2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
molecule tags Lectin
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
2B7YA 3M3OA 3Q9OA 1KQRA 3ZYRA 4DPNA 5T50A 4Y1VA 4KBBA 3WHUA 4XBNA 2WT1A 3VKOA 5HCBA 4FPEA 3NV3A 2D43A 3SH4A 1V6NA 2UU8A 2ZAAA 1AVBA 2ZZJA 1YO8A 1GNZA 1WLWA 3N7MA 3V65A 1Q8OA 2A6XA 2A7AA 1GZ9A 2GMMA 5CAZA 2VU9A 3U4XA 3RSJA 1W6OB 1UAIA 5JMCA 3BOPA 2A6ZA 1SBFA 4ATFA 1MS5A 5H9QA 2ZGPA 4ISQA 2R1DA 1VAMA 3POSA 1GV9A 2WKKA 3O0VA 3ZVXA 2D44A 3ILFA 3AXEA 1FX5A 2WSUA 2A3XA 3IN9A 2GMEA 5KXCA 5CB7A 5GZCA 4BPZA 1CJPA 4GALA 5KXBA 4Y1YA 1VALA 4WVWA 1LOFC 1G7YA 2LTNA 2JD4A 4NO4A 3B01A 3FLTA 5DZEA 2GNDA 5JOXA 3DUIA 5T5LA 2WT2A 3AZVA 4JC1A 3TAYA 5T5PA 2AREA 2A6VA 1RIRA 1Q8QA 4H55A 4UW4A 1V6JA 1Q56A 1S0EA 1WLDA 1AX1A 2VW0A 4GA9A 4AVTA 1Z0HA 3WDUA 4XTPA 3OJBA 5HCAA 1DYPA 3GALA 3LSEA 2ZMLA 2YZ4A 4FPHA 4XMAA 1MR5A 4PBPA 3NWKA 3CNAA 2CL2A 3WHTA 4Q1PA 1LOFA 2A71A 2EF6A 3WVJA 2OUHA 2ZGKA 1D2SA 4R9BA 2GALA 4LBLA 5T5JA 1FV2A 3SNMA 1W0PA 1C57A 1QGLA 5E8AA 4IQPA 3WDVA 1H9WA 2VW2A 5JOZA 2YV8A 1V6MA 1WW7A 3ZSLA 1LGCA 1HQWA 5JLVA 3L2YA 2DWRA 3AP6A 1LU2A 5GLUA 1JHNA 4XMIA 5H9PA 1IS6A 1PZ7A 2NYYA 5DUVA 1KDKA 1CONA 4XZPA 1ZM1A 2JECA 1QU0A 3IPVA 2R0HA 1G86A 4U36A 1A78A 2C5DA 3AZWA 1UKGA 4OZXA 2AENA 2FHRA 1DHKB 1N3PA 2UWCA 4M3CB 5GZFA 3W58A 2DURA 3A4UA 3R4UA 3ZXEA 4BMBA 2XG3A 1BZWA 1DQ6A 2A5ZA 4YLZA 5IK4A 2YMZA 4YM3A 1DBNA 1CPMA 1JBCA 3O12A 3POWA 5DXDA 1KJRA 1O4ZA 4Y24A 3V0BA 1IKPA 2NN8A 2JJ6A 1WCSA 5IK5A 1MVQA 1KRIA 1HLCA 3NV1A 4YZ2A 2P3IA 1SLAA 2XB6C 3N3HA 3WDTA 3ILRA 3N35A 1WUVA 1N1SA 1XQNA 1PZ9A 3IKWA 1AX2A 3AYAA 1AXKA 4PQ9A 5DUUA 1QOTA 5KXEA 2NZ9A 4Y22A 1UPSA 1J1TA 3SLIA 3R4SA 4GXLA 3FLRA 4ITCA 1DQ4A 4BLJA 2R0FA 2W39A 2YROA 5T55A 3AP5A 3NV4A 1CVNA 2CTVA 2D3SA 4PCRA 3OY8B 3AYCA 4WVVA 1SBEA 4YGBA 2EALA 1IS5A 3OBRA 4FPFA 1I1EA 4HL0A 3T1LA 4XJ9A 4YFZA 4YG0A 2AR6A 1LGBA 1ULCA 5SV8A 4XTMA 3KM5A 1D0HA 2GMPA 1W6OA 1QF3A 1R1ZA 3POYA 4YG3A 1V6IA 1Q8VA 2NMNA 3B69A 2P3KA 4U2AA 5LK5A 3JU9A 2PHTA 3JUUA 1WW5A 4YW1A 1DQ5A 4AGRA 3ZYPA 1FAYA 4Q8LA 4CTEA 4K1YA 4XXAA 3AZZA 3AZXA 1SACA 4FPLA 4Q2FA 3SITA 4DFSA 4ZKTB 5EXOA 2ZGUA 3INAA 2EXIA 2PHXA 3IM0A 4FVVA 3HR9A 2GNBA 2TEPA 1MZ5A 1CQ9A 2ZGOA 3A0KA 3GNEA 4Y22B 5EYYA 1MS9A 3T2TA 1CPNA 2ERFA 2D3PA 3ZSJA 1FNZA 1LECA 3FLPA 1Z78A 4Y1XA 4P9YA 5GLTA 1FNYA 1UMZA 2ZGMA 4YM0A 1QOSA 2ZGRA 2P34A 1QDCA 5T52A 2R16A 1QNYA 2ZGSA 1QNWA 3D5OA 2PHUA 3AP7A 3AX4A 1LENA 4Y1UA 1YRZA 1LHNA 1VIWB 2DU1A 1OQ1A 1LODA 2JKBA 2VY0A 3RQ0A 3DGTA 1C1FA 1AXYA 1FYUA 1GZCA 4FOQA 1ULEA 4LBKA 2DTWA 3MW4A 3WDXA 1LOEA 2P37A 2JDZA 4YW5A 3WCSA 3C2UA 3I8TA 4TZDA 5CNAA 3AP4A 5CBLA 4XJWA 3AJYA 3ENRA 5T5OA 1LESA 4M01A 4FPCA 2CY6A 2HYKA 3QCWA 1SCRA 1WBLA 2DVGA 2ZHMA 5DUXA 3UK9A 4LBQD 3WG3A 1GICA 3MW2A 4K20A 3TB0A 1QMJA 4CRQA 4M3CA 2FMDA 5GZEA 2A75A 3D6EA 3R05A 1GKBA 2A6WA 4FPYA 3USUB 2P2KA 2SLIA 1MS0A 2AH2A 2GNMA 4C1WA 1I3HA 3WDWA 1W6QA 5IK8A 3M2MA 2R49A 4ATEA 1MS1A 1W6NB 4BMEA 1V00A 5IT6A 4FPOB 1LHWA 2D6NA 1AJKA 4LBNA 4AVSA 3ILNA 4Q1RA 1F5FA 2D7FA 5EWSA 5H9RA 1G9DA 2A3YA 3M1HA 2GDFA 4ISRA 3T1MA 1A3KA 1SCSA 1B09A 3ATGA 1ZA4A 2WSVA 3KQRA 1WW4A 1RITA 3WLUA 1LU1A 3V0AA 3IMNA 3OGGA 1N3OA 3OY8A 1H9PA 1SFYA 4WZFA 1KITA 5GZDA 4PBOA 4M3CE 4PF5A 5GLZA 5GLWA 1RINA 3NV2A 1Y7BA 2ZHNA 3D4KA 1AZDA 1HDKA 2ZMNA 2D3RA 3UJQA 3UJOA 2E7TA 1WLCA 3PVNA 3N7LA 4K21A 2EAKA 5DUWA 1YIFA 4CZSA 1JYIA 4XHXA 2GN3A 1JYCA 3MEPA 1QDOA 2ARXA 3FBYA 2RHPA 3MW3A 1KJLA 4R9DA 4DRVA 2NM1A 4I30A 5CA6A 1W0OA 3H0OA 2WNEA 1W6QB 3WNXA 1IOAA 5IUQA 2JE7A 2ZHLA 1YI7A 2UWAA 5HCFA 3V64A 2WT0A 1KDMA 4DQAA 3OPZA 4NOTA 1BJQA 1ULFA 4FOWA 4GKYA 4GKXA 4Z8BA 2W08A 4Y26A 2I2SA 2OW4A 1GZWA 2GNTA 4YM1A 1YXWA 4M00A 3VKLA 1VLNA 5EYXA 3V0AB 4YW2A 3W59A 1MS4A 4R9AA 4FPJA 1GSLA 1LOBA 4M3CF 3N7JA 1BXHA 1WD3A 2DUOA 4RA0A 2Z42A 2D6KA 1G8WA 5GLVA 1DLLA 4GWNA 2E53A 5DG1A 2D6LX 3LSDA 4FOVA 1DQ0A 2AYHA 1JXNA 2VH9A 4XJAA 3ZXLA 3O0WA 1SLLA 2DVFA 5F5QA 5GJ6A 1LGNA 4XDQA 1G9AA 4UW5A 1WD4A 3AK0A 3WCRA 5H9SA 4Q8KA 5JDBA 4XHBA 1MS8A 3UL2A 4RL7A 3A0NA 1U0AA 1DQ2A 2ES3A 1C1LA 1S1AA 1CIWA 2PHFA 1V6OA 3WUDA 1UL9A 