1UTMA 1YLCA 2GT8A 2C93B 3KIDU 3SU1A 1V2QT 3PTNA 2GP9B 4U01A 1DWEH 2OC0A 2ZQ1A 1FV9A 1QA7A 1O5FH 1QB1A 1ZMJA 2NWNA 4ISIH 1TA6A 2FI5E 3I77A 5DGJA 1ZJDA 1XUKA 1GHBF 2ZU4A 1SQAA 4NWLA 3HK6B 1SVPA 1P11E 1P0SH 3DUXH 1HIAB 1L4ZA 1LDTT 4I8LA 1VJAU 4FUBA 1YBWA 1INCA 1G9IE 1ETRH 4BAOB 2H5CA 1G36A 1YCPM 1ZZZA 4FUEA 2ZEBA 1QBVH 1TIOA 1L1GA 1TAWA 2ZZUH 4D7GA 1F5KU 2ANMH 1TQ0B 4ASHA 3F9FA 3SU0A 5A0CA 1HAPH 1KDQB 4DW2U 3GDSA 1KTSB 3P17H 5DG6A 1KLTA 1MAYA 1C4V2 3Q3KA 5DP9A 1GI3A 5DP8A 5C20A 4UFEH 2BX3A 1WSSH 1O5EH 1ELCA 1F7ZA 1GI7B 1JBUH 1Z8IB 3EAJA 1C1TA 2GGVB 1T4VH 4KTCA 1JIMA 2ZFTA 1J16A 5EPNA 2OCVB 1HFDA 4OS4A 3PM3A 1DVAH 4FVDA 2JH5D 1J17T 4Y8XA 4ABDA 2ZDLA 4GCHF 3GY4A 3GOVB 1V2PT 1QGFA 2DUCA 5A8ZA 4RSPA 4WWYA 4UD9H 2LPRA 2P8OC 1P10A 2FIRH 2J2UA 1YPMH 1TRMA 2AGGX 4A1XA 1C5UA 4O03A 2ZU1A 4H42U 4AX9H 1H4WA 2PFEA 1C1WH 1Z8JB 3F9GA 2K1QA 1IQIA 2W3KA 1QQUA 1T7CA 1JIRA 1P9UA 1AMHA 2J34A 5PTPA 1S85A 1P02A 1DUEA 1YYY1 2GD4B 3NK8A 3AW1A 3RXOA 2GCTB 2O8TA 2ZFSA 1MU6B 4Y71A 4ISLA 1EB2A 1V2ST 4AG2A 5JBTA 3KQBA 1DM4B 1FN8A 1GBKA 1SLVB 4JZDH 1DSUA 5CMXH 1DOJA 1AU8A 2P3UB 1LHCH 5DP5A 4Y7BA 3RXUA 1Y3VA 3BEFB 3RXQA 5LGOA 3PROA 3N7OA 2CF8H 1GVKB 2O8LA 1QL9A 4NA8A 4A1TA 3ZYDA 1WYKA 2TGAA 3STIA 1P2KA 3QGNB 4BXSA 4O9VA 1HCGA 1DX5M 2R3YA 3FVFB 4WMFA 1IQKA 4FUIA 1W7GH 1GBDA 1VZQH 3HK3B 3RXEA 2D8WA 4Y0ZE 3PO1C 3W94A 1C1UH 5DO4H 3D23A 1BCUH 1OKXA 4UONA 4MG3A 4NA7A 1LHFH 3BTTE 1SBWA 3NWUA 1V3XA 2ZPRA 3MNCA 1TPOA 1PQ5A 1FNIA 1TBZH 1PQ8A 4KP0A 3VGCC 2BDIA 1BRBE 1GDNA 1GJBB 1MD8A 3RXMA 1ELDE 4NWKA 3T26A 3HPTB 1LQEA 1OPHB 3IITA 3QLPH 1DXWA 1HIAA 3EA9A 1GCDA 1Y3UA 1LHEH 1NFWA 5E0HA 1LTOA 1O2UA 2W3IA 5GPIB 1GBTA 2EI6A 1ANCA 2OLGA 1TGNA 3BSQA 4YOJA 2PLXA 1Y5UT 1ELEE 3M7QA 5AF9H 2BMGB 3L6PA 1K1JA 1P2OA 3ZV9A 1C5MD 2A32A 3NZIA 2ZU3A 3RU4E 2SNVA 4CRGA 2FXRA 3KF2A 4MPXA 4IBLH 2ZCHP 4ZXXH 4GHTA 3AW0A 3U8TH 3EGKH 1GMCG 3U1IB 2B9LA 3TGKE 4MDSA 4K5ZA 3SNBA 1UK3A 2ZNKH 1C1VH 2P8OB 1UTOA 4Y10E 1MTNB 1KYNA 2FYRA 4WMEA 1W11U 1G30B 1K2I1 1WAYB 2SGDE 1SSXA 1GHZA 1BRAA 1K28D 4IMZA 3RM0H 1DSTA 2IOTA 2JH0D 1GJAB 1PPBH 4IN1A 4H6SB 2OXSA 5GCHG 4ISHH 4YLUA 1TLDA 4YT6H 1QRXA 1ELTA 2BQ7B 4Y0YE 3I78A 4X2XA 1C2DA 5L2YH 3VXEH 1CT4E 3UPEA 1SHHB 1CGIE 2G4TA 3TIUA 1G3EA 5K7RA 4ISOA 1HAHH 1IQFA 2GZ9A 4Y8ZA 4YTAA 2J9NA 4TY7A 3BTDE 1P09A 2JETC 2OBOA 1QL8A 1XUHA 3GY7A 1E34B 3B8JA 5F6MA 5IYTA 3ZVGA 4Y8YA 4BNRA 3D65E 4YOGA 1O0DH 4ZH8A 3UFAA 1GJ7B 3T28A 1TOMH 2C8XB 4X1RU 3A7YA 1TGTA 1ELGA 1V2MT 3PO1B 1C5ZB 1NRQH 8KME2 1HAZB 1C1SA 3RXVA 1BBRH 1O5AB 3BTHE 1VITH 3PMAB 5T6FA 1F5LA 2UWLA 1HAXB 1Z6JH 3GY6A 3VGCB 5C1XA 1DWBH 1Y5BT 4AGJA 2QA9E 1TNHA 6GCHF 3RXTA 3K6YA 1DY9A 2BLVA 1EPTC 2W26A 2AFQB 1LHGH 4WVPE 4CR5A 3P8GA 2Z9KA 1EP6A 1OSSA 2FX4A 2FTLE 1IQHA 2OC8A 3SO3A 2R2WU 4OS1A 4ABEA 4D7FA 1A5GH 2FI4E 3SGBE 1PYTD 2FM2A 2ZIQH 1TPSA 4KKDA 3LGIA 1P9SA 1EOLA 1ETTH 3MO9A 3TH4H 1C9TA 4I8KA 1FIZA 2ZCKP 1FXYA 4FUDA 3SU2A 2Q6GA 2C8WB 3SUDA 1GHYH 3TPIZ 1GI0A 3GICB 1O32A 5FCRA 2PKSC 2CMYA 2VJ1A 1FLEE 3F9HA 1QHRB 1A5IA 4AB9A 3SU6A 1P01A 2NU3E 3M5MA 3LJOA 3T62A 2ZDVH 9LPRA 4D76A 3ZV8A 9ESTA 3LH1A 4WXVA 1O2JA 1AO5A 5FHTA 2F83A 5CE1A 3E8LA 1W13U 1GJDB 2BLOA 4KTSA 1GMHG 5A8XA 1EOJA 4ABIA 1AFEH 1CU1A 2R3UA 4TYDA 4X1NU 4DG4A 1QFKH 3MU4A 5EQQA 1A5HA 1RS0A 4X1SU 4K2YA 4U30A 1TB6H 2XCNA 1TBRH 1Y3WA 2ZDKA 3ZVBA 4YESB 4JZEH 2FOMB 1D9IA 5F8XA 1C1QA 3RXLA 5DP4A 3LIWA 2F9NA 2R9PA 1TGSZ 2FOFA 1RGQA 2KAIA 5LH8A 1GJCB 4D9QA 2NU1E 1WU1A 3UWIA 2SGFE 1FY3A 3ZVDA 3BTEE 4SGBE 1VCQA 3KL6A 1DICA 1QJ7B 2FLBH 3BG4C 3SNAA 4CRDA 3KHVA 1RRKA 1ABIH 2JETB 4ZAEA 1YCPH 2QXGA 3ZZCA 3V13A 1TOCB 4Y79A 3RXBA 1YPEH 1TNJA 3TH3H 1AUJA 4J2YB 4A1VA 3DD2H 1GGDC 1AZ8A 1FPHH 3F68H 5F8TA 3L33A 1X7AC 1P2MA 3M5OA 3F6UH 3G01A 3V3MA 2BD7A 4F4OC 1RTKA 1HJ9A 3FP6E 3A8AA 1SOZA 3H7TA 3A89A 1TMUH 1CHOF 1JOUB 3O8RA 2G5VA 1LCYA 1EPTB 2IPHA 2BVRH 2F9VA 1F0UA 3CENA 1GVZA 1WV7H 1F0TA 1XXDA 5EXLA 1DFPA 3RM2H 1C9PA 1C2HA 2V35A 3RMLH 1C1MA 1G3DA 2PSYA 3SJKA 2QCYA 2FOAA 2UUYA 1A4WH 3SUGA 4LZ1H 1ZSLA 2FP7B 5GDSH 2OQUA 2ZGJA 4U2WA 1AE8H 3A7XA 4ZHLU 3SNDA 3Q3YA 1O2XA 2PKSB 5JPMH 3V12A 1AY6H 1GJ6A 2BOHB 2WV4A 1EATA 1TALA 1DDJA 1UMAH 3LDXH 1IQNA 4FUGA 1BZXE 1RTLA 3SV6A 1GBBA 3K2UA 3CS7A 3OYPA 2ZFPH 2UWPA 3ODFA 4ZXYH 2VB0A 4JK5A 3FAOA 1P04A 3BTQE 3PB1E 1O2TA 2Z9JA 2GDDA 2H9EH 2Q6DA 1YKTA 1BT7A 3C27B 2BVXH 1RIWC 3UWJH 1O2SA 4B74A 1TNKA 2QXIA 1YF4A 3SU3A 1FQ3A 3KEEA 2EC9H 3RXJA 1JWTA 1NTPA 1AB9B 3D62A 1SLUB 2OC7A 3S7KB 3RXCA 1BB0B 1NROH 1G3CA 4XE4A 3A83A 5AVDA 4X0WU 3M3TA 3BG4B 1LQDB 1B0EA 3E90B 1BDAA 5GWZA 3LC5A 3LT3A 1MH0A 2Y5FA 