1MVEA 4W65A 4BOWA 1FATA 1UX6A 2EIGA 3RG0A 1CESA 1UN1A 2ZMKA 2DUPA 4DRRA 2JE9A 5AVAA 1NXD1 4Q26A 1GZWB 1AJOA 1S0CA 2ENRA 2OUJA 2ZABA 1LOAA 2E51A 1GLHA 3AJZA 3FUOA 3USUA 5GZGA 5E89A 2NMOA 2NP0A 2EXHA 2R1BA 1IS4A 1A8DA 3ZSKA 4FQ4A 1LEDA 2PHRA 4BM8A 1W6NA 1W6PA 2A6YA 3WZ1A 3VKNA 2DV9A 3PJQA 5FRAA 2H0BA 1C4RA 2A3WA 4YG6A 4BQ1A 1MZ6A 4UW6A 4YGEA 5F9TA 3VUOA 4YZ5A 2CNAA 4D69A 1SLTA 1N1TA 4R9CA 4LBQA 2VUAA 1ENSA 2DVBA 1GANA 1SLIA 1LHVA 4AGGA 1H30A 4FP2A 3SISA 5GALA 1F9KA 3BTAA 1JUIA 3VV1A 3B9CA 2ARBA 3AYEA 4FOYA 1CN1A 3LCPA 4XXPA 5JOYA 2C9AA 3AZYA 5JOWA 2OVUA 1CR7A 2DTYA 4K1ZA 4XYXA 4LBMA 1LTEA 3AP9A 4FPGA 4P9WA 4XBQA 1VAVA 3OYWB 5KXDA 1ENRA 1G9BA 1S0IA 4LBJA 1LHUA 1AXZA 3M3CA 1LHOA 3ZXKA 4JRAA 3ASIA 1V6KA 3M3EA 3PVEA 3B3QE 2KM2A 1W6PB 4AVVA 1SLBA 1YYNA 1LOGA 3QLQA 4XJZA 4Y20A 2YXSA 1DIWA 2WLQA 4Y1ZA 4FQZA 3WDYA 4YZ4A 1S0GA 2V5YA 1GBGA 4LBQB 4FP3A 1QKQA 3AYDA 1S0JA 4Q27A 2ZGQA 3WG2A 3I4IA 2PHWA 2ZA9A 4XJUA 1JW6A 1MS3A 1UZYA 2CWMA 1UZZA 2ZBJA 2DVAA 3ZXFA 3WOGA 1JOJA 2ZGLA 1V6LA 4P14A 5FREA 4YM2A 5DZFA 2AGSA 2AUYA 2EXKA 5BYNA 3AXDA 3HMYA 2ZGTA 3VKMA 1DGLA 1G9FA 1SLCA 1LJ7A 3FUQA 1ONAA 1S0FA 4SLIA 1QOOA 2A70A 1EPWA 1N1YA 2CYFA 1X50A 4TYSA 4C1XA 1IS3A 2D6PA 2ZGNA 3PMEA 4P9XA 5GM0A 1SBDA 2DUQA 1F31A 1G9CA 1ULGA 1DQ1A 2E6VA 4XJ8A 1ENQA 4Y20B 4DS0A 4ASMB 3SH5A 3O0XA 2LALA 4YW4A 1DZQA 4F83A 1IKQA 4XE9A 4BLIA 1OFSA 2UURA 2ZACA 4AGVA 3RMYA 5DZGA 3WG1A 3APBA 3N36A 1GYKA 3OBTA 1BQPA 3PVOA 2D6OX 4MYEA 3N7KA 3BODA 3M3QA 4YFWA 3WG4A 2WQZC 1URXA 5JVVA 1W6MA 5IK7A 3WV6A 2W68A 1WBFA 2ZHKA 1LEMA 4L8QA 4YGCA 3ZXJA 1BYHA 1S0DA 2V73A 1JN2P 1N47A 1TEIA 3RMXA 1MACA 2VW1A 1AF9A 2WJSA 4AYUA 1S0BA 4GWMA 4XIKA 2P3JA 1ULDA 1PZ8A 2ZKNA 1HKDA 1Q8PA 2DYCA 3ZPYA 1O4YA 3FFZA 4LBOA 2D6MA 2G4IA 1DYKA 1LCLA 3IPVB 1N1VA 4YZ3A 3ZSMA 1HQLA 2PELA 1AX0A 1FV3A 2DU0A 2EXJA 3AFKA 4JCKA 1N3QA 3SH3A 4XILA 2BQPA 4ZXKA 4FPKA 1WW6A 1BKZA 1DFQA 4WV8A 4YW3A 2VXRA 1GNHA 2SBAA 3VKFC 2CWSA 4HANA 4UW3A 2GN7A 2UWBA 3MPPG 3OYWA 3WUCA 3B00A 4AWDA 4XIOA 1OKQA 4YZ1A 1NLSA 5DG2A 1W6MB 2W52A 2E7QA 5T54A 3V0BB 2DVDA 3O5SA 3RRDA 5E88A 4XOGA 4YGDA 3BIWE 1APNA 1LULA 2YY1A 3HN1A 5L73A 1LOCA 4XBLA 1Q8SA 2Q5TA 3RS6A
chains in the Genus database with same CATH superfamily
4LO6B 4N7IA 2C24A 1PIV3 4FFIA 3WHUA 4CUAA 1OFNA 3VKOA 3G7DA 4FPEA 4OULA 3O7OA 1MZEA 3NKTA 3PIJA 3I3QA 1GUIA 3BYWA 4QGLA 5FZLA 5ABJA 5LA9A 4OUEA 1O8PA 4N53A 1J83A 3K48A 4LHNA 3VZMA 4DUWA 5F1RA 3BVCA 3MIDA 3ES4A 4AZZA 2XMLA 5JMCA 3HNYM 3BOPA 4RD7A 4JVAA 1RUG2 5L7OA 1Y4WA 2ZGPA 2DCZA 1GV9A 1NA1B 2WKKA 5KWRA 4BIFA 3ILFA 5F5IA 3AXEA 3W5MA 3CMGA 2YPDA 1YI9A 1ZBE2 3UGGA 1C8NA 4QM9A 2YUEA 4MOAA 1CZVA 1W3VA 3MIGA 5CB7A 4E2SA 4KWUA 2HKXA 1CJPA 1M4WA 1ZX5A 2W87A 4GALA 2WQ8A 5AC93 5FYYA 1H1IA 1W2OA 1LOFC 5B4XA 4HXCA 4Q4X2 1G7YA 5CFDB 4DUVA 2GNDA 2VNOA 2YU1A 2WT2A 3AKPA 2QKDA 4JC1A 4P08A 5IVBA 3WQ7A 2A6VA 4PLNA 4AFMA 1AR61 1E5RA 5CZKA 4Q0VA 3GYDA 4BCUA 3VZLA 1WLDA 5EV7A 1ZZ9A 4ZHNA 1QIQA 3VDDB 5FZOA 2ZMLA 1C8M3 1RYYA 2YZ4A 3ACFA 1MR5A 1VBA3 1WCKA 4JX0A 4XMAA 3TN92 3CNAA 1LR5A 2Q1ZB 1LOFA 1ND3C 5JR2A 1LAJA 2E32A 4W6YA 4OUSA 5K4LA 5L19A 3WNOA 2ZGKA 4ES9A 3A23A 1AYM2 2GALA 1QJEA 1EUUA 4LBLA 4QU1A 1FV2A 2K46A 3VD7A 4HT1T 4Q4V3 3UETA 4QPGA 2VW2A 5JOZA 2YV8A 1CD3G 4DXRA 1HQWA 1JZ4A 3MPBA 3RPQA 1TME3 2DWRA 1OA4A 1ASJ3 1FOD1 1UOFA 3GJBA 1JHNA 1RL3A 5H9PA 4R8HA 1UZ0A 1UU5A 1KDKA 2PAKA 2NYYA 4XZPA 5DUVA 1VBD2 1ND3A 2QE3A 4XFFA 2MNGA 5FY5A 1A78A 3AZWA 4QHZA 4BA6A 3MIBA 1UKGA 2WINB 1R64A 5FAXA 1BBT1 2Y60A 1ULPA 4QDSA 4S2FA 2RVAA 5FKCA 1POV3 4CEWB 1N3PA 2UWCA 4M3CB 5GZFA 2IXLA 3A4UA 4HZFA 5K0UA 3ZXEA 1H8TB 2XG3A 4QU2A 1BZWA 5KHHA 5C9AC 5DMYA 2IWGB 1DQ6A 1DZRA 2B45X 1DBNA 4NHYA 2AEYA 3OGRA 4B8EA 1KJRA 2XONA 4GULA 3V0BA 1IKPA 1GP4A 1YNAA 3AMMA 4Q4Y1 2JJ6A 1CJDA 1PHMA 3HN3A 4YVSC 4C90A 5IK5A 2W91A 3NV1A 2C4XA 1L3JA 1U5YA 3ZPOA 4ET7A 2WNUB 3N35A 4I0BA 4TXWA 3VBOB 5LEJA 3WF2A 4B1MA 3D3AA 5CKNA 4W8JA 3POIA 4E4HA 3EB7A 1UOBA 1CAUA 1NY72 5C9AA 5LZ6A 2B9UA 3ALQA 2VTFA 3PLQA 3FLRA 4GXLA 1CGPA 2DCYA 2YB7A 4IEVA 1BMV2 3WW4A 4GWJA 2R071 3AYCA 4ZZ8A 4WVVA 2WS92 