3ZZ4A 1GBHA 3SJ8A 5ETXA 1SGPE 1BTWA 1TPAE 1XX9A 1O2GH 2RCEA 3E6PH 1C5PA 1RXPA 3UUZA 4BAHB 1MMJN 1GGDB 1O2VA 1LPKB 1YPHE 4ZKOU 3MH6A 1BRUP 4DGJA 2IN2A 1CGHA 2GT7A 5EGMA 3BG8A 1SFIA 3VB4A 3PMHB 2ZGXH 3VB5A 7GCHG 1BJUA 4Y11E 1S6HA 1EQ9A 2ZO3H 3QK1A 2GVFA 3ZZ3A 2QC2A 2XC0A 1BMMH 1XUIA 2ANWA 2RG3A 4SGAE 5EOKA 3RC4A 1SFQB 3EQ0H 3RMNH 1QY6A 2VVCA 4UEHH 3RXPA 1KTTB 3U8OH 2D1JA 2G4UA 3LGVA 2CHAC 5E8EH 2BY9X 2ZCLP 5EQSA 1TNLA 1W0YH 4ZROA 3HGPA 1K1PA 1BHXB 3TJOA 2STBE 1GBLA 2ZHFH 4THNH 5LPFA 3MH7A 1P06A 1O3LA 4CH8B 4B73A 3MO6A 1QRZA 1EPTA 1QJ1B 1T4UH 1WQSA 1UK2A 2OP9A 1CO7E 4AN7A 1NRSH 2WYJA 3LOXA 2Y7XA 1O5CB 5FPSA 2Z94A 1AIXH 5ESTE 1MKWK 2ZF0H 4A7IB 3P8OA 1O3KA 2O8MA 2J92A 1GVLA 2Z3EA 3FP7E 4TY6A 4X8SH 5L2ZH 1JMOH 3M3VA 4MVNA 1P05A 2WPKS 5DKMA 3GCOA 1G3BA 3ZZ9A 2HVXA 4QT8C 3ZZ6A 2WPIS 1HAYB 2A5IA 1ANDA 7ESTE 4ZMAH 1ETSH 1GBEA 1RIWB 3GYLB 1QRWA 2XXLA 1GI2A 4WH6A 1W8BH 1ABJH 5TJXA 5C67A 4NIWA 5FCKA 1TMBH 1ELFA 1DLKB 3EA8A 1HGTH 3M7UA 2QV1A 4XBBA 1N8OC 1TRYA 1ZLRA 2CV3A 5EXMA 1D3PB 4ABFA 1UVTH 1GHBG 1FY8E 1C2MA 2FOEA 4B1TA 2OBQA 2PHBA 4IN2A 1P3EA 3PWCA 1V2OT 3PTBA 2TGDA 4XBDA 2WV5A 1C5TA 3H7OA 1KY9A 1O3NA 2A7JA 3KQDA 2O9QA 3UR6A 1EAIA 1VGCC 1WUNH 2FWWA 1HNEE 4K8YA 2G5NA 2BD4A 4BOHA 1N1LA 2YNAA 3NCLA 5CHAB 5EG4A 3KCGH 3QZRA 2BD9A 2CJIA 3KNXA 4OS7A 3RC5A 1ZTKA 2ZU2A 4B76A 1O2NA 4K8BA 3ELAH 5FPYA 5B6OA 3MNXA 1MTNC 3ZZ7A 1ZMLA 1FAXA 1FIWA 2HALA 4AFSA 1ZHPA 1SGFG 3MI4A 2AGIX 2H2ZA 1EAXA 1O5BB 1F5RA 1GG6C 2XNIA 3OX7U 3P95A 4I8JA 1ZMNA 4DVAU 1SC8U 3MFJA 4WJG2 4FU7A 5I46H 3NUMA 1EZUC 1LO6A 2ANYA 2V6NA 3KQEA 5ESBA 2YOLA 1NFXA 2A1DB 1CSOE 1KXEA 2FTMA 1O36A 2CHAB 1O2LA 3LONA 1BQYA 8ESTE 1GBCA 1CGJE 3BTKE 3K9XB 1T8MA 1V2KT 4Y76A 2Y82A 4GSOA 4GCHG 3E0NB 1V2VT 5C5NA 1O3IA 2ZDNA 3MU8A 5T6GA 4I33A 1OX1A 2ZHDA 4XDEA 1SGFA 1GHXH 4X8TH 4IW4E 3A7TA 3EYDA 4INLA 1A1RA 3SQHE 1DLEA 1AQ7A 3RP2A 1IAUA 2DE8A 1GBFA 1PPGE 3A85A 2ZTXA 4KGAA 1AN1E 3T27A 5HYOA 2PGBB 1NC6A 1O2KA 2VGCC 1AGJA 1TYNA 2R2MB 5FBIA 4MPWA 3HKJB 1TX6A 1O2OA 3P92A 1O37A 2A7HA 1ZYOA 1EP5A 2ZHEH 1CVWH 4DIIH 1OP0A 1OOKB 2XBYA 4ZHAA 2ZKSA 1EB1H 1P57B 4NCYA 1QTFA 1OWHA 1VJ9U 3ITIA 3VPKA 2QN5T 1MUEB 2G8TA 1O3AA 1SG8B 1ZPCA 3ZZ8A 1HPGA 2UUKB 1SLWB 1VR1H 2ZHQH 3FP8E 2TBSA 4FUJA 1C2LA 4TPIZ 3Q76A 3NPSA 1C1PA 1N8OB 5A09A 3QX5H 3E16B 2A4GA 4I8GA 1GDUA 1LVBA 5LPRA 1VITG 3ZVFA 1NU9A 1E0FD 4RKJB 1JXPA 4MLFB 1O2YA 1EZSC 2VIQA 5JBAS 1SGQE 4H6TA 2FOBA 1YLDA 4WXIA 1OP2A 1VGCB 1T8LA 4E05H 3TJUA 4Z6AH 1D6WA 1YPGH 2RA0A 5FBEA 5BPEA 5K0HA 2GTBA 2BLQA 3P8NA 4FUCA 2GDEH 3P8FA 2BD2A 2FPZA 2VU8E 1ANEA 3P70B 3LKWA 2W5EA 2AMDA 3SNEA 2KAIB 3GCNA 1GPZA 2H6MA 3S0NA 3JZ1B 3MNBA 2XW9A 1EJNA 1SGYE 1TRNA 3PLBA 1GG6B 2GZ7A 2UWOA 2AEIH 4R8TB 4YM9A 3UQVA 2VIVA 4RN6A 2BY7X 5GIBA 3UTUH 2GCHF 1H8IH 2EI7A 1V2LT 4MNVA 4UFFH 1DY8A 1P2QA 4IS5A 1J14A 1JRTA 1A61H 1EAUA 2BDGA 1C1NA 2VINA 3VB7A 1FDPA 2F3CE 4UE7H 5EPYA 3JZ2B 3BIVH 2G55A 1UJ1A 1O2ZA 1QJ6B 1TMTH 1BITA 4GLYA 2PGQB 2BM2A 2XTTB 1GBIA 3SBKA 2SGQE 1NFYA 1Y59T 1C2GA 3SJ9A 1AUTC 1UK4A 1E38B 3BTME 1H1BA 3MU0A 3RC6A 4NIYA 3ATMA 3GY5A 1F0RA 1XUFA 1UTKA 2VGCB 2ZG0H 1LKBA 2PSXA 3LGYA 3TLOA 4NFFA 1C5XB 4B2CA 3QUMP 2C90B 4NG9H 1BTUA 2J38A 2F9UA 3BEIB 1J15A 3ZZ5A 4X1PU 1V2WT 1Z8GA 4X2WA 1UCYE 1O5GH 2XBWA 4BXWA 4XFQA 1O3BA 3QO6A 1K1LA 2AH4X 1ELVA 3SI4H 1O2WA 1C5VA 1W0ZU 4MPUA 2ZGHA 2R0KA 1GJ5H 1KXFA 3A8BA 5E0GA 1XUJA 3ZZBA 2FO9A 2BZ6H 3A80A 4LXBH 1ZRBA 3SUEA 1G2MA 4AG1A 1UTPA 1GMDF 4WY3A 1D4PB 2VVVA 3ZZAA 5JBBS 1A3EH 4FU8A 1OYTH 1ZHMA 2A4RA 3L3TA 1OWEA 3TGIE 2QIQA 1UTLM 1E35B 1SGEE 1DPOA 3AASA 4E7RG 5DP7A 3TK9A 1A0HB 2Y6TA 2Z6BD 5L30H 1GJ4H 1QIXB 1TBQH 1EASA 4X2VA 1AVXA 5IDKA 1T32A 3SJIA 2Q6FA 3HATH 1PFXC 2ZDMA 2BY6X 3SQEE 3RLWH 6GCHG 2Y7ZA 1W7XH 2HRVA 2EEKA 3UNSA 1GCTC 3O8DA 3ZYEA 2Z3DA 3W95A 2P59A 3MTYA 2BDBA 1FONA 3M36A 1CBWC 3SORA 2BDYA 1C1RA 1QBOA 4DY7B 4WH8A 4JCNA 2GKVE 2A45B 1C5QA 2C3SA 1AB9C 4ZKNU 1CHGA 2UUJB 1V6DA 1FY1A 4NZLA 2CN0H 1O2PA 1CT2E 1MCVA 2TPIZ 3BF6H 1H9HE 1ZJKA 2SGEE 3URCA 1AVWA 3B23B 3URDA 1LPGB 1GDQA 1QNJA 2BLWA 3P6ZB 5A8YA 2DE9A 4K1TA 1FUJA 4RKOB 5EQRA 2Y5GA 1BMLA 4OGXA 1AKSB 3KGPA 1MCTA 3QGJA 4AB8A 3Q00A 5DK1A 1A3BH 1KLIH 4JZFH 1Q3XA 2AS9A 3TK5A 4DIHH 2GMTB 2BDAA 4OS5A 1MU8B 3TVJB 4F49A 5EW1H 2SNWA 1DUAA 1P03A 3TU7H 2ZI2H 1Y3YA 2AMQA 3K6ZA 1K1IA 3R3GB 1O2RA 5JBCS 1TQ7B 1HJAC 3EA7A 1TX8A 2Z9GA 2Z9LA 5F03A 4KELA 1MQ6A 6CHAC 3RXHA 1T31A 3GY8A 2QY0B 4CREA 1Z71A 3PV4A 2UUFB 1ZSKA 2A4QA 3LGWA 2PTCE 3PMJA 1WCZA 1OWDA 2NU0E 2ANKH 1GHAG 4NSYA 1KLJH 2BOKA 1C5SA 4OGYA 3M3SA 3SU4A 2A2XH 1ORFA 1S0QA 1H8DH 2PUQH 1C2KA 1XKBC 1QA0A 3PMBB 3RMOH 4CRCA 1GJ9B 5FX6A 2VWOA 3LPRA 5FPTA 4ABHA 1AE5A 8GCHG 2V0BA 1ELBA 4TWYA 1TABE 2I6SA 2ZA5A 3TITA 2ESTE 1TX7A 3F9EA 1ESTA 1MKWH 4ZKSU 2O8UA 3SV7A 2PTNA 1BMAA 1O31A 2ALPA 4CRFA 4FUFA 1C1OA 5ABWA 4Y7AA 1Y8TA 2AIPA 1THRH 2AGEX 2J95A 2BXUH 3T29A 4E7NA 5JYIA 3LU9B 1UO6A 2ZP0H 4M7GA 8LPRA 2BQWB 2QYIA 1QL7A 2EI8A 2A4OA 1GCTB 1KXAA 1B5GH 2OTVA 4K3JA 1SGTA 1CBWB 2B0FA 4R0IA 3MU1A 3SOSA 1O2HA 1AI8H 1NO9H 3E1XB 3K65B 5AHGH 5HM2A 1SLXB 2J4IA 4UFGH 1LVYA 3QTVH 1UTNA 3ATIA 2OQ5A 1C2JA 3OY6U 4ZHMU 1LHDH 2F91A 2QXJA 1AD8H 1NM6A 4NA9H 2VIOA 5EODA 1TWXB 2Y5HA 3MU5A 1LKAA 2VNTA 1S0RA 4XSKU 1A7SA 2TGTA 3UNQA 3M35A 2ZC9H 1PPFE 2A2QH 2ZTZA 2WPHS 3GDUA 4JYVH 1CT0E 3MYWA 3D49H 2HNTE 2EA3A 2NU2E 4Q7XA 1NRRH 2XYAA 4E06H 1WTHD 1PPZA 1GBJA 2ZHWH 1E37B 3CS0A 1Q31A 5CHAC 4NSVA 4B71A 2FS8A 3ATWA 1V2NT 1BJVA 3KN2A 1A0JA 1HLTH 4MNXA 4CRBA 3B9FH 2GZ8A 3T25A 5FAHA 1HJAB 3S9AA 4YOIA 1C5LH 6CHAB 2JH6D 3GCHC 1NT1A 3TJNA 1WTGH 1GI5A 1AKSA 1E36B 1NESE 1N6YA 4OS6A 1AFQB 3UQOA 4AZ2B 2ZWLH 1FMGA 4AFUA 1Y3XA 2TGPZ 3GCTG 1QR3E 1HBTH 1PPCE 1O3JA 2HPPH 3ENSB 5JDUB 1BBRE 1ACBE 1NS3A 1SGDE 1OYQA 3AVZA 2BB4A 3GISB 2M5TA 1Z1IA 4LZ4B 2FEQH 1ARCA 1YGCH 3SV9A 1A46H 2C4FH 4O3UA 1W3CA 4MNYA 5DP6A 4HGCA 5C3NA 1MZAA 3RUOA 2F9PA 1DANH 2BYAX 5TCAA 1MBMA 5HGGA 1SI5H 2ALVA 4NFEA 4Q7YA 3Q3XA 3E91A 5F8ZA 2ZPSA 5JB8S 3BTWE 2YNBA 4MPVA 4WMDA 4A92A 2QGRA 2ZQ2A 1ZSJA 1FZZA 3S7HB 6LPRA 5E0JA 4ABGA 1ZRKA 4CBOA 2ILNA 2VIDA 5BRRE 1Z7KA 4YLQH 1J8AA 1SPJA 2QXHA 2BQ6B 1KIGH 1UCYH 1MAXA 4GHQA 2RA3A 2HPQH 1GBAA 2BXTH 1HUTH 2FDAA 1P3CA 3O8CA 3VB3A 1S83A 3NXPA 3DFJA 1C2FA 2FOCA 2WINI 5DP3A 1ANBA 1THSH 1SHYA 1DXPA 4INKA 5HM9A 2Z7FE 1BOQA 2ODQA 3A86A 5H4IB 1B0FA 3TGJE 2P3TB 4JYTA 4B2BA 1GI6A 4I7YH 1YC0A 2F9OA 2G81E 2OC1A 3LGTA 1FN6A 2OD3B 1NU7B 4H4FA 5AFZH 4CHAC 3ESTA 5J4SA 1H9LB 3OU0A 2R0LA 1AWFH 1TE0A 3EDXB 3SHAH 1UTJA 5C1UA 1NRPH 1OS8A 1O3DA 4DURA 1LPZB 5I25A 1K22H 3U8RH 3Q77A 2XCFA 2PR3A 1ESAA 3UR9A 1QB9A 3IWMA 1BHXF 3E3TA 2J94A 3LC3A 4NIXA 1BTPA 2VWMA 3TJVA 3FZZA 3LJJA 1OWJA 3T5FH 2PW8H 3A7ZA 3GCHB 1J9CH 5GJ4B 1EAWA 1MKXH 1UVUH 4UFDH 4MTBA 3PLPA 3LH3A 1KXCA 1PJPA 3U69H 4HTCH 1FI8A 3FANA 1IQJA 2BHGA 2Z9IA 1O2QA 1BA8B 1G2LA 1ZPZA 2HNTF 1YPLH 1SL3A 1MTWA 3DFLA 3R0FA 5FXLA 2STAE 1HV7A 1XUGA 3TH2H 1ELAA 5SGAE 2B8OH 1D6RA 1HAOH 3RXRA 1AWHB 1Z6EA 1B7XB 4KTUA 3UNRA 1EX3A 2CXVA 5E2PA 1HYLA 1YP9A 1TGBA 1P2JA 1O3GA 1TGCA 1DWCH 3WY8A 4K1SA 1TONA 3SGAE 1TPPA 3ZVCA 2ODYB 1PQAA 1GWAA 4ESTE 1FY5A 1SGIB 3BV9B 1CE5A 1ZTJA 3BIUH 1O38A 1D3TB 1UVSH 2VH6A 1SQOA 2VH0A 3RXFA 3QTOH 1YM0A 3AAUA 4ISNA 4DOQA 4GPGA 3SZNA 1VITF 1VCWA 4JYUH 1S5SA 3SUFA 3FZDA 2PKAB 2BD8A 1SOTA 5T3HA 4A6LA 1Z8RA 1P2IA 1PYTC 2ZGCA 1HAGE 2XBXA 1UCYK 2CF9H 2A5AA 1BMNH 3RLYH 2XC5A 4ABBA 3E0PB 4MQAA 4O97A 2W7UA 1XMNB 3KQCA 4AYYB 1V2UT 4CR9A 1GMCF 1A2CH 1C5NH 4D8NA 4GUXA
chains in the Genus database with same CATH superfamily
2OINA 1MZDA 4F48B 5EW2H 3A87A 4CHAB 1BUIA 4BAQB 2VWLA 4I31A 3UREA 2KCAA 1IHTH 1KXDA 3ZVEA 3RU4T 2FYQA 4X6NA 3SNCA 1SR5C 6ESTA 3UAIC 3A88A 4B75A 1AVGH 4B2AA 1M9UA 1IQLA 3SW2B 2L74A 1L1JA 5GCHF 1GI1A 3SN8A 3MHWU 7LPRA 2QF3A 1FPCH 3EE7A 4X2YA 1K21H 2V3HH 3SJOA 1L1NA 1DITH 2ZDAH 3QDZB 3U98H 2BDCA 1EZQA 2RDLA 1WDIA 1KDQA 4GAWA 2H9TH 1BIOA 1CA0C 1WOFA 1QCPA 4BTUB 1S81A 4ABJA 3HKIB 3QWCH 4CH2B 4X6PA 3EE0B 3MOCA 2FODA 1LMWB 3A7VA 2Z3CA 1SGRE 2F43B 4U32A 4FUHA 3F1SB 1RTFB 1MKXK 1D3QB 2QF4A 3GYMA 1ESBA 2G51A 1DWDH 5TCCA 3NKKA 4DT7B 1EJMA 4Y6DA 3BTGE 4AFQA 1SQRA 4HI3A 1G37A 1S6FA 1SQTA 3SI3H 1IQGA 3A81A 4ABAA 3QZQA 3DA9B 1DE7H 3SV2H 4HFPB 2ZTYA 3LGUA 3MH5A 1IOEA 1QQ4A 1PQ7A 1XXFA 2BTCE 3C1KA 3DT0H 2V3OH 2WYGA 1DS2E 2PV9B 1TNIA 1MBQA 3ODDA 1MQ5A 1O30A 2GMTC 4AYVB 4LOYH 2W7SA 3ZVAA 1IHSH 2SGPE 3A82A 2D26C 1C2EA 3DCLA 1SGNE 2QF0A 3UOUA 3MNSA 4OS2A 3OY5U 3F2HA 2FI3E 4O3TA 2GCHG 2VIWA 3A84A 1K9OE 3HGNA 2FOHA 3OTJE 4YZUA 2OUAA 5A0AE 1O3HA 4WF8A 1ZGVA 3GY2A 3MO3A 1HJ8A 1WBGB 2C8YB 1BTZA 1SMFE 2FESH 3GDVA 3PYHA 4AGKA 2HLCA 2ULLA 1THPB 4DJZB 1AHTH 3FN8A 3NRLA 2H5DA 1EZXC 4AORA 4AOQA 4NGAH 1G32B 1GHVH 1PPHE 1HAVB 4VGCC 1F92A 1XKAC 1EKBB 1GMHF 1QURH 2PKAA 2D2DA 2ASUB 3U1JB 2FX6A 3A8DA 4K60A 1D3DB 4X1QU 1W2KH 2QF5A 1P8VC 4XBCA 1FY4A 4JK6A 1GI9B 2BZAA 3S69A 3M5LA 2H1UA 4DCDA 1O2MA 1O3CA 1ARBA 2THFB 5GXPA 1KXBA 1O3OA 1EFRD 3PWBA 1NBMD 4GVUA 3RU4D 1PPEE 3ATKA 2PWXA 1V2JT 3RXKA 2H9HA 2SFAA 5EXNA 1GL1A 2HGTH 4RT1A 1K1MA 1CA0B 1ZR0A 5EIYA 3BTFE 3SV8A 2WUCA 3PLKA 5L6NH 1ID5H 1SB1H 2BDHA 4FU9A 2JIZD 7KMEH 1BMFD 2GV6A 2BY5X 1RFNA 3TNSA 1GBMA 3T2NA 1XVOA 2AYWA 1T8NA 1UHBB 4IC6A 1Q2WA 2PUXB 