4YGBA 4YVSA 4E9KA 1IS5A 4LUMA 1V70A 3OBRA 1I1EA 4HL0A 5BNPC 4LPLA 2Y6GA 2G9ZA 3LPGA 4YG0A 4JGZB 5SV8A 3W5NA 5HCHA 4HPKB 1PVC3 1Z7S2 3DYPA 1D0HA 1W8WA 4MV2A 4A7KA 4I0AA 1QF3A 4YVWC 3P3NA 3POYA 2B9VA 1V6IA 5E1RA 3B69A 1XE8A 3PMSA 2BZDA 5FYTA 5LK5A 4AAXA 3EBRA 1RUE1 3H7YA 5FK7A 3S57A 4YW1A 2GSYA 2XLAA 3AFGA 3J9SA 3POEA 2PAMA 4XXAA 3I2KA 4Q2FA 1XU1A 3I59A 2B46X 1VPHA 5EXOA 2PHXA 1CZSA 5C8CB 2TEPA 1X7NA 1XE0A 1CQ9A 1VB4A 4XQ4A 4YVWA 2QUOA 3ZX7A 2I07B 3GNEA 3Q8EA 4Y22B 3VBUC 1CPNA 1VBB2 3H42B 1Z78A 2BNOA 4X6RB 3DCQA 3RZJA 2E9QA 4IEQA 2ZZQA 3U78A 1FNYA 2VMFA 3UKVA 1UMZA 2PXJA 2ZGMA 3ORJA 4R4XA 4F8AA 4QB1A 1OD5A 2ZGRA 2OPWA 1QDCA 2HBTA 1QNWA 2V09A 2PLV2 3D5OA 2PHUA 3AP7A 4Y1UA 1W8UA 3VBUA 1LODA 2VY0A 4XPVA 1C1FA 1AXYA 4IDZA 1GZCA 4IE0A 4JDOA 1W9SA 5JXIA 2QFEA 4LBKA 3KWVA 1JI6A 2DTWA 3GF6A 1X82A 5FZHA 5F3IA 3WDXA 3IAQA 4YW5A 3GZAA 2WAAA 3C2UA 3O1TA 1QXPA 2FCVA 2IVIB 2DFBA 2VULA 3AJYA 4YWAA 3RI9A 4XF4A 3K77A 3URFA 1IPSA 4K6BA 2YU2A 3THCA 1WBLA 2DVGA 2J1UA 4E4DX 4NVPA 4AEDB 3BTZA 1FPN3 4MXVA 1R093 3CJXA 2HWE2 5A3LA 4JDNA 2FMDA 5GZEA 1MEC2 2A75A 2J42A 3R05A 2A6WA 1YFYA 4FPYA 2ARAA 1PMHX 2ADDA 2PHDA 1W6NB 1VRH1 4OZOA 3TNPB 5FUNA 5FDBA 4AI9A 3JZVA 3ILNA 1REFA 2D7FA 2EIEA 5LY2A 3MLLA 4IEPA 5H9RA 3WNLA 4ISRA 3M1HA 1G9DA 2B39A 3WP4A 4LA3A 4NIIA 5IW0A 5FZ7A 1B09A 2JENA 1ZA4A 1RITA 3WLUA 5L9BA 2RMU1 4QQLA 1XRUA 3AMPA 3OGGA 5IFPA 1N3OA 1UY1A 1H9PA 3OY8A 2VAUA 4I3PA 5FZ6A 1KITA 2UYAA 1B35A 4PF5A 5EPAA 3GJAA 5GLWA 3HVDA 5GLZA 3BUCA 4IEWA 3FHQA 2ZTNA 2D3RA 4NJ4A 3UJQA 4K9SA 1GOGA 4CDXC 2JG9A 1SFPA 5D21A 5CISA 3FBYA 4LO5B 3MW3A 1KJLA 4BDVB 4P9JA 4JQTA 3H0OA 3ES1A 5CFCC 2WNEA 2W1UA 1ZRFA 4KQ7A 4XFBA 1C5IA 2JDPA 2JE7A 4LULA 4R4ZA 4XDOA 2KD7A 1AR62 3V64A 2WT0A 2PYTA 1UZVA 4BK4A 3ZN6A 4CDXA 3HEIA 2JIJA 5JZGC 1BJQA 3SKJE 3N9PA 4E4ZA 1UYZA 3LIHA 2RDRA 2WUHA 1GZWA 4YM1A 1YXWA 1IHMA 1QH6A 3DKWA 3VKLA 1YC61 4YW2A 3OBAA 5CFCA 1QQP3 4CDUB 1LOBA 1POV0 2RJKA 2WO2A 3N7JA 4A42A 3VBFB 2VPVA 4CCLA 3OD4A 4COUA 1IQDC 1FI2A 2NLRA 2VCCA 3NNLA 5FY4A 1I9RA 4BXFA 3OBZA 3E6BA 4Q5OA 4AEJA 4YPJA 1XB9A 1YQ8A 4GWNA 2E53A 4CP1A 2IFWA 2QQNA 3S7EA 5FO8B 2WNOA 4UFIA 5DAWA 4D6SA 5JZGA 1HXS1 3POJA 1DQ0A 2AYHA 4XAAA 1FOD2 4XJAA 3WNMA 4DXTA 1ST8A 3O0WA 1D0GA 1UXZA 4LLFA 5IVCA 3LOBA 2JX9A 2VQ0A 2W0XA 4CA9A 5A32B 3WCRA 1WD4A 1WCUA 4XHBA 1MS8A 2Y0IA 2YPJA 3OUJA 4L99A 5FWJA 1BBT2 1U0AA 3KF3A 2ES3A 2RS31 4LKFA 1RUD3 1WCDJ 2UYBA 4NAOA 4RHV1 5FZAA 4EQVA 3ST7A 5FPZA 2RS11 3RG0A 3L9JT 2BOJA 2OX0A 4B29A 2WFPA 2FDFA 4Q26A 2ZEWA 1US2A 2RDNA 1S0CA 1E5HA 4Q4Y2 2JWPA 4ZS3A 1QJX3 3MFCA 3USUA 1RUJ1 2NP0A 5JMOA 2BV4A 1W06A 1W8NA 3KLSA 1JZ2A 4MGYE 5FYBA 4S2HA 2Y8KA 3OG2A 2HWB1 2PHRA 4MHRA 5A3UA 1R083 3J8F3 2A6YA 5FUPA 5JSPA 5AVPA 3H1YA 1C4RA 4YG6A 4KI5M 4IEZA 1QJFA 1PIV1 2R072 4YGEA 3LFMA 1H2LA 5FPAA 1DDLA 3THTA 1PGW1 4KWKA 5FJKA 1Q5OA 1N1TA 5DAQA 1XNTA 2DF7A 3Q8CA 4CXXA 1ENSA 3MHZA 1SLIA 4L2NA 4AGGA 5CG8A 5FYMA 4DB5A 4CCOA 1H30A 4CYDA 5GALA 3BTAA 3W9AA 3EXUA 4CPBA 3B9CA 3AYEA 1K5MC 4OHWA 4Q29A 4TWTA 5JOWA 3HD8B 2OVUA 3TYJA 1CR7A 1RUE2 5FMCA 3NJYA 5EP9A 3RNSA 4BQWA 4MZUA 4PIZA 4UFKA 5A7WA 4KNCA 3T0BA 4QKDA 3SEEA 4PI0A 4FPGA 4ZPIA 5HPOA 4XBQA 4CPBD 2OA2A 1G9BA 4AOCA 1WMEA 2VQUA 5CVRA 1LHUA 4N8MA 3VZOA 1JU3A 2KR2A 3GGLA 3ZXKA 3E6DA 3HWJA 2WA3A 3FX3A 4QQHA 1F2NA 3B3QE 3PVEA 5FV3A 1K5MA 1RUI2 3T4HB 1O7FA 2BJSA 4HSJA 3WSOA 3K3NA 5AC91 5I0RA 2R7EB 4JKMA 2J7MA 1LOGA 5FZMA 3NNGA 2YXSA 4QX8A 5A7SA 3B93A 2JDKA 4JDMA 2LRPA 4NE9A 5ISLA 4KL1A 2V5YA 5C6CA 5BNOB 1S0JA 4Q27A 4HVRA 2KXLA 1C8M1 2WIIB 2PHWA 5FUIA 2WC2A 1VBA1 1JW6A 2ZA9A 1UZYA 4K3UA 4XJUA 5JSRA 1X36A 1YQCA 1RUF3 2ZCWA 5L9VA 2ZGLA 4Z92B 4P14A 1C5HA 2QQOA 3VZJA 3E6CC 5FZDA 2AUYA 1XNDA 4Q4V1 5FR3A 3QH6A 5ANQA 3ZFFC 1D2QA 1S0FA 5J48A 1YLLA 4UF0B 1QOOA 1TME1 1OA3A 1ASJ1 4WM8A 3K75B 3CU7A 3PHMA 3PMEA 4IEYA 3UGFA 4RQPB 2W47A 4QPIA 4DS0A 2G1MA 3WF4A 4ASMB 2B5HA 5A3TA 3I3DA 1HRI3 5FMOL 1DZQA 4MADA 4MXWA 5ERLA 4AVCA 1POV1 2ATFA 4C0BA 3ZFFA 1ZZ7A 2W95A 2Y6LA 2XXZA 3H8RA 1T6BX 1UF2C 1VRH2 3CJIB 1AR83 3M3QA 3TEZA 4IERA 2VMDA 5FMOS 5FZIA 2JG8B 3WW2A 1NQJA 4NHLA 4C8DA 1W03A 4BE3A 4AL9A 1VMFA 4CCJA 2WWJA 3ZSEA 2OIIA 1XPWA 2PMWB 3T09A 1PK6B 3RMXA 2PAEA 2RMU2 2VW1A 5IAVA 1JODA 1KGYA 1S0BA 2FCUA 3ETPA 3HBZA 1BVVA 1ULDA 1PZ8A 1SDWA 5FZ0A 5A1AA 1LRHA 3KS7A 1JUHA 2GH2A 1NA1C 3HJRA 4LBOA 3BALA 3C3VA 3KV4A 3MLKA 2JDNA 3PUHA 1NCRB 1YUDA 1HQLA 4GJYA 4X6QB 5J98B 3OEAA 1FV3A 2EXJA 3JQXA 2F4LA 1PVC1 5FCCA 3LPFA 4ZXKA 2VMCA 3LAGA 3BOWA 1DFQA 4G4FA 4YW3A 1X8MA 5CFDC 2WL1A 1W05A 4I02A 1GNHA 4UOJA 5T3NA 4EJRA 4UW3A 5FZFA 2GN7A 2RJLA 3WUCA 3B00A 3I3MA 1NA1A 5FTTC 4A45A 3JQWA 3PU3A 4BYYA 2DDUA 5T54A 2C9KA 3C7GA 5A1FA 2CGPA 2DVDA 4UFHA 1QWRA 3VDDC 1PMJX 5M0TA 5E88A 4LIVA 4YGDA 5FZ3A 1APNA 2EA7A 3HN1A 1Y9QA 5L73A 2C0ZA 5CYYA 4XBLA 3S6PA 4BU2A 3RS6A 1FMD3 2VQTA 3TEWA 3Q9OA 1OHFA 1PX4A 3FFQA 1H8VA 4L9BA 5T50A 4IESA 4XBNA 4Y4YA 4Z07A 2EAAA 3NV3A 1ACCA 2D43A 3R0RA 5JR7B 4AQSA 2J1VA 2XL7A 5F5CA 1WA6X 1ZZ8A 4QB6A 1HXS2 5JXHA 4G9SB 2A6XA 1SFNA 4CCNA 4Z82A 1YWKA 4H7LA 2WFF3 5CAZA 2VU9A 3U4XA 2F17A 4Q0PA 4OMDA 3POGA 2VMEA 5F32A 4B3NA 1W6OB 1UAIA 4ATFA 4Y5TA 3U10A 1MS5A 4XQWA 3AMNA 4CEWC 4RHV2 2P4EA 2RS32 3HNMA 3ZVXA 3FL7A 1RUC3 1UU6A 2VZ3A 4LK7A 1H8TC 1UW8A 1FX5A 2RS12 5KXCA 3PUSA 3IN9A 5F2SA 4KG0A 2ETEA 3LOIA 5GZCA 4BPZA 3IIAA 4N7UA 5AFBA 5KXBA 1OKOA 3ZR6A 1VALA 1RGSA 1K5JA 3ACLA 4BHPA 4NO4A 1FPN1 1HB2A 1R091 3BKZA 3GBFA 1EYBA 5JOXA 2WRAA 2WABA 3DUIA 2WNUC 5T5LA 1JYNA 4XURA 1RUJ2 5T5PA 2AREA 4CEWA 2CGNA 2NPIA 1US3A 2XJUA 5FQ0B 3VBOC 2VMIA 3C8XA 4UW4A 4AAPA 2VW0A 1NUKA 1AX1A 1H8TA 2HWB2 1PNGA 4IUGA 4MHUA 1Z0HA 5FKBA 4LTAA 2FD8A 1L7RA 4XTPA 3OJBA 1NY71 4FTSA 4IW3A 4Y3OA 3LSEA 3N9OA 1CAWA 3AKSA 4PBPA 4W6WA 3NWKA 1PIV2 4AF9A 4XFCA 2VZPA 2A71A 2IUWA 5FPVA 1PGW2 3RYRA 1D2SA 1BEV3 3ACHA 3NNFA 5T5JA 3ZFEB 1H4HA 1RC6A 4JGZC 5C71A 3ZKYA 3SNMA 4WM7B 1UPIA 1W0PA 5JXJA 3WDVA 4CVUA 5F7UA 1XNAA 1EUTA 2VUDA 3UNPA 3E5XA 4QXBA 1HJGA 2RE9A 1QJY3 4S2GA 3H8OA 2R30A 5GLUA 4XMIA 3KT1A 5DAVA 1PGSA 2JECA 1QU0A 3IDAA 3IPVA 3WQBA 2R0HA 1G86A 4QXCA 2C5DA 5C3PA 2BVBA 3A22A 1I6XA 4OHXA 1VRBA 4JGZA 4OZXA 5F39A 4HPKA 4D94A 4EROA 2VZSA 1OXCA 1DHKB 2BU9A 2VR4A 3K4AA 4FT8A 5C8CC 3MV01 4CP9B 3R4UA 4OHVA 1S2KA 1J3QA 2BYVE 1HQNA 3LZZA 4PQQA 5AC92 1U5XA 5IK4A 2XWBB 1JBCA 1CPMA 3BPSA 4FO9A 3VGIA 4EWDA 4CDQC 5C5TA 2NN8A 1ZNPA 4OI1A 4O9GA 1WCSA 3RGBA 1MVQA 1D4VB 3GDBA 3RDIA 3SXWA 3NNJA 4HN1A 2P3IA 2XB6C 2YC4A 4QGMA 3R6SA 4ZZ5A 3WDTA 3IKWA 5DUUA 4CCCA 5C8CA 1QOTA 1QEXA 1C8M2 1VBA2 4Y22A 2PLV1 2XL9A 4CU7A 5TSWA 1J1TA 1NE6A 1RVF3 4KG8A 3SLIA 4ITCA 4QX1A 4BLJA 1QQP1 2YROA 1CVNA 2D3SA 3HBKA 5FP3A 3VZKA 4PCRA 4RS5B 4CDQA 4LUKA 5J7MA 1AHSA 1SBEA 1SPPB 4Q4V2 4OMCA 4J1XA 4YFZA 1W8TA 2AR6A 1LGBA 1TME2 2QQUA 2WZ8A 1ASJ2 3H8UA 3I7DA 4XF3A 4DXZA 3B02A 1ND2A 2PFWA 4D7SA 1Q8VA 4AEDC 2Z69A 4GH4B 2J1EA 5FK8A 2P3KA 3I97A 1ZZCA 1E5IA 1NXMA 4PDWB 1UXXX 3JU9A 5CU1A 3CO2A 4P5YA 4EZHA 2E31A 2A73B 1F15A 4RR3A 3ZYPA 5FO7B 3USSA 1RUD1 1QJU3 4BZ4A 4FAHA 5A3PA 2VBPA 5F6KA 5C3OA 4ZKTB 3O1PA 5HV4A 3AKQA 3NRUA 3INAA 2EXIA 4IGPA 5FP7A 1IQAA 3N4MA 3M8LA 3H3ZA 3WD5A 1MZ5A 3OD0A 3U07A 4UFLA 4E2GA 1MS9A 4Y1XA 3FMGA 3E5QA 1TNFA 3SCFA 1QJX1 5CKMA 1F4HA 2XJRA 1OD3A 2CSGA 1ODNA 2VCBA 5I91A 2ZEYA 1CAVB 4HG6B 3SKVA 5BNQA 3GCXA 4NMIA 4NPLA 3JBG3 4XAEA 5K8SA 1JS9A 5T52A 4D7YA 3VBSA 1R081 3J8F1 3H9AA 1RJ7A 5DABA 3TWIA 4M0NA 3OSDA 4AI0A 1LENA 1T6GC 2AZ5A 2VNVA 3MLJA 5FYSA 4PIXA 1OQ1A 5LCWL 3VL8A 1FYUA 4A4AA 1ULEA 3E97A 2ORZA 2XBO3 1JH5A 4XW3A 1HJFA 2XKOA 2YBKA 3ABZA 3MW4A 4GIQA 2QQJA 2O8OA 4HKWA 3I3EA 1PVC2 3K51A 3UT0A 3B5LB 3THPA 2DBNA 2WN2A 3ZXDA 2OZ6A 4DINB 4DZGA 1T2XA 3ENRA 1LESA 1DGWX 4M01A 1BK0A 3SC7X 2HYKA 4NIAA 4CU9A 2BGCA 3D82A 4PF1A 5DUXA 5LBEA 3UK9A 3ZIWA 4PT6A 1U5ZA 2XJPA 1XSRA 1YQ6A 4AI8A 5FXZA 1GICA 1O6UA 1W28A 2PQQA 3TNQA 3ETQA 1HN0A 4QD2A 4AHXA 4IL7A 4N9IA 3D6EA 3ZYHA 4B7EA 1G6NA 2X5IB 2P2KA 3O1OA 2SLIA 5CIRA 1MS0A 1KS4A 2AH2A 2Z2SB 3U37A 5JI7A 1TE1B 4CDUC 4FAGA 3VBFC 3OTFA 4ATEA 4NHKA 4GAZA 1J3RA 1V00A 2LUWA 4BMEA 1AJKA 2PQSA 3H50A 4P9IA 4LBNA 5DN2A 4AVSA 1L7QA 1NQDA 3JD73 4RFT0 5FLHA 3PL0A 1F4AA 1XC6A 1A3KA 4WVMB 2R32A 1H1MA 4LO8A 1WW4A 3KT4A 3IMNA 4CDUA 1AR93 4WZFA 