2AMPA 2JJ1D 1GMDG 1W12U 1KSNA 1U6QA 2A31A 4PROA 4BTIB 3GY3A 4IMQA 3RXGA 2WPLS 3MH4A 3M5NA 3DSPA 2FLRH 4X8UH 2P16A 1V2RT 2V7QD 2XNDD 4I32A 4I8HA 1UTQA 5LPEA 1OP8A 2FS9A 3SU5A 1WQVH 1NN6A 3RDZA 1S82A 3DHKH 3ZZDA 3A7WA 4ACAA 1O33A 1GHAF 5FX5A 1O34A 2B7DH 1V2TT 4M9FA 2WPDD 3RXAA 3U9AH 4DT4A 3VB6A 2Y80A 1K1NA 2BVSH 4TSFD 1XM1A 2TRMA 1F0SA 3RXDA 1JRSA 4JZIA 1W14U 1SGCA 4YO9A 1C4Y2 5JB9S 4BAKB 4JMYA 8GCHF 4A5TS 2QAAA 1AFQC 2Y81A 5T6DA 1ZPBA 3RXSA 3F2FA 3FFGA 2Q1JA 1MTUA 1O3FA 1YPKH 4UDWH 2ZFQH 3BN9A 1UVOA 4K1EA 5G4BA 1GJ8B 2NU4E 2VIPA 3TK6A 3UY9A 2SGAA 1C5RA 5HXFA 3QN7A 4VGCB 1P12E 1GI8B 4YT7H 2AERH 1ZOMA 3PRDA 1IQMA 1BBRK 5HMAA 2O8WA 1RJXB 2A7CA 2WPMS 3VXFH 1QBNA 4K69A 3S9BA 4TPYA 2XBVA 4LK4A 2C8ZB 5C1YA 3STJA 2VWNA 2VVUA 1C5YB 2ZECA 1O5DH 2AIQA 1L4DA 1NY22 2F9BH 1O35A 1L0ZA 1QB6A 1O39A 2GV7A 3ATLA 2ZFRH 2A0QB 3VEQB 3S9CA 1TA2A 2HWLB 2XWBI 1NPMA 4INHA 2G00A 5E2OA 1HAVA 1VCPA 4MNWA 2LNCA 1EJAA 2ZFFH 1NRNH 1CHOG 1C4U2 1GI4A 4X8VH 3UIRA 1TFXA 3OSYA 2P94A 3RMMH 3O8BA 3V7TA 1P2NA 1EUFA 3AAVA 1C5WB 1ZHRA 1ZTLA 2G52A 3TNTA 2ODPA 5C2ZA 4CRAA 1A0LA 3SGQE 3MWIU 4BANB 2GJGA 1OWKA 2HNTC 4ZKRU 3CP7A 2XC4A 2ZPQA 5EU8A 1Z1JA 1C5OH 2BX4A 1UVPA 1CA8B 1ZGIA 4IC5A 1O3EA 1F2SE 3UOPA 1LVOA 2YMSD 1TNGA 3M61U 1YPHC 2IJOB 4HZHA 1O2IA 1L2EA 2BY8X 3H5CB 1MTVA 1H9IE 2XWAA 3N7DA 1HXEH 4X6MA 4Z0KA 4Q7ZA 1NZQH 1UHBA 1MD7A 7GCHF 1HB0B 3A8CA 1RD3B 1GHWH 1BTHH 4Q2KA 4AFZA 1OWIA 2I6QA 1HDTH 1BTYA 2P95A 3OE7D 3GCTF 1FJSA 2TIOA 3V0XA 2HOBA 4NIVA 3IG6B 4ZUHA 2BD5A 1C2IA 5DPAA 1S84A 2P93A 2WPJS 1LVMA 2CGAA 3FKSD 4BAMB 4JZ1A 1Y5AT 4NZQA 2GX4A 2IPQX 1W10U 1BTXA 3RXIA 4FVBA 5DJ7A 1HAIH 3M7TA 1YCPK 2JKHA 1FAKH 4D9RA 4Q80A 1N6XA 1EXFA 1YPJH 2ZU5A 1NFUA 1XVMA 2WUBA 3ZIAD 5HKKD 4TWWA 3MMGA 2XRCA 1S6LA 5A2MH 4XOJA 1T8OA 4IGDA 1BRCE 1DT2A 2A5KA 2BD3A 5J4QA 1AZZA 4FXGH 4CBNA 3I29A 3M37A 5C5OA 2FMJA 1HRTH 1K1OA 3SHCH 3VFEA 1O3PB 3BEUA 1GL0E 1OXGA 2B5TB 4BTTB 2P3FH 5A0BA 2FOGA 1HXFH 3AK5A 2FZZA 4J1YA 5IK2D 2GCTC 1O3MA 1IQEA 5AFYH 2ZGBH 4X6OA 1CQQA 1MTSA 1UTMA 1YLCA 2GT8A 2C93B 3KIDU 3SU1A 1V2QT 3PTNA 2GP9B 4U01A 1DWEH 2OC0A 2ZQ1A 1FV9A 1QA7A 1O5FH 1QB1A 1ZMJA 2NWNA 4ISIH 1TA6A 2FI5E 3I77A 5DGJA 1ZJDA 1XUKA 1GHBF 2ZU4A 1SQAA 4NWLA 3HK6B 1SVPA 1P11E 1P0SH 3DUXH 1HIAB 1L4ZA 1LDTT 2RFKC 3CNRA 4I8LA 1VJAU 4FUBA 1YBWA 1INCA 1G9IE 1ETRH 4BAOB 2H5CA 1G36A 1YCPM 1KMHB 1ZZZA 5CDFE 4FUEA 2ZEBA 1QBVH 1TIOA 1L1GA 1TAWA 2WHXA 2ZZUH 4D7GA 1F5KU 2ANMH 1TQ0B 4ASHA 3F9FA 3SU0A 5A0CA 1HAPH 1KDQB 4DW2U 3GDSA 2K8IA 1KTSB 3P17H 5DG6A 1KLTA 1MAYA 1C4V2 3Q3KA 5DP9A 1GI3A 5DP8A 5C20A 4UFEH 2BX3A 2KZ4A 1WSSH 1O5EH 1ELCA 1F7ZA 1GI7B 1JBUH 1Z8IB 3EAJA 1C1TA 2GGVB 1T4VH 4KTCA 1JIMA 2ZFTA 1J16A 5EPNA 2OCVB 1HFDA 4OS4A 4B6EA 3N7EA 3PM3A 1DVAH 4FVDA 2JH5D 1J17T 4Y8XA 4ABDA 2ZDLA 4GCHF 3GY4A 3GOVB 1V2PT 1QGFA 2DUCA 5A8ZA 4RSPA 4WWYA 4UD9H 2LPRA 2P8OC 1P10A 2FIRH 2J2UA 5EJZA 1YPMH 2KCOA 1TRMA 2AGGX 4A1XA 1C5UA 4O03A 2ZU1A 4H42U 4AX9H 1H4WA 2PFEA 1C1WH 1Z8JB 3F9GA 2K1QA 1IQIA 2W3KA 1QQUA 1T7CA 1JIRA 1P9UA 1AMHA 2J34A 5PTPA 1S85A 1P02A 1DUEA 1YYY1 2GD4B 3NK8A 3AW1A 3RXOA 2GCTB 2O8TA 2ZFSA 1MU6B 4Y71A 4ISLA 1EB2A 1V2ST 4AG2A 5JBTA 3KQBA 1COWD 1DM4B 1FN8A 1GBKA 1SLVB 4JZDH 1DSUA 5CMXH 1DOJA 1AU8A 2P3UB 1LHCH 5DP5A 4Y7BA 3RXUA 1Y3VA 3BEFB 3RXQA 5LGOA 3PROA 3N7OA 2CF8H 3PV2A 1GVKB 2O8LA 1QL9A 4NA8A 4A1TA 3ZYDA 1WYKA 2TGAA 3STIA 1P2KA 3QGNB 4BXSA 4O9VA 1HCGA 1DX5M 2R3YA 3FVFB 4WMFA 5C17A 1IQKA 4FUIA 1W7GH 1GBDA 1VZQH 3HK3B 3RXEA 2D8WA 1MABB 4Y0ZE 3PO1C 3W94A 2CK3D 1C1UH 5DO4H 3D23A 1BCUH 1OKXA 4UONA 4MG3A 4NA7A 1LHFH 3BTTE 1SBWA 3NWUA 1V3XA 2ZPRA 3MNCA 1TPOA 1PQ5A 1FNIA 1TBZH 1PQ8A 4KP0A 3VGCC 2BDIA 1BRBE 1GDNA 1GJBB 1YY3A 1MD8A 3RXMA 1ELDE 4NWKA 3T26A 3HPTB 1LQEA 1OPHB 3IITA 3QLPH 1DXWA 1HIAA 3EA9A 1GCDA 1Y3UA 1LHEH 1NFWA 5E0HA 1LTOA 1O2UA 2HLDD 2W3IA 5GPIB 1GBTA 2EI6A 1ANCA 2OLGA 1OHHD 1TGNA 3BSQA 4YOJA 2PLXA 1Y5UT 1ELEE 3M7QA 5AF9H 2BMGB 3L6PA 1K1JA 1P2OA 3ZV9A 1C5MD 2A32A 3NZIA 2ZU3A 2M2AA 1NBME 3RU4E 2SNVA 4CRGA 2FXRA 3WWBA 3KF2A 4MPXA 4IBLH 2JJ2D 2ZCHP 4ZXXH 4GHTA 3AW0A 3U8TH 3EGKH 1GMCG 3U1IB 2B9LA 3TGKE 4MDSA 2K0QA 4K5ZA 3SNBA 1UK3A 2ZNKH 1C1VH 2P8OB 1UTOA 4Y10E 1MTNB 1KYNA 1W0JD 2FYRA 4WMEA 1W11U 1G30B 1K2I1 5KEDA 1WAYB 2SGDE 1SSXA 1GHZA 1BRAA 1K28D 4IMZA 3RM0H 1DSTA 2IOTA 2JH0D 1GJAB 1PPBH 4IN1A 5EJLA 4H6SB 2OXSA 5GCHG 4ISHH 4YLUA 1TLDA 4YT6H 1QRXA 1ELTA 2BQ7B 4Y0YE 3I78A 4FETA 1C2DA 4X2XA 5L2YH 4RI0A 3VXEH 1CT4E 3UPEA 1SHHB 1CGIE 2G4TA 3TIUA 1G3EA 5K7RA 4ISOA 1HAHH 1IQFA 2GZ9A 4Y8ZA 4YTAA 2J9NA 1SKYE 4TY7A 3BTDE 1P09A 2JETC 2OBOA 1QL8A 1XUHA 4Q63A 4ZCNA 3GY7A 1E34B 3B8JA 5F6MA 5IYTA 3F0OA 3ZVGA 4Y8YA 4BNRA 3D65E 4YOGA 1O0DH 4ZH8A 3UFAA 1GJ7B 3T28A 1TOMH 2C8XB 4X1RU 3A7YA 1TGTA 1ELGA 1V2MT 3PO1B 1C5ZB 1NRQH 8KME2 1HAZB 1C1SA 3RXVA 1BBRH 1O5AB 3BTHE 2KR7A 1VITH 3PMAB 5T6FA 1F5LA 2UWLA 1HAXB 2JDID 1Z6JH 3GY6A 3VGCB 5C1XA 1DWBH 1Y5BT 4AGJA 2QA9E 1TNHA 6GCHF 3RXTA 3K6YA 5C94A 1DY9A 2BLVA 1EPTC 2W26A 2AFQB 4Q4LA 1LHGH 4WVPE 4CR5A 3P8GA 2Z9KA 1EP6A 1OSSA 2FX4A 2FTLE 1IQHA 2OC8A 3SO3A 2R2WU 4OS1A 4ABEA 4D7FA 1A5GH 2FI4E 3SGBE 3DSOA 1PYTD 2FM2A 2ZIQH 1TPSA 4KKDA 3LGIA 1P9SA 1EOLA 1ETTH 3MO9A 3TH4H 1C9TA 4I8KA 1FIZA 2ZCKP 1FXYA 4FUDA 3SU2A 2Q6GA 2C8WB 3SUDA 1GHYH 3TPIZ 1GI0A 3GICB 1O32A 5FCRA 2PKSC 2CMYA 2VJ1A 1FLEE 3F9HA 1QHRB 1A5IA 4AB9A 3SU6A 1P01A 2NU3E 3M5MA 3LJOA 3T62A 2ZDVH 9LPRA 4D76A 3ZV8A 9ESTA 3LH1A 1K0HA 4WXVA 1O2JA 1AO5A 5FHTA 2F83A 5CE1A 3MQKC 3E8LA 1W13U 1GJDB 2BLOA 4KTSA 1GMHG 5A8XA 1EOJA 4ABIA 1AFEH 1CU1A 2R3UA 4TYDA 4X1NU 4DG4A 1QFKH 3MU4A 5EQQA 1A5HA 1RS0A 4X1SU 4K2YA 4U30A 1TB6H 2XCNA 1TBRH 1Y3WA 2ZDKA 3ZVBA 4YESB 4JZEH 2FOMB 1D9IA 5F8XA 1C1QA 3RXLA 5DP4A 3LIWA 2F9NA 2R9PA 1TGSZ 2FOFA 1RGQA 2KAIA 5LH8A 1GJCB 4D9QA 2NU1E 2KM0A 1WU1A 3UWIA 2SGFE 1FY3A 3ZVDA 3BTEE 4SGBE 1VCQA 3KL6A 1DICA 1QJ7B 2FLBH 3BG4C 2J97A 3SNAA 4CRDA 3KHVA 3WW7A 1RRKA 1ABIH 2JETB 4ZAEA 1YCPH 2QXGA 3ZZCA 1UW7A 3V13A 1TOCB 4Y79A 3RXBA 1YPEH 1TNJA 3TH3H 1AUJA 4J2YB 4A1VA 3DD2H 1GGDC 3FOAA 1AZ8A 1FPHH 3F68H 3KYFA 3L33A 1X7AC 5F8TA 1P2MA 3M5OA 3F6UH 3G01A 3V3MA 2BD7A 4F4OC 1RTKA 1HJ9A 5F53A 3FP6E 3A8AA 1SOZA 3H7TA 3A89A 1TMUH 3KYGA 1CHOF 4RT0A 1JOUB 3O8RA 2G5VA 1LCYA 1EPTB 2IPHA 2BVRH 2F9VA 1F0UA 3CENA 1GVZA 1WV7H 1F0TA 1XXDA 5EXLA 1DFPA 2VBCA 3RM2H 1C9PA 3F0PA 1C2HA 2V35A 3RMLH 1C1MA 1G3DA 2PSYA 3SJKA 1E79D 2QCYA 2FOAA 2UUYA 1A4WH 3SUGA 4LZ1H 1ZSLA 2FP7B 5GDSH 2OQUA 2ZGJA 4U2WA 4ASUD 1AE8H 3A7XA 4ZHLU 3SNDA 3Q3YA 1O2XA 2PKSB 5JPMH 3V12A 1AY6H 1GJ6A 5T1VA 2BOHB 2J5UA 1EATA 2WV4A 1TALA 5C0UA 1DDJA 1UMAH 3LDXH 1IQNA 4FUGA 1BZXE 1RTLA 4XRNA 3SV6A 1GBBA 3K2UA 3CS7A 3OYPA 2ZFPH 2UWPA 3ODFA 4ZXYH 2VB0A 3W1EA 4JK5A 3FAOA 1P04A 3BTQE 3PB1E 1O2TA 2Z9JA 2GDDA 2H9EH 2Q6DA 1YKTA 3SYJA 1BT7A 3C27B 4YXWD 2J98A 2BVXH 1RIWC 3UWJH 1O2SA 4B74A 1TNKA 2QXIA 1YF4A 3OTPA 3SU3A 1FQ3A 3KEEA 2EC9H 3RXJA 1JWTA 1NTPA 1AB9B 3D62A 1SLUB 2OC7A 3S7KB 4XD7D 3RXCA 1BB0B 1NROH 1G3CA 5DN6D 4XE4A 3H09A 2OK5A 3A83A 5AVDA 4X0WU 3M3TA 3BG4B 1LQDB 4FOUC 2EY4C 1B0EA 3E90B 1BDAA 5GWZA 3LC5A 3LT3A 1MH0A 2Y5FA 3ZZ4A 1GBHA 3SJ8A 5ETXA 1SGPE 1BTWA 1TPAE 1XX9A 1O2GH 2RCEA 3E6PH 1C5PA 1RXPA 3UUZA 4BAHB 1MMJN 4P02A 1GGDB 1O2VA 1LPKB 1YPHE 4ZKOU 3MH6A 1BRUP 4I86A 2IN2A 4DGJA 1CGHA 2GT7A 5EGMA 3BG8A 1SFIA 3VB4A 3VG8A 3PMHB 2AHME 2ZGXH 3VB5A 7GCHG 1BJUA 4Y11E 1S6HA 1EQ9A 2ZO3H 3QK1A 2GVFA 3ZZ3A 3N99A 2QC2A 2XC0A 1BMMH 1XUIA 2ANWA 2RG3A 4SGAE 5EOKA 3RC4A 1SFQB 3EQ0H 3RMNH 1QY6A 2VVCA 4UEHH 3RXPA 1KTTB 3U8OH 2D1JA 2G4UA 3LGVA 2CHAC 5E8EH 2BY9X 2WSSD 2ZCLP 5EQSA 1TNLA 1W0YH 4ZROA 3HGPA 1K1PA 1BHXB 3TJOA 2STBE 1GBLA 2ZHFH 4THNH 2KCPA 5LPFA 3MH7A 1P06A 1O3LA 4CH8B 4B73A 3MO6A 1QRZA 1EPTA 1QJ1B 1T4UH 1WQSA 2RDEA 1UK2A 2OP9A 1CO7E 4AN7A 1NRSH 2WYJA 3LOXA 2Y7XA 1O5CB 5FPSA 2Z94A 1AIXH 5ESTE 1MKWK 2ZF0H 4A7IB 3P8OA 1O3KA 2O8MA 2J92A 1GVLA 2Z3EA 3FP7E 4TY6A 4X8SH 5L2ZH 1JMOH 3M3VA 4MVNA 1P05A 2WPKS 5DKMA 3GCOA 1G3BA 3ZZ9A 2HVXA 4QT8C 3ZZ6A 2WPIS 1HAYB 2A5IA 1ANDA 7ESTE 4ZMAH 1ETSH 1GBEA 1RIWB 3GYLB 1QRWA 2XXLA 1GI2A 4WH6A 1W8BH 1ABJH 5TJXA 5C67A 4NIWA 5FCKA 1TMBH 1ELFA 1DLKB 3EA8A 1HGTH 3M7UA 2QV1A 4XBBA 1N8OC 1TRYA 1ZLRA 2CV3A 5EXMA 1D3PB 4ABFA 1UVTH 1GHBG 1FY8E 1C2MA 2FOEA 4B1TA 2OBQA 2PHBA 4IN2A 1P3EA 3PWCA 1V2OT 3PTBA 2TGDA 4XBDA 2WV5A 1C5TA 3H7OA 1KY9A 1O3NA 2A7JA 3KQDA 2O9QA 3UR6A 1EAIA 1VGCC 1WUNH 2FWWA 1HNEE 4K8YA 2G5NA 2BD4A 4BOHA 1N1LA 2YNAA 3NCLA 5CHAB 5EG4A 3KCGH 3QZRA 2BD9A 2CJIA 3KNXA 4OS7A 3RC5A 1ZTKA 2ZU2A 4B76A 1O2NA 4K8BA 3ELAH 5FPYA 5B6OA 4P00A 3OEHD 3MNXA 1MTNC 3ZZ7A 1ZMLA 1FAXA 1FIWA 2HALA 4AFSA 1ZHPA 5B6LA 1SGFG 3MI4A 2AGIX 2H2ZA 1EAXA 1O5BB 1F5RA 1GG6C 2XNIA 3OX7U 3P95A 4I8JA 1ZMNA 4DVAU 1SC8U 3MFJA 4WJG2 4FU7A 5I46H 3NUMA 1EZUC 1LO6A 2ANYA 2V6NA 3KQEA 5ESBA 2YOLA 1NFXA 2A1DB 2KCYA 1CSOE 1KXEA 2FTMA 1O36A 2CHAB 1O2LA 3LONA 1BQYA 5GNDA 8ESTE 1GBCA 1CGJE 3BTKE 3K9XB 1T8MA 1V2KT 4Y76A 2Y82A 4GSOA 4GCHG 3E0NB 1V2VT 5C5NA 1O3IA 2ZDNA 3MU8A 5T6GA 4I33A 1OX1A 2ZHDA 4XDEA 1SGFA 4F55A 1GHXH 4X8TH 4IW4E 3A7TA 3EYDA 4INLA 3OEED 1A1RA 3SQHE 1DLEA 1AQ7A 3RP2A 1IAUA 2DE8A 1GBFA 1PPGE 3A85A 2ZTXA 4KGAA 1AN1E 5CHBA 3T27A 5HYOA 2PGBB 1NC6A 1O2KA 2VGCC 3PV5A 1AGJA 1TYNA 2R2MB 5FBIA 4MPWA 3HKJB 