2VOWA 3QH7A 1RUF1 5GZDA 4M3CE 2VCMA 3VDBA 1AL23 1UU4A 2P5BA 2ZHNA 1ZRRA 4JZRA 4KWLA 5LA2A 1PX3A 1WLCA 4XUPA 3N7LA 2QCSB 2EAKA 3FN9A 2RM23 3J7MA 2VUCA 3MO4A 4KU7A 4FFFA 1UIJA 3LGRA 4GMP3 4DUXA 5JIUA 1EY2A 5CA6A 2EIDA 1Y9MA 1PO23 3WNXA 1W6QB 1FPN2 5A32A 1R092 5I0DA 1OI6A 5LBFA 4MGZE 4QX0A 1GOFA 1RB8G 3NAPB 4LITA 5IUQA 4XF1A 3H7JA 1YI7A 2UWAA 2YFUA 4ZS2A 1H6XA 5I8SA 3WY6A 1HRI1 5IWFA 5A7PA 4EN8B 2HWC3 3D0JA 4N43B 4CXWA 1UIKA 1VBE3 1IPKA 3EO6A 1VBC3 4IV1B 1YFWA 3VD4A 4JHZA 4Z8BA 1O5LA 1CX4A 4M00A 5EYXA 3V0AB 2VVDA 1AR81 3CZUA 1MS4A 2E63A 4BQXA 3U14A 1GSLA 1W9FA 3JXSA 3AM2A 1UX7A 2DUOA 4RA0A 3UV9A 2E7AA 4QPYA 4HKLA 2D6KA 5GLVA 4P9LA 1RJ8A 2H6BA 1HB1A 5A33A 1QJZA 3I2DA 3K3OA 2TBVA 5FJHA 3VBHB 1PGL1 1JXNA 5IVJA 1GZTA 3ZXLA 3I49A 4JV4A 2DCTA 3FHIB 2ADEA 4CDWB 2XUEA 5GJ6A 2F6BA 4A3XA 3POFA 3AK0A 3T0DA 1K3IA 1TQ5A 2BP6A 3RWNA 5I8TA 4S2DA 5BNPA 2J1SA 3EYPA 1DQ2A 1UL9A 1MVEA 2WQ4A 2X09A 3IBMA 3LE0A 4W65A 4Y33A 4FTBA 3I2FA 1BLZA 3V56A 3KV9A 1RUI1 2DUPA 3RZZA 1DLCA 3ZOIA 5EJZB 1OUXA 1U5IA 4QDRA 2ENRA 1X9PA 1LOAA 2GC3A 2E51A 1GLHA 1NG0A 2Q30A 3FUOA 5LRRA 5BNOC 4QXKA 2NMOA 5GZGA 4LKSA 1S4CA 4W6XA 2O1QA 2R063 3ZDVA 5J96B 3LDBA 4HN0A 4QM8A 1STMA 1IS4A 1A8DA 2R1BA 4WBBA 3ZKUA 3GZEA 1LEDA 2WZPP 2K2SA 5A3WA 2Q8DA 2DV9A 2QQMA 2QQVA 1QQP2 3PJQA 4KGQA 3NNMA 1YJKA 2WZR3 4OI4A 4OLLA 5A7QA 4BQ1A 3WF0A 4TLFA 1OT5A 4UW6A 5F9TA 3VUOA 1OOPB 3T2QA 2CNAA 1RXFA 2IC1A 3VKNA 2B4KA 4YZ5A 3LDRA 4UFMA 1F35A 4AVBA 4DOUA 4MGIE 5LBBA 5C8WA 1W2AX 2DVBA 2ZEZA 1D4M3 5L36A 1LHVA 2FQPA 3SISA 3VDCA 1F9KA 4EYUA 1JUIA 2RR13 1WKYA 2WFF1 3WQ0A 1CN1A 3LCPA 2RDSA 3KSCA 3P3PA 3WW3A 1W90A 2UY9A 4MUVA 4RQPC 3WR0A 2DTYA 5BNNB 4XYXA 2MEV3 3VHPA 4URAA 2GAUA 1VB2A 4COVA 1RUD2 1ENRA 3VBRB 1RUC1 4AI2A 1S0IA 3ZO0B 1SDDB 1LHOA 1K45A 4JRAA 4W4ZA 3BCWA 3RWKX 3M3EA 3CJIC 3DKQA 2PA7A 4LHLA 4V2VA 1YIPA 3WEZA 1X33A 1NLQA 4Z1VA 1SLBA 2JG8C 4IV3B 4XJZA 5DDJ3 5FPBA 1QJX2 3O1VA 3P1IA 3LDKA 4BJ0A 3SCGA 1DZTA 3NKGA 4LHSA 4H14A 4YZ4A 2JICA 3B94A 4NROA 1PK6C 1R082 3DXTA 3J8F2 1NCQC 3AYDA 4AI3A 2ZGQA 3I2GA 3I4IA 4DNYA 2ZBJA 3F95A 2XJTA 3WOGA 2JG8A 3RZMA 3H1MA 4B4RA 1BEV1 1NCRC 4YM2A 5DZFA 2AGSA 3SHRA 2BDRA 1OC1A 2RS53 3AKTA 3RJRA 1J84A 3AXDA 2ZGTA 1DGLA 1HV0A 1PK6A 2AACA 3PUIA 4D6RA 3FUQA 5L7OB 1NCQA 2W3JA 5FMDA 5FXXA 2VNGA 1EPWA 1QJY1 4UT5A 5IVYA 5LRSA 1AR73 4TYSA 3S5QA 1IS3A 2ZGNA 3KQ4B 4P9XA 2GH8A 5GM0A 3I2JA 1UO9A 4O7XA 4OQ9A 2JB8A 4QXHA 1ULGA 4K8RB 1DQ1A 2E6VA 4Y20B 1ENQA 1NCRA 3C7OA 5IATA 5EQUA 5J09A 1TVGA 5KC6A 2D40A 4QAWA 4AHWA 4F83A 1XBFA 4UAPA 5I93A 1OFSA 1AL0G 2UURA 1W99A 4MGSA 3N36A 3OBTA 3N9LA 2G19A 3AKRA 1JOBA 3NQHA 3WG4A 4HK8A 5FZOB 2FZ2A 1URXA 2X05A 4GMP0 4HONA 4KMQA 1WBFA 1GNYA 2WLPA 2ZHKA 5DAXA 5FP8A 1UYPA 3ZXJA 1UYYA 2VTXJ 1DCSA 1JN2P 5ACA3 1J1LA 1OH4A 3DEMA 2F4PA 1HB4A 1RVF1 2RDQA 4QPGB 4XIKA 1RUF2 1XU2A 5CEHA 2VJXA 1E57A 1Q8PA 3H3LA 4D7TA 3N9MA 1OUSA 3MIHA 1O4YA 2YGMA 3LB9A 3ROUA 2WA4A 2Y38A 4JGYB 2DU0A 2JDHA 3SH3A 1EV13 2BQPA 1XYPA 1S2BA 1GWLA 4G3YC 5K0UB 4P02B 2OS2A 3VKFC 2CWSA 4HANA 4DEVA 4DXSA 2WWUA 2XJVA 4J25A 5HI0A 3OYWA 4RN5A 5FZBA 1WLTA 4DY3A 4XIOA 1HRI2 1UY4A 4YZ1A 1NLSA 1DG6A 3O1UA 2GP5A 1GQPA 2ZX0A 3V0BB 3RRDA 2OQ6A 5FZ8A 4XOGA 5IVFA 4ORFA 1O3RA 1NLRA 1AR82 2C26A 3IMMA 4BQYA 3LF7A 1HRV3 2QBXA 3ZYRA 1W9TA 2W5FA 4KBBA 3ZFEC 5HCBA 2XR4A 2HWD3 2MPFA 4WM7C 1XSQA 2WWSA 3LQCA 1J58A 2AC1A 4HSLA 4DO0A 1V6NA 5FBZA 2ZAAA 1AVBA 4Q4W3 5C4WB 3N7MA 1GNZA 3JBG1 2B8MA 2WO7A 2DCJA 3LEKA 3V65A 1P8JA 1Q8OA 1PGL2 2P3YA 2A7AA 3MF6A 4XABA 4YYOA 2WAOA 4AHZA 1UMHA 2VQAA 1SZBA 1EPZA 3WX5A 1O3SA 3RSJA 1OH3A 2ZAHA 5JUVA 4MLOA 3ZFEA 1SBFA 3OPWA 2XBO1 2V72A 2FZ1A 2VCAA 1DGRA 3POSA 4ISQA 1R1A3 1YFXA 2VZ1A 2JEMA 3HOBA 1BVP1 3WQ1A 3POBA 5EFUA 2A3XA 4EWEA 2GMEA 4Z2WA 4FFHA 1TNRA 5B2GB 4FBFA 1H0BA 3U11A 2C1FA 1O8SA 2Z79A 5A6QA 4WVWA 3X29B 4AEMA 5LY1A 1SG3A 2D5FA 4HLTA 4RYDA 3TAYA 3AZVA 3PJYA 4H7MA 2FDJA 1RIRA 1Q8QA 4H55A 4CP9A 2WZEA 1Q56A 1S0EA 2VBDA 3OUIA 4AVTA 2ZEXA 4BQ3A 1DGWA 4IGQA 1FMD2 5HCAA 1DYOA 1W04A 4GB33 5F37A 2WNVB 4FPHA 2VC9A 4YNIA 3BB6A 2CL2A 3NJXA 4RS5C 4Q1PA 1HB3A 5EZWA 2EF6A 3WVJA 4QHBA 2QQIA 2VOKA 4LOSA 4URTA 4P5HA 3LFIA 3A7QA 3JD71 4CCKA 3KF5A 4RGKA 2QNKA 4MSVA 2PHLA 1C57A 4AFBA 1H9WA 1V6MA 1WW7A 2WFF2 1LGCA 3ZSLA 4N9HA 5JLVA 4GH4C 2JDUA 3L2YA 3TRSB 2E33A 3AP6A 1AR91 1LU2A 1WGPA 4PDWC 5FY1A 2Z4FA 1IS6A 4RS5A 1CONA 2GC0A 1AL21 2Q1MA 2XLGA 3D0SA 2FDGA 1SPPA 4RGGA 2FDIA 4W50A 5C33A 1RUC2 1ZRCA 2RM21 3BU7A 3MIFA 3PUAA 3ZDSA 2FHRA 4COWA 4GMP1 2LM3A 2VG9A 3W58A 4BMBA 1IPJA 2DURA 3MUZ1 3IDCB 4CU6A 4GH4A 4NN0A 4X8NA 1OPOA 2YGLA 3T2PA 4YLZA 1PO21 4PDWA 2XPJA 1W8FA 2EVXA 4YM3A 2CU5A 3POWA 4AFDA 1QH7A 4GWIA 1O4ZA 2CV6A 2VVEA 1ENXA 4LIUA 2XQRA 5FYHA 1HLCA 4YZ2A 2VMGA 4AFCA 2HWC1 2R043 4FI9A 3ILRA 4PQ9A 1WUVA 1UKRA 1AX2A 1VBE1 2VXJA 2TNFA 1VBC1 3AYAA 4LJHA 3VHNA 5FO9B 5L9RA 2NZ9A 5D8AB 4TN7A 1ZVFA 4A41A 2G9FA 2XVGA 3THDA 5KHGA 2WR9A 1UPSA 1DQ4A 2PTMA 4YW7A 5T55A 1BEV2 2VOXA 3HT1A 3OY8B 1KFXL 2EALA 1B35B 2FDKA 1AYN3 3MZHA 4FPFA 3T1LA 1MZFA 4JTOA 1TMF3 1ULCA 1SEFA 4MX3A 1QJY2 3KM5A 1GU3A 2GU9A 5F3GA 4AQ2A 2JG9B 3PU8A 5EIYB 5IFTA 3ZYBA 5LW9A 3O1SA 5FLIA 2VUJA 1ZBA3 1ZZBA 1Y43B 1WW5A 1SQ4A 4R52A 1VP6A 4AGRA 3T4VA 4JHTA 4LR4A 2X5IC 4Q8LA 4CTEA 4CU8A 4K1YA 3AZXA 1SACA 3KV6A 4FPLA 2ZGUA 5KHKA 4FVVA 4IETA 3HR9A 3VHOA 5HV0A 5CFDA 2GNBA 4MGTA 2XVKA 2ZGOA 3A0KA 3KVAA 1V9U3 3VDAA 4XCAA 2ERFA 5FZ1A 3ZSJA 5FYUA 2ZX1A 3FLPA 2VL4A 2PN5A 5ANNA 3NSTA 5A80A 1XYNA 4O9EA 3WNKA 3AL5A 1ZRIA 2X5IA 4PHZA 4YM0A 2R061 3VDDA 1QOSA 2P34A 4RGAA 3WINE 2R16A 5FBJA 1RVF2 2ZGSA 4HOOA 3C7HA 4ES8A 1W9WA 5J3UA 4LHKA 5F3CA 4GQ7A 1VJ2A 1YRZA 1LHNA 1VIWB 4MGQA 3RQ0A 3DGTA 4FOQA 4Y5Z0 2LS6A 2Q8OA 1D4M1 1CAXB 4WVMA 3BU0A 3VZNA 3I8TA 4GD4A 2RR11 5HXVA 3AP4A 5CBLA 2W2IA 1NX9A 2W92A 3KB5A 4XJWA 4FPCA 5LBCA 4EE2A 3NAPC 3KGLA 5FLJA 1SCRA 2MEV1 3AB0A 2NQYA 1C3HA 3QBQA 4LBQD 5A70A 3WF1A 1F8VA 2ZX4A 4QX5A 3TB0A 2YFZA 2Q1FA 1O5UA 3MW2A 4LMFA 4N43C 1QJU2 4M3CA 4EZ4A 3B9IA 4IV1C 4RFRB 1GKBA 1S55A 3W20A 3USUB 1KS5A 3LWCA 2D5HA 4C1WA 2GNMA 4NWWA 1I3HA 2HEVF 3KV5A 1W6QA 3H8XA 4FSJA 3EQEA 5IK8A 2R49A 4O61A 1UOJA 1MS1A 3NAPA 2VVFA 5DDJ1 4EN9B 1JZ8A 4FPOB 1RHI3 2D6NA 4EN7B 2WNUA 1F5FA 3VBOA 5EWSA 4N43A 3JBG2 2A3YA 3VBHC 4L92A 4IV1A 4CCMA 1SCSA 4V2WA 1TZOA 3VHRA 2WSVA 1LU1A 4CCEA 5LWBA 4CDWC 3IDBB 4E4SA 3V0AA 1CWPA 4OI2A 5C3SA 3L2HA 4WVZA 5FY0A 2P17A 2XBO2 4KBZA 4ARXA 1JTZX 1RINA 4NAMA 2Y34A 5CKQA 3UESA 5SV5A 3D4KA 1AZDA 3Q8AA 1HDKA 2ZMNA 1W3XA 4V1PA 2E7TA 2EIBA 3KCCA 1KRIA 4CUBA 3PUQA 2W1SA 4FTEA 3VBHA 1JYIA 1NAEA 1JYCA 1QDOA 2ET7A 2RJ2A 3S5AA 2K9ZA 2RHPA 4Q0UA 5F5AA 4R9DA 2NM1A 1OA2A 4I30A 1AR71 3FJSA 5FZ4A 2QVSB 3RFRA 3SMHA 2J1TA 4ZU5A 4LA2A 4CDWA 5F2WA 2O14A 4PI2A 3O1RA 1PNFA 1WWYA 1IOAA 2ZKLA 4YARA 4NPMA 2ZHLA 2ZX3A 5E16A 5A3OA 4CSWA 1ULOA 4CE8A 1XE7A 2VECA 3HT2A 3OPTA 2GC1A 1NT0A 1Q3EA 4DQAA 5HXMA 4KWJA 1UY2A 1ULFA 4GKYA 5C70A 4NIHA 1NKGA 4Y26A 1J59A 2QJVA 2OW4A 2QQWA 1GOHA 3CBNA 1OOPC 4QX3A 4ZU7A 1VLNA 3ZYIB 3W59A 4PLMA 2VGDA 1RUH3 2BGOA 3HQRA 3U0ZA 4M3CF 3U75A 2JIGA 2TUNA 3PDQA 3JD72 1BXHA 1WD3A 4TSVA 1OF4A 5F6LB 5C5UA 5IAXA 3JB4C 1ZZ6A 1DLLA 4WZCA 3KHBA 5DG1A 2VO5A 5ACA1 2D6LX 4IE6A 1AR92 5BY5A 3IB3A 5BNNC 2DVFA 1AL22 5F5QA 4QX7A 4WM8B 5LEKA 1LGNA 5FOJB 1G9AA 3ZN5A 1UCXA 2FCTA 4LO7A 1S2EA 3CL1A 2VZOA 3VBRC 2D98A 1COV3 2RM22 2GP3A 3UL2A 1W2TA 1C1LA 1PO13 2PHFA 5A1LA 4QPIB 1W8HA 1H1AA 1V6OA 4FCAA 2LW8A 4XEZA 4BOWA 1EV11 4HETA 4MXWB 4XUQA 1PO22 4AXOA 1CESA 4IV3C 4AEDA 2ZMKA 4IE5A 3CQOA 2V4AA 2JE9A 3ZFFB 5BNNA 1ZRDA 3PTYA 2JDYA 4BQ5A 4EWAA 4MH0E 1UMIA 1AJOA 2OUJA 3TEXA 2ZABA 4LOTA 2XKPA 3VBRA 4QB2A 2HWC2 4A7YA 5E89A 4NHXA 1JMUB 1VBE2 3GBGA 4IEUA 1VBC2 2HJIA 1MQTB 2V4VA 1EAH3 3H3UA 2BFUL 4BM8A 3GHNA 1W6NA 1RMU3 4XF9A 3MICA 4IV3A 4UYBA 3WP6A 4KU8A 1HRV1 2A3WA 5KBFA 2A1XA 2ZX2A 4HVOA 1MZ6A 2GC2A 2HWD1 1PMIA 2JDAA 1O4TA 4D69A 2J1RA 2CHHA 1SLTA 2BERA 1O91A 2BFUS 2O8QA 4HBNA 4Q4W1 5L7OC 2VUAA 5F3EA 3DPRB 4MG2A 2OPKA 4FP2A 4KGGA 4XQDA 2QZ3A 1NYWA 1IG0A 3MF9A 1JZ3A 2ARBA 4QPWA 4XXPA 5A7NA 2C9AA 2Y0OA 4D6QA 1ZREA 2BPA2 5APAA 2CAVA 3AP9A 2OXBA 5I0TA 4IE4A 2RV9A 5IYYA 2DFCA 1R1A1 3VB9A 1OLME 4OI0A 3AMQA 1NOVA 3W21A 2OQ7A 4LLOA 4IEOA 3M3CA 1VMJA 1V6KA 4MO3M 