1TX6A 1O2OA 3P92A 1O37A 2A7HA 1ZYOA 1EP5A 2ZHEH 1CVWH 4DIIH 1OP0A 1OOKB 2XBYA 4ZHAA 2ZKSA 1EB1H 1P57B 4NCYA 1QTFA 1OWHA 1VJ9U 3ITIA 3VPKA 2QN5T 1MUEB 2G8TA 1O3AA 1SG8B 2WZQA 1ZPCA 3ZZ8A 1HPGA 2UUKB 1SLWB 1VR1H 3UB0A 2ZHQH 3FP8E 2TBSA 4FUJA 1C2LA 4TPIZ 3Q76A 3NPSA 1C1PA 1N8OB 5A09A 3QX5H 3E16B 3PRBA 2A4GA 4I8GA 1GDUA 1LVBA 5LPRA 1VITG 3ZVFA 1NU9A 1E0FD 4RKJB 1JXPA 5KECA 4MLFB 1O2YA 1EZSC 2VIQA 5JBAS 1SGQE 4H6TA 2FOBA 1YLDA 4WXIA 1OP2A 1VGCB 1T8LA 4E05H 2V3MA 3TJUA 4Z6AH 1D6WA 1YPGH 2RA0A 5FBEA 5BPEA 5K0HA 2GTBA 2BLQA 3P8NA 4FUCA 2GDEH 3P8FA 2BD2A 2FPZA 2VU8E 1ANEA 3P70B 3LKWA 5KGOA 2W5EA 2AMDA 3SNEA 2KAIB 3GCNA 1GPZA 2H6MA 3S0NA 3JZ1B 2WV9A 3MNBA 2XW9A 1EJNA 1SGYE 1TRNA 3PLBA 1GG6B 2GZ7A 2UWOA 2AEIH 4R8TB 3FO8D 4YM9A 3UQVA 2VIVA 4RN6A 2BY7X 5GIBA 2KFWA 3UTUH 2GCHF 1H8IH 2EI7A 1V2LT 4MNVA 4UFFH 1DY8A 1P2QA 4IS5A 1J14A 1JRTA 1A61H 1EAUA 2BDGA 1C1NA 2VINA 3VB7A 1FDPA 2F3CE 4UE7H 5EPYA 3JZ2B 3BIVH 2G55A 1UJ1A 1O2ZA 1QJ6B 1TMTH 1BITA 4GLYA 1YLNA 2PGQB 2BM2A 2F4LA 2XTTB 1GBIA 3SBKA 2SGQE 1NFYA 1Y59T 1C2GA 3SJ9A 1AUTC 1UK4A 1E38B 3BTME 1H1BA 5HIYA 3MU0A 3RC6A 4NIYA 3ATMA 3GY5A 1F0RA 1XUFA 1UTKA 2VGCB 2ZG0H 1LKBA 2PSXA 3LGYA 3TLOA 4NFFA 1C5XB 4B2CA 3QUMP 2C90B 4NG9H 1BTUA 2J38A 2F9UA 3BEIB 1J15A 3ZZ5A 4X1PU 1V2WT 1Z8GA 5DSFA 4X2WA 1UCYE 1O5GH 2XBWA 4BXWA 4XFQA 1O3BA 3QO6A 1K1LA 2AH4X 1ELVA 2LP6A 3SI4H 1O2WA 1C5VA 1W0ZU 4MPUA 2ZGHA 2R0KA 1GJ5H 1KXFA 3A8BA 5E0GA 1XUJA 3ZZBA 2FO9A 2BZ6H 3A80A 4LXBH 1ZRBA 3SUEA 1G2MA 4AG1A 1UTPA 2W6JD 1GMDF 4WY3A 5HIZA 1D4PB 2VVVA 3ZZAA 5JBBS 1A3EH 4FU8A 1OYTH 1ZHMA 2A4RA 3L3TA 1OWEA 3TGIE 2QIQA 2XOKD 1UTLM 1E35B 1SGEE 1DPOA 3AASA 4E7RG 2J98B 5DP7A 3TK9A 1A0HB 2Y6TA 2Z6BD 5L30H 1GJ4H 1QIXB 1TBQH 1EASA 4X2VA 1AVXA 5IDKA 1T32A 2YMSC 2Q6FA 3SJIA 3HATH 1PFXC 1FX0B 2ZDMA 2BY6X 3SQEE 3RLWH 6GCHG 2Y7ZA 1W7XH 2HRVA 2EEKA 3UNSA 1GCTC 4OM9A 3O8DA 3ZYEA 2Z3DA 3W95A 2P59A 3MTYA 2BDBA 1FONA 3M36A 1CBWC 3SORA 2BDYA 1C1RA 1QBOA 4DY7B 4WH8A 4JCNA 2GKVE 2A45B 1C5QA 1QZ8A 2C3SA 1AB9C 4ZKNU 1CHGA 2UUJB 1V6DA 1FY1A 4NZLA 2CN0H 2PP6A 4AC9A 1O2PA 1CT2E 1MCVA 2TPIZ 3BF6H 1H9HE 1ZJKA 2SGEE 3URCA 1AVWA 3B23B 3URDA 1LPGB 1GDQA 1QNJA 2BLWA 3P6ZB 5A8YA 2DE9A 4K1TA 1FUJA 2EQNA 4RKOB 5EQRA 2Y5GA 1BMLA 4OGXA 1AKSB 3KGPA 1MCTA 3QGJA 4AB8A 3Q00A 5DK1A 1A3BH 1KLIH 4JZFH 1Q3XA 2AS9A 3TK5A 4DIHH 2GMTB 2BDAA 4OS5A 1MU8B 3TVJB 4F49A 5EW1H 2SNWA 1DUAA 1P03A 3TU7H 2ZI2H 1Y3YA 2AMQA 3K6ZA 1K1IA 3R3GB 1O2RA 5JBCS 1TQ7B 1HJAC 3EA7A 1TX8A 1YWUA 2Z9GA 2Z9LA 5F03A 4KELA 1MQ6A 2LELA 3RXHA 6CHAC 1T31A 3GY8A 2QY0B 4CREA 1Z71A 3PV4A 2UUFB 1ZSKA 2A4QA 2L6OA 1H8HD 3LGWA 2PTCE 3PMJA 1WCZA 1OWDA 2NU0E 2ANKH 1GHAG 4NSYA 1KLJH 2BOKA 1C5SA 4OGYA 3M3SA 3SU4A 2A2XH 1ORFA 1S0QA 1H8DH 2PUQH 1C2KA 1XKBC 1QA0A 3PMBB 3RMOH 4CRCA 1GJ9B 1VKYA 5FX6A 2VWOA 3LPRA 5FPTA 4ABHA 1AE5A 8GCHG 2V0BA 1ELBA 4TWYA 1TABE 2I6SA 2ZA5A 3TITA 2ESTE 1TX7A 3F9EA 2KX4A 1ESTA 1MKWH 4ZKSU 2O8UA 3SV7A 2PTNA 1BMAA 1O31A 2ALPA 4CRFA 4FUFA 4TT3D 1C1OA 5ABWA 4Y7AA 1Y8TA 2AIPA 2YMSB 1THRH 2AGEX 2J95A 2BXUH 3T29A 4E7NA 5JYIA 3LU9B 1UO6A 3OFND 2ZP0H 4M7GA 8LPRA 2BQWB 2QYIA 1QL7A 2EI8A 2A4OA 1GCTB 1KXAA 1B5GH 2OTVA 4K3JA 1SGTA 1CBWB 2B0FA 4R0IA 3MU1A 3SOSA 1O2HA 1WXRA 1AI8H 1NO9H 3E1XB 3K65B 5AHGH 5HM2A 1SLXB 2J4IA 4UFGH 1LVYA 3QTVH 1UTNA 5EJ1A 3ATIA 2OQ5A 1C2JA 3OY6U 4ZHMU 1LHDH 2F91A 2QXJA 1AD8H 1NM6A 4NA9H 2VIOA 5EODA 1TWXB 2Y5HA 3MU5A 1LKAA 2VNTA 1S0RA 4XSKU 1A7SA 2TGTA 4ACBA 3DSGA 3UNQA 3M35A 2ZC9H 1PPFE 2A2QH 2ZTZA 2WPHS 3GDUA 4JYVH 1CT0E 3MYWA 3D49H 2HNTE 2EA3A 2NU2E 4Q7XA 1NRRH 2XYAA 4E06H 1WTHD 1PPZA 3KQ5A 3U28C 1GBJA 2ZHWH 1E37B 3CS0A 1Q31A 5CHAC 4NSVA 4B71A 2FS8A 3ATWA 1V2NT 1BJVA 3KN2A 1A0JA 1HLTH 4MNXA 4CRBA 3B9FH 3SZEA 2GZ8A 3T25A 3GS9A 5FAHA 1HJAB 3S9AA 4YOIA 1C5LH 6CHAB 2JH6D 3GCHC 5C0TA 1NT1A 3TJNA 1WTGH 1GI5A 1AKSA 1E36B 1NESE 1N6YA 2IJD1 1AFQB 4OS6A 3UQOA 2ZWLH 1FMGA 4AZ2B 4AFUA 1Y3XA 2QE7D 2TGPZ 3GCTG 1QR3E 1HBTH 1PPCE 1O3JA 2HPPH 3ENSB 5JDUB 1BBRE 1ACBE 1NS3A 1SGDE 1OYQA 3F3BA 3AVZA 2BB4A 3GISB 2M5TA 1Z1IA 4LZ4B 2FEQH 1ARCA 1YGCH 3SV9A 1A46H 2C4FH 4O3UA 2HVYB 1W3CA 4MNYA 5DP6A 4HGCA 5C3NA 1MZAA 3OAAD 3RUOA 2F9PA 1DANH 2BYAX 5TCAA 1MBMA 4B6FA 1E1QD 5HGGA 1SI5H 2ALVA 4NFEA 4Q7YA 3Q3XA 3E91A 5F8ZA 2ZPSA 5JB8S 3BTWE 2YNBA 4MPVA 4WMDA 4A92A 2QGRA 2ZQ2A 1ZSJA 1FZZA 3S7HB 6LPRA 1H8ED 5E0JA 4ABGA 1ZRKA 4CBOA 2ILNA 2VIDA 5BRRE 1Z7KA 4YLQH 1J8AA 1SPJA 2QXHA 2BQ6B 1KIGH 1UCYH 1MAXA 4GHQA 2RA3A 2HPQH 1GBAA 2BXTH 1HUTH 2FDAA 1P3CA 3O8CA 3VB3A 1S83A 3NXPA 3DFJA 1C2FA 2FOCA 2WINI 5DP3A 1ANBA 1THSH 1SHYA 1DXPA 4INKA 5HM9A 2Z7FE 1BOQA 