2KM2A 2BEOA 3HAGA 4A44A 1W6PB 4YRDA 3WNNA 4Y20A 1ODMA 5JPNB 4Y1ZA 3NMBA 1YCIA 3J26N 4FQZA 3RYKA 1YEWA 4E2QA 5KHJA 4I2OA 3G6JB 2R062 1C28A 1S0GA 4AHYA 2BGPA 2HWF3 2MHFA 2WO3A 3IZOA 4QMAA 1GBGA 3IWZA 3OGVA 4LBQB 3CF6E 2ILMA 4QPGC 4DEQA 4GB31 2WZR2 2BUKA 4XZUG 2CWMA 1SMVA 3VD9A 3VBFA 4AE2A 2JDMA 3GZUC 1RXGA 1JOJA 4EN6B 1K12A 4JGYC 1D4M2 2EXKA 5BYNA 5FFOC 5FZ9A 2ET1A 3HMYA 3ZFGB 1RUNA 3M4FA 2QDNA 2RR12 4QKNA 5FMBA 5CG9A 1ONAA 2IXCA 4O65A 4SLIA 5CADA 5K0UC 2A70A 2XOMA 1N1YA 5I8YA 4LEJA 1RTVA 1X50A 5LB6A 2P1BA 2MEV2 4OUMA 4C1XA 2OZJA 3NJVA 1O3TA 4PIYA 2DUQA 1F31A 2J1AA 2XH6A 3WP5A 1G9CA 3BI3A 2WYSA 2WN3A 4JGYA 1XYOA 3SH5A 3O0XA 3PTRB 5DPNA 3ECQA 2LALA 3UGHA 4HVQA 5J37A 4QHOA 1IKQA 4XE9A 4BLIA 2ZACA 3UKTA 5DZGA 3WG1A 3APBA 1GYKA 4GZ9A 2BNNA 4OYUA 4AR2A 1BQPA 2VZQA 5DDJ2 3PVOA 2D6OX 1OURA 4BQ4A 3N7KA 2WQZC 4LNVA 4B4PA 1IGOA 1CAWB 4J6GA 4CEYB 2XUMA 2X29A 5JVVA 3WV6A 2P6CA 2W68A 3I54A 4D3WA 2VM9A 1LEMA 2V5DA 3EHKA 2R041 5A3NA 4F3JA 5C4WC 1DP0A 4L8QA 4YGCA 1O3QA 2XQXA 1BYHA 2V73A 1N47A 4K7JA 1OMIA 2Q8CA 3RJ2X 4AQ6A 1MACA 1AF9A 1BCXA 2WJSA 3ZYJB 2P3JA 3KZ4C 1UY0A 1OPMA 4QQPA 3U4SA 3RZKA 4AVAA 1CIYA 1HKDA 2XJSA 5JIAA 5JCTA 2DYCA 3ZPYA 3AC0A 2RS52 3QOPA 5IVVA 5C4WA 1AYN1 3IPVB 4YZ3A 1RUG3 3ZSMA 1TMF1 1AX0A 2JXAA 4LQRA 3AFKA 4I0WB 4JCKA 1JZ6A 1N3QA 1AR72 1ZBE3 4FPKA 2BWAA 4OFGA 2QTWB 4QDQA 3ACGA 1ZBA1 3NL1A 5LK7B 3MPPG 5HBAA 4PJYA 4Q4X3 1A6CA 5DG2A 4XVHA 1W6MB 2W52A 4OHYA 3PNAA 1XNKA 3O5SA 4META 1W2NA 2WNVC 5BUVA 3GCWA 1FMD1 1LULA 2JE8A 2YY1A 1LOCA 4LXLA 2Q5TA 1V9U1 2B7YA 3M3OA 4NIGA 1KQRA 4NPRA 5FZEA 2Y6KA 4DPNA 3TN93 4Y1VA 4I3GA 2WT1A 4P00B 3PVBB 4Q0SA 5BNOA 4XFAA 3SH4A 2UU8A 1AYM3 4CDQB 5ACA2 2ZZJA 1YO8A 1WLWA 2VZUA 2WDBA 4INDA 4QKBA 3WF3A 4B7KA 1JYWA 1HN1A 3DECA 2WNVA 3ITQA 4NHMA 1GQGA 4DMIA 2Z5WA 3RZHA 2YBSA 1YHFA 1GZ9A 2GMMA 3R4DB 5G05L 1ND2B 5IHRA 4IEXA 1CZTA 2O0OA 1JYVA 2A6ZA 5A7OA 1VBD3 4ZY9A 2DCKA 5H9QA 5EJ3A 3S7IA 2R1DA 1OF3A 1VAMA 4CP0A 5C3QA 3O0VA 4ZU4A 1H2NA 2D44A 2D93A 4UF0A 2CGOA 4LORA 1EV12 4SBVA 2WSUA 4RR3B 5FYVA 2XHKA 1XNCA 3IT8A 4RQPA 1JYTA 1JHJA 2WYFA 3H1WA 4GJZA 3BTYA 4Y1YA 1LB2A 5LA0A 1OQEA 1W8OA 2LTNA 5DZEA 2JD4A 3B01A 3CHXA 3FLTA 4XUNA 1MPXA 4QGNA 3EJKA 2G9GA 2ZS6B 1V6JA 1Y9GA 4UI9L 5D8AC 2XDVA 4GA9A 1Q8SA 4QX2A 1K42A 3WDUA 1IG3A 3M7AA 3LA3A 3CJIA 1DYPA 1UY3A 1D7PM 3GALA 1GWMA 3LEGA 1HRV2 4H3WA 5ABJB 3J4UH 4N53B 2AEZA 4KH9A 3VBSB 3WHTA 4B4QA 3FWEA 2BNMA 3DYOA 1RHI1 2HWD2 2VOTA 5IJRA 1B35C 3HQXA 3UYJA 2OUHA 4R9BA 4BXSV 2L9LA 4Q4W2 4K40A 2QQPA 2WS93 5E8AA 1QGLA 3ZR5A 4IQPA 4ONUA 4Y5SA 5D8AA 4AQTA 2JG9C 3BGAA 1XXNA 2VBBA 1V0AA 5K9YA 1Z7S3 2ZPXA 4NRPA 5LATA 4BB3A 3HIFA 1PZ7A 4HMZA 1ZM1A 3JB8A 4ZONA 4ARYA 5KC5A 4U36A 1R1A2 4NRMA 1AUYA 1J3PA 2ORXA 1VE0A 5JAXA 2AENA 3T30A 3MYXA 3SQOA 2HLEA 2XLFA 5EHDA 3ZIXA 2A5ZA 4QKFA 1BHGA 1L7LA 5BV6A 2BBAA 2YMZA 3KVBA 1JZ7A 3O12A 5E6HA 4AG4A 2YHJA 2Y64A 5DXDA 1ZYBA 4Y24A 4OQ8A 5FZCA 2QQKA 1VBB3 2YDEA 2ID4A 4AFAA 2FDHA 4DY5A 2IFRA 3C7EA 3LD8A 3N3HA 1SLAA 1QXRA 3ON7A 5FPXA 1N1SA 1XQNA 1PZ9A 4JTNA 1AXKA 4GB32 1JYXA 5KXEA 1DF0A 2YYOA 1UOGA 3R4SA 4QQ2A 2PLV3 1RUH1 2X10A 1GP5A 2R0FA 2W39A 3AL6A 3BPZA 3K4DA 3AP5A 3NV4A 2CTVA 5FWEA 1ND3B 4UBGA 2YC2A 4L11A 3WXPA 4ASKA 5FZKA 3OEBA 1QXJA 1DGRN 2J22A 4XJ9A 2H6CA 2IVJA 5I0UA 4XTMA 1E5SA 2Q0AA 1JU4A 1W6OA 2GMPA 1R1ZA 2IXJA 1HX6A 4YG3A 2NMNA 1O59A 3T3YA 4U2AA 3ZMNA 5BPXA 3KD4A 5JXGA 2BW8A 2PHTA 3JUUA 3ZXAC 2VZRA 1COV1 1WA4A 3GM8A 1NZCA 5F8PA 1CAXA 4D8MA 3BIEA 5FY8A 1DQ5A 1QJU1 2Y33A 1FAYA 3PIGA 3Q8BA 1PO11 2HWE3 3QACA 2Y26A 3AZZA 4DFSA 5FXVA 3SITA 1MEC3 4AEKA 3DXUA 2HBUA 3IM0A 2CAUA 5C7GA 5FPUA 2H0VA 3F2ZA 3LIGA 1CAUB 2D97A 1BK1A 4UXAA 5EYYA 3GBWA 3CEWA 3T2TA 5C9AB 2D3PA 5FQ0A 2K0GA 1FNZA 1LECA 4AI1A 4P9YA 3TOJA 2HYXA 2JKXA 2R042 3T2OA 1OLQA 1GP6A 1PM7A 3DYMA 4FXGB 5GLTA 3J7NA 4YVSB 1EAH1 5J1XA 1YQ2A 1RMU1 2I45A 1QNYA 3I2OA 5A33B 2XVLA 3AX4A 4DIQA 4TLGA 2DU1A 2BRTA 2JKBA 3OUHA 4NWVA 1UQXA 4WM7A 1W9YA 1AYN2 1TMF2 3NJZA 3OCPA 2VD7A 5I0SA 1LOEA 1W8ZA 2JDZA 2P37A 3WCSA 4CP2A 2OKXA 1GMMA 5BNPB 5CNAA 4TZDA 3MDPA 3I59B 3LKJA 1ALYA 4COZA 5T5OA 