2ODQA 3A86A 5H4IB 1B0FA 3TGJE 2P3TB 4JYTA 4B2BA 1GI6A 3WWFA 4I7YH 1YC0A 2F9OA 2G81E 2OC1A 3LGTA 1FN6A 2OD3B 1NU7B 4H4FA 5AFZH 4CHAC 3ESTA 5J4SA 2W6ID 1H9LB 3OU0A 2R0LA 1AWFH 1TE0A 3EDXB 3SHAH 1UTJA 5C1UA 1NRPH 5FL7D 1OS8A 1O3DA 4DURA 1LPZB 5I25A 1K22H 3U8RH 3Q77A 2XCFA 2PR3A 1ESAA 3UR9A 1QB9A 3IWMA 1BHXF 3E3TA 2J94A 3LC3A 4NIXA 1BTPA 2VWMA 3TJVA 3FZZA 3LJJA 1OWJA 3T5FH 2PW8H 3A7ZA 3GCHB 1J9CH 5GJ4B 1EAWA 1MKXH 1UVUH 4UFDH 4MTBA 3PLPA 1W0KD 3LH3A 1KXCA 1PJPA 3U69H 4HTCH 1FI8A 3FANA 1IQJA 2BHGA 2Z9IA 1O2QA 1BA8B 1E1RD 1G2LA 1ZPZA 2HNTF 1YPLH 1SL3A 1MTWA 3DFLA 3R0FA 5FXLA 2STAE 1HV7A 1XUGA 3TH2H 1ELAA 5SGAE 2B8OH 1D6RA 1HAOH 3RXRA 1AWHB 1Z6EA 1B7XB 4KTUA 3UNRA 1EX3A 2CXVA 5E2PA 1HYLA 1YP9A 1TGBA 1P2JA 1O3GA 1TGCA 1DWCH 3WY8A 4K1SA 1TONA 3SGAE 1TPPA 3ZVCA 2ODYB 1PQAA 1GWAA 4ESTE 1FY5A 1SGIB 3BV9B 1CE5A 1ZTJA 3BIUH 1O38A 1D3TB 1UVSH 2VH6A 1SQOA 2VH0A 3RXFA 3QTOH 1YM0A 3AAUA 4HG6A 4ISNA 4DOQA 4GPGA 3SZNA 1VITF 1VCWA 4JYUH 1S5SA 3SUFA 3FZDA 2PKAB 2BD8A 1SOTA 5T3HA 4A6LA 1Z8RA 1P2IA 3F2GA 1PYTC 2ZGCA 1HAGE 2XBXA 1UCYK 2CF9H 2A5AA 1BMNH 3RLYH 2XC5A 4ABBA 3E0PB 4MQAA 4O97A 2W7UA 1XMNB 3KQCA 4AYYB 1V2UT 4CR9A 1GMCF 1A2CH 4Z1MD 1C5NH 4D8NA 4GUXA
chains in the Genus database with same CATH topology
2OINA 1MZDA 5EW2H 3A87A 4CHAB 1BUIA 4BAQB 2VWLA 4I31A 3UREA 3ZVEA 1IHTH 1KXDA 3RU4T 2FYQA 4X6NA 3SNCA 1SR5C 6ESTA 3A88A 4B75A 1AVGH 4B2AA 1M9UA 1IQLA 3SW2B 1L1JA 5GCHF 1GI1A 3SN8A 3MHWU 7LPRA 2QF3A 1FPCH 4X2YA 1K21H 2V3HH 3SJOA 1L1NA 1DITH 2ZDAH 3QDZB 3U98H 2BDCA 1EZQA 2RDLA 1KDQA 4GAWA 2H9TH 1BIOA 1CA0C 1WOFA 1QCPA 4BTUB 1S81A 4ABJA 3HKIB 3QWCH 4CH2B 4X6PA 3EE0B 3MOCA 2FODA 1LMWB 3A7VA 2Z3CA 1SGRE 4U32A 4FUHA 3F1SB 1RTFB 1MKXK 1D3QB 3GYMA 1ESBA 2G51A 1DWDH 5TCCA 3NKKA 4DT7B 1EJMA 4Y6DA 3BTGE 4AFQA 4HI3A 1G37A 1S6FA 1SQTA 3SI3H 1IQGA 3A81A 4ABAA 3QZQA 3DA9B 1DE7H 3SV2H 4HFPB 2ZTYA 3LGUA 3MH5A 1IOEA 1QQ4A 1PQ7A 1XXFA 2BTCE 3C1KA 3DT0H 2V3OH 2WYGA 1DS2E 2PV9B 1TNIA 1MBQA 3ODDA 1MQ5A 1O30A 2GMTC 4AYVB 4LOYH 2W7SA 3ZVAA 1IHSH 2SGPE 3A82A 2D26C 1C2EA 1SGNE 2QF0A 3UOUA 3MNSA 4OS2A 3OY5U 2FI3E 4O3TA 2GCHG 2VIWA 3A84A 1K9OE 3HGNA 2FOHA 3OTJE 4YZUA 2OUAA 5A0AE 1O3HA 4WF8A 1ZGVA 3GY2A 3MO3A 1HJ8A 1WBGB 2C8YB 1BTZA 1SMFE 2FESH 3GDVA 3PYHA 4AGKA 2HLCA 2ULLA 1THPB 4DJZB 1AHTH 2H5DA 1EZXC 4AORA 4AOQA 4NGAH 1G32B 1GHVH 1PPHE 1HAVB 4VGCC 1F92A 1XKAC 1EKBB 1GMHF 1QURH 2PKAA 2D2DA 2ASUB 3U1JB 2FX6A 3A8DA 4K60A 1D3DB 4X1QU 1W2KH 1P8VC 4XBCA 1FY4A 4JK6A 1GI9B 2BZAA 3S69A 3M5LA 2H1UA 4DCDA 1O2MA 1O3CA 1ARBA 2THFB 5GXPA 1KXBA 1O3OA 3PWBA 4GVUA 3RU4D 1PPEE 3ATKA 2PWXA 1V2JT 3RXKA 2H9HA 2SFAA 5EXNA 1GL1A 2HGTH 1K1MA 1CA0B 1ZR0A 3BTFE 3SV8A 2WUCA 3PLKA 5L6NH 1ID5H 1SB1H 2BDHA 4FU9A 7KMEH 2GV6A 2BY5X 1RFNA 3TNSA 1GBMA 3T2NA 1XVOA 2AYWA 1T8NA 1UHBB 4IC6A 1Q2WA 2PUXB 2AMPA 1GMDG 1W12U 1KSNA 1U6QA 2A31A 4PROA 4BTIB 3GY3A 4IMQA 3RXGA 2WPLS 3MH4A 3M5NA 2FLRH 4X8UH 2P16A 1V2RT 4I32A 4I8HA 1UTQA 5LPEA 1OP8A 2FS9A 3SU5A 1WQVH 1NN6A 3RDZA 1S82A 3DHKH 3ZZDA 3A7WA 1O33A 1GHAF 5FX5A 1O34A 2B7DH 1V2TT 3RXAA 3U9AH 3VB6A 2Y80A 1K1NA 2BVSH 1XM1A 2TRMA 1F0SA 3RXDA 1JRSA 4JZIA 1W14U 1SGCA 4YO9A 1C4Y2 5JB9S 4BAKB 4JMYA 8GCHF 4A5TS 2QAAA 1AFQC 2Y81A 5T6DA 1ZPBA 3RXSA 3FFGA 2Q1JA 1MTUA 1O3FA 1YPKH 4UDWH 2ZFQH 3BN9A 1UVOA 4K1EA 5G4BA 1GJ8B 2NU4E 2VIPA 3TK6A 3UY9A 2SGAA 1C5RA 5HXFA 3QN7A 4VGCB 1P12E 1GI8B 4YT7H 2AERH 1ZOMA 1IQMA 1BBRK 5HMAA 2O8WA 1RJXB 2A7CA 2WPMS 3VXFH 1QBNA 4K69A 3S9BA 4TPYA 2XBVA 4LK4A 2C8ZB 5C1YA 3STJA 2VWNA 2VVUA 1C5YB 2ZECA 1O5DH 2AIQA 1L4DA 1NY22 2F9BH 1O35A 1L0ZA 1QB6A 1O39A 2GV7A 3ATLA 2ZFRH 2A0QB 3VEQB 3S9CA 1TA2A 2HWLB 2XWBI 1NPMA 4INHA 2G00A 5E2OA 1HAVA 1VCPA 4MNWA 2LNCA 1EJAA 2ZFFH 1NRNH 1CHOG 1C4U2 1GI4A 4X8VH 3UIRA 1TFXA 3OSYA 2P94A 3RMMH 3O8BA 3V7TA 1P2NA 1EUFA 3AAVA 1C5WB 1ZHRA 1ZTLA 2G52A 3TNTA 2ODPA 5C2ZA 4CRAA 1A0LA 3SGQE 3MWIU 4BANB 1OWKA 2HNTC 4ZKRU 3CP7A 2XC4A 2ZPQA 5EU8A 1Z1JA 1C5OH 2BX4A 1UVPA 1CA8B 1ZGIA 4IC5A 1O3EA 1F2SE 3UOPA 1LVOA 1TNGA 3M61U 1YPHC 2IJOB 4HZHA 1O2IA 1L2EA 2BY8X 3H5CB 1MTVA 1H9IE 2XWAA 4X6MA 1HXEH 4Z0KA 4Q7ZA 1NZQH 1UHBA 1MD7A 7GCHF 1HB0B 3A8CA 1RD3B 1GHWH 1BTHH 4Q2KA 4AFZA 1OWIA 2I6QA 1HDTH 1BTYA 2P95A 3GCTF 1FJSA 2TIOA 3V0XA 2HOBA 4NIVA 3IG6B 4ZUHA 2BD5A 1C2IA 5DPAA 1S84A 2P93A 2WPJS 1LVMA 2CGAA 4BAMB 4JZ1A 1Y5AT 4NZQA 2GX4A 1W10U 1BTXA 3RXIA 4FVBA 5DJ7A 1HAIH 3M7TA 1YCPK 2JKHA 1FAKH 4D9RA 4Q80A 1N6XA 1EXFA 1YPJH 2ZU5A 1NFUA 1XVMA 2WUBA 4TWWA 3MMGA 2XRCA 5A2MH 4XOJA 1T8OA 4IGDA 1BRCE 1DT2A 2A5KA 2BD3A 5J4QA 1AZZA 4FXGH 4CBNA 3I29A 3M37A 5C5OA 2FMJA 1HRTH 1K1OA 3SHCH 3VFEA 1O3PB 3BEUA 1GL0E 1OXGA 2B5TB 4BTTB 2P3FH 5A0BA 2FOGA 1HXFH 2FZZA 4J1YA 2GCTC 1O3MA 1IQEA 5AFYH 2ZGBH 4X6OA 1CQQA 1MTSA 1UTMA 1YLCA 2GT8A 2C93B 3KIDU 3SU1A 1V2QT 3PTNA 2GP9B 4U01A 1DWEH 2OC0A 2ZQ1A 1FV9A 1QA7A 1O5FH 1QB1A 1ZMJA 2NWNA 4ISIH 1TA6A 2FI5E 3I77A 5DGJA 1ZJDA 1XUKA 1GHBF 2ZU4A 1SQAA 4NWLA 3HK6B 1SVPA 1P11E 1P0SH 3DUXH 1HIAB 1L4ZA 1LDTT 4I8LA 1VJAU 4FUBA 1YBWA 1INCA 1G9IE 1ETRH 4BAOB 2H5CA 1G36A 1YCPM 1ZZZA 4FUEA 2ZEBA 1QBVH 1TIOA 1L1GA 1TAWA 2ZZUH 4D7GA 1F5KU 2ANMH 1TQ0B 4ASHA 3F9FA 3SU0A 5A0CA 1HAPH 1KDQB 4DW2U 3GDSA 1KTSB 3P17H 5DG6A 1KLTA 1MAYA 1C4V2 3Q3KA 5DP9A 1GI3A 5DP8A 5C20A 4UFEH 2BX3A 1WSSH 1O5EH 1ELCA 1F7ZA 1GI7B 1JBUH 1Z8IB 3EAJA 1C1TA 2GGVB 1T4VH 4KTCA 1JIMA 2ZFTA 1J16A 5EPNA 2OCVB 1HFDA 4OS4A 3PM3A 1DVAH 4FVDA 2JH5D 1J17T 4Y8XA 4ABDA 2ZDLA 4GCHF 3GY4A 3GOVB 1V2PT 1QGFA 2DUCA 5A8ZA 4RSPA 4WWYA 4UD9H 2LPRA 2P8OC 1P10A 2FIRH 2J2UA 1YPMH 1TRMA 2AGGX 4A1XA 1C5UA 4O03A 2ZU1A 4H42U 4AX9H 1H4WA 2PFEA 1C1WH 1Z8JB 3F9GA 2K1QA 1IQIA 2W3KA 1QQUA 1T7CA 1JIRA 1P9UA 1AMHA 2J34A 5PTPA 1S85A 1P02A 1DUEA 1YYY1 2GD4B 3NK8A 3AW1A 3RXOA 2GCTB 2O8TA 2ZFSA 1MU6B 4Y71A 4ISLA 1EB2A 1V2ST 4AG2A 5JBTA 3KQBA 1DM4B 1FN8A 1GBKA 1SLVB 4JZDH 1DSUA 5CMXH 1DOJA 1AU8A 2P3UB 1LHCH 5DP5A 4Y7BA 3RXUA 1Y3VA 3BEFB 3RXQA 5LGOA 3PROA 3N7OA 2CF8H 1GVKB 2O8LA 1QL9A 4NA8A 4A1TA 3ZYDA 1WYKA 2TGAA 3STIA 1P2KA 3QGNB 4BXSA 4O9VA 1HCGA 1DX5M 2R3YA 3FVFB 4WMFA 1IQKA 4FUIA 1W7GH 1GBDA 1VZQH 3HK3B 3RXEA 2D8WA 4Y0ZE 3PO1C 3W94A 1C1UH 5DO4H 3D23A 1BCUH 1OKXA 4UONA 4MG3A 4NA7A 1LHFH 3BTTE 1SBWA 3NWUA 1V3XA 2ZPRA 3MNCA 1TPOA 1PQ5A 1FNIA 1TBZH 1PQ8A 4KP0A 3VGCC 2BDIA 1BRBE 1GDNA 1GJBB 1MD8A 3RXMA 1ELDE 4NWKA 3T26A 3HPTB 1LQEA 1OPHB 3IITA 3QLPH 1DXWA 1HIAA 3EA9A 1GCDA 1Y3UA 1LHEH 1NFWA 5E0HA 1LTOA 1O2UA 2W3IA 5GPIB 1GBTA 2EI6A 1ANCA 2OLGA 1TGNA 3BSQA 4YOJA 2PLXA 1Y5UT 1ELEE 3M7QA 5AF9H 2BMGB 3L6PA 1K1JA 1P2OA 3ZV9A 1C5MD 2A32A 3NZIA 2ZU3A 3RU4E 2SNVA 4CRGA 2FXRA 3KF2A 4MPXA 4IBLH 2ZCHP 4ZXXH 4GHTA 3AW0A 3U8TH 3EGKH 1GMCG 3U1IB 2B9LA 3TGKE 4MDSA 4K5ZA 3SNBA 1UK3A 2ZNKH 1C1VH 2P8OB 1UTOA 4Y10E 1MTNB 1KYNA 2FYRA 4WMEA 1W11U 1G30B 1K2I1 1WAYB 2SGDE 1SSXA 1GHZA 1BRAA 1K28D 4IMZA 3RM0H 1DSTA 2IOTA 2JH0D 1GJAB 1PPBH 4IN1A 4H6SB 2OXSA 5GCHG 4ISHH 4YLUA 1TLDA 4YT6H 1QRXA 1ELTA 2BQ7B 4Y0YE 3I78A 4X2XA 1C2DA 5L2YH 3VXEH 1CT4E 3UPEA 1SHHB 1CGIE 2G4TA 3TIUA 1G3EA 5K7RA 4ISOA 1HAHH 1IQFA 2GZ9A 4Y8ZA 4YTAA 2J9NA 4TY7A 3BTDE 1P09A 2JETC 2OBOA 1QL8A 1XUHA 3GY7A 1E34B 3B8JA 5F6MA 5IYTA 3ZVGA 4Y8YA 4BNRA 3D65E 4YOGA 1O0DH 4ZH8A 3UFAA 1GJ7B 3T28A 1TOMH 2C8XB 4X1RU 3A7YA 1TGTA 1ELGA 1V2MT 3PO1B 1C5ZB 1NRQH 8KME2 1HAZB 1C1SA 3RXVA 1BBRH 1O5AB 3BTHE 1VITH 3PMAB 5T6FA 1F5LA 2UWLA 1HAXB 1Z6JH 3GY6A 3VGCB 5C1XA 1DWBH 1Y5BT 4AGJA 2QA9E 1TNHA 6GCHF 3RXTA 3K6YA 1DY9A 2BLVA 1EPTC 2W26A 2AFQB 1LHGH 4WVPE 4CR5A 3P8GA 2Z9KA 1EP6A 1OSSA 2FX4A 2FTLE 1IQHA 2OC8A 3SO3A 2R2WU 4OS1A 4ABEA 4D7FA 1A5GH 2FI4E 3SGBE 1PYTD 2FM2A 2ZIQH 1TPSA 4KKDA 3LGIA 1P9SA 1EOLA 1ETTH 3MO9A 3TH4H 1C9TA 4I8KA 1FIZA 2ZCKP 1FXYA 4FUDA 3SU2A 2Q6GA 2C8WB 3SUDA 1GHYH 3TPIZ 1GI0A 3GICB 1O32A 5FCRA 2PKSC 2CMYA 2VJ1A 1FLEE 3F9HA 1QHRB 1A5IA 4AB9A 3SU6A 1P01A 2NU3E 3M5MA 3LJOA 3T62A 2ZDVH 9LPRA 4D76A 3ZV8A 9ESTA 3LH1A 4WXVA 1O2JA 1AO5A 5FHTA 2F83A 5CE1A 3E8LA 1W13U 1GJDB 2BLOA 4KTSA 1GMHG 5A8XA 1EOJA 4ABIA 1AFEH 1CU1A 2R3UA 4TYDA 4X1NU 4DG4A 1QFKH 3MU4A 5EQQA 1A5HA 1RS0A 4X1SU 4K2YA 4U30A 1TB6H 2XCNA 1TBRH 1Y3WA 2ZDKA 3ZVBA 4YESB 4JZEH 2FOMB 1D9IA 5F8XA 1C1QA 3RXLA 5DP4A 3LIWA 2F9NA 2R9PA 1TGSZ 2FOFA 1RGQA 2KAIA 5LH8A 1GJCB 4D9QA 2NU1E 1WU1A 3UWIA 2SGFE 1FY3A 3ZVDA 3BTEE 4SGBE 1VCQA 3KL6A 1DICA 1QJ7B 2FLBH 3BG4C 3SNAA 4CRDA 3KHVA 1RRKA 1ABIH 2JETB 4ZAEA 1YCPH 2QXGA 3ZZCA 3V13A 1TOCB 4Y79A 3RXBA 1YPEH 1TNJA 3TH3H 1AUJA 4J2YB 4A1VA 3DD2H 1GGDC 1AZ8A 1FPHH 3F68H 5F8TA 3L33A 1X7AC 1P2MA 3M5OA 3F6UH 3G01A 3V3MA 2BD7A 4F4OC 1RTKA 1HJ9A 3FP6E 3A8AA 1SOZA 3H7TA 3A89A 1TMUH 1CHOF 1JOUB 3O8RA 2G5VA 1LCYA 1EPTB 2IPHA 2BVRH 2F9VA 1F0UA 3CENA 1GVZA 1WV7H 1F0TA 1XXDA 5EXLA 1DFPA 3RM2H 1C9PA 1C2HA 2V35A 3RMLH 1C1MA 1G3DA 2PSYA 3SJKA 2QCYA 2FOAA 2UUYA 1A4WH 3SUGA 4LZ1H 1ZSLA 2FP7B 5GDSH 2OQUA 2ZGJA 4U2WA 1AE8H 3A7XA 4ZHLU 3SNDA 3Q3YA 1O2XA 2PKSB 5JPMH 3V12A 1AY6H 1GJ6A 2BOHB 2WV4A 1EATA 1TALA 1DDJA 1UMAH 3LDXH 1IQNA 4FUGA 1BZXE 1RTLA 3SV6A 1GBBA 3K2UA 3CS7A 3OYPA 2ZFPH 2UWPA 3ODFA 4ZXYH 2VB0A 4JK5A 3FAOA 1P04A 3BTQE 3PB1E 1O2TA 2Z9JA 2GDDA 2H9EH 2Q6DA 1YKTA 1BT7A 3C27B 2BVXH 1RIWC 3UWJH 1O2SA 4B74A 1TNKA 2QXIA 1YF4A 3SU3A 1FQ3A 3KEEA 2EC9H 3RXJA 1JWTA 1NTPA 1AB9B 3D62A 1SLUB 2OC7A