4JQRA 4AW7A 4EN0A 1ZBA2 5GKAC 2CY6A 4OCTA 3QCWA 4FFGA 4YVWB 4YW6A 2ZHMA 1XJAA 3U1XA 3WG3A 3PURA 5JI9A 4K20A 5A6XA 1QMJA 2CDOA 4CRQA 3WT3A 3RYPA 2BWCA 1AR63 2X53S 4J1WA 5A6YA 3T08A 1VR3A 1V9U2 3WDWA 3M3IA 3M2MA 1HW5A 3J7HA 3LEIA 4Z2AA 3NW4A 3OGSA 4BISA 1LHWA 5IT6A 2R6QA 2WO1A 4CUGA 3VBUB 4Q1RA 2QZ2A 1UZWA 2HWF1 1F5JA 4L97A 4ZXEA 2IZWA 3VLBB 2GDFA 1W39A 3T1MA 4A6OA 3AVRA 1UYXA 1X8EA 3ATGA 3KQRA 3J7LA 2JD9A 5B4NA 4WM8C 1FOD3 3SEPA 1SFYA 3CDZB 4IXLA 4PBOA 1WZXA 1UD1A 2JB4A 2W94A 4IE7A 2QQLA 3IIIA 3NV2A 1Y7BA 4K8FA 4M0HA 3ZYFA 5JWPA 1U12A 1I5ZA 4QPIC 3UJOA 3VL9A 2Y6HA 3PVNA 4K21A 2E26A 2VTXA 4X8PA 4XUOA 5DUWA 5FXWA 1YIFA 4CZSA 2BBVA 4E8CA 4XHXA 1BBT3 2GN3A 3MEPA 2ARXA 4CUCA 2YBPA 2BTVC 4DRVA 3D8CA 3BTXA 1W0OA 1WCQA 1KD7A 3O1MA 2N7GA 1JZ5A 4N90A 1M06G 3RVHA 3N9NA 3SCHA 5K7PA 2Q4SA 1XNBA 1HIXA 2W1WA 4Q4Y3 3B7MA 3CLPA 4LO4B 1MQTC 5HCFA 1KDMA 3ZN4A 2ARCA 3OPZA 1PM4A 2Y6JA 4NOTA 2W1QA 1KXGA 4FOWA 4GKXA 3C7FA 4YSFA 2W08A 4Q0QA 2I2SA 5LA1A 2X8KA 2GNTA 1RHI2 5KR7A 4M4RA 4FPJA 4R9AA 2HH9A 2VNRA 1CAVA 2R073 4A3ZA 3DPRC 2Z42A 5G04L 1G8WA 4C91A 1H4GA 3ME2A 1MQTA 3MUY1 1OBNA 3ACIA 5FY7A 5FYIA 5FZGA 2P6HA 5A3MA 2GZWA 3LSDA 4FOVA 1W0NA 2IXKA 5EJ1B 1A34A 2VH9A 4B1LA 2IXIA 1SLLA 3FE5A 1NCQB 1GR3A 2HEYF 1DU3D 1VAKA 2FBEA 1RUE3 3I3BA 3NO8A 4XDQA 4BQ2A 4TTGA 4UW5A 2KA3A 4NR1A 5H9SA 4HKOA 3QD6A 4D0QA 1UWWA 4Q8KA 1QY4A 2C6SA 2IXHA 1RUG1 3DPRA 4P9GA 3A0NA 4RL7A 5JDBA 1S1AA 1CIWA 4XCBA 2LROA 4XUTA 2WBKA 4A6SA 2OYZA 3WUDA 4CCDA 3Q8FA 1POQA 3ZN6B 1FATA 1ZBE1 3I2HA 1UX6A 2EIGA 4CDXB 3OOXA 1UN1A 1TG7A 1OSGA 4DRRA 5AVAA 3MGUA 1NXD1 3HQUA 3N9QA 1RUI3 3KCXA 4JKKA 1GZWB 4Q4X1 5CFCB 1LNSA 1YFUA 3CKHA 3AJZA 4NUBA 4OVEA 4XDPA 1PVXA 2VOVA 5IVEA 2YC0A 2EXHA 3MBWA 3ZSKA 1CX1A 4FQ4A 4LKDA 1OLMA 4F7ZA 3OB8A 1W6PA 1OVSA 2WZR1 3WZ1A 5JZGB 5FRAA 1RUH2 2H0BA 4E8DA 5FYZA 5FY9A 3TN91 3UKNA 5D1IA 1I5PA 3DN7A 2RG4A 3ZFGC 3ZXGA 1KFUL 1IZ3A 1ZA7A 4R9CA 1AYM1 1H6YA 3GZTB 4LBQA 1GANA 5A6ZA 1HV1A 1WMDA 1FT9A 3VV1A 2B42B 3ZLIA 1YJLA 4FOYA 4AK3A 4HFSA 3S0MA 5JOYA 5LASA 2XGXA 3AZYA 4RSUA 3ZYGA 4M4PA 1REEA 3HNBM 2DBIA 5DQ0A 4K1ZA 1X9TA 1COV2 4LBMA 3RI8A 1LTEA 1VBD1 5D2AA 1KEXA 4P9WA 3ZFGA 3DF0A 1PO12 1VAVA 3OYWB 1Q43A 4XC9A 5FOBB 2XJQA 2CDPA 2EICA 4UFJA 3WNPA 5KXDA 3M70A 5JSOA 1REDA 4LBJA 1AXZA 3LA2A 4C0HA 3ASIA 1XOYA 4LE4A 4XFHA 4UBHA 4JAAA 4CEYC 5FPLA 4COYA 4AVVA 1YYNA 1YQ5A 3FBMA 3QLQA 4NRQA 4XETA 2BVVA 1VRH3 4A2UA 1DIWA 2WLQA 3K4ZA 1H2MA 4XFIA 3FZ3A 3JCIA 3WDYA 4PLOA 5C3RA 5JPMB 1EAH2 5DAPA 1EP0A 4LT5A 4FXKB 2Y6FA 1RMU2 4FP3A 1QKQA 2OT7A 3WG2A 3TBDA 4XF0A 2UY8A 1MS3A 2RMU3 1UZZA 3AMHA 4CEYA 1GQHA 2DVAA 4I09A 4L0PA 3T0AA 5FP4A 3ZXFA 4EV0A 3IDEA 3MIEA 1WMFA 1V6LA 2VMHA 4HK9A 5FREA 2VZVA 1BMV1 2RS51 4BIOA 3E1F1 3P6BA 3KCYA 3A21A 5A7WB 3ZM8A 2WS91 4BH9A 3I2IA 3VKMA 4IGOA 4NIDA 1G9FA 1SLCA 1LJ7A 3P5BA 3GXUA 2XWJB 1GWKA 1Z7S1 4QQOA 1RUOA 2CYFA 2QDRA 1LKNA 3CIHA 2D6PA 1K5MB 2HEWF 1SBDA 1JOPA 3LA7A 4XJ8A 4LK6A 4MVTA 4ASLA 1WMXA 1UNBA 3K2OA 3IAPA 3OF1A 2XHNA 4LKEA 4YW4A 5FIXA 3WW1A 1NZIA 4MGKE 4AGVA 3RMYA 2W46A 3VD3A 2ZOEB 3DL3A 4MYEA 2FMYA 1QHDA 2Q8EA 3BODA 3ZMOA 4YFWA 1OQDA 5FYCA 5J36A 4QT6A 1VBB1 1W6MA 5IK7A 2HWF2 3AVSA 4E27A 1NE4A 2ZXQA 3MFAA 3O14A 1S0DA 1TEIA 3KHCA 1HXS3 3K46A 4H2AA 5KHIA 4AYUA 1ND2C 1OOPA 3BN6A 3FHAA 1VMHA 4GWMA 3OGJA 3KGZA 1OLRA 2ZKNA 2BOIA 2ZJCA 3KMHA 3CZJA 3HPNA 3MI8A 3LEMA 3FFZA 4BK5A 1H2KA 2D6MA 2G4IA 1DYKA 1LCLA 1N1VA 4RR3C 4XFGA 2PELA 4UWDA 1Y3TA 4RHV3 4OHZA 2RS33 3VD5A 2W9XA 3RZGA 2I74A 3S30A 1A8MA 4XILA 3VN4A 2YG0A 2RS13 3TEYA 1WW6A 1BKZA 4WV8A 3E5UA 2VXRA 2VZTA 2SBAA 3RZLA 2UWBA 3KT7A 5AFEA 4LE3A 3DV8A 3GHMA 4BWOA 5BXXA 4AWDA 1OKQA 1OVPA 3FC0A 3MV11 4Y4RA 4I01A 4CXYA 2HWE1 3NVCA 2E7QA 4JKLA 4A7ZA 1RUJ3 2VE1A 3EMRA 5ABJC 1MEC1 1SHWB 1FXZA 5FP9A 4JRLA 3BIWE 1GFF2 4N53C 3VBSC 2HWB3 3ELNA 4XACA 1W2UA 3WP3A 4QWNA
chains in the Genus database with same CATH topology
4LO6B 4N7IA 1PIV3 3WHUA 1OFNA 3VKOA 3G7DA 4FPEA 4OULA 3O7OA 1MZEA 3NKTA 4QGLA 5ABJA 4N53A 3K48A 4LHNA 3VZMA 5F1RA 3MIDA 3ES4A 5JMCA 3BOPA 4RD7A 4JVAA 1RUG2 5L7OA 2ZGPA 2DCZA 1GV9A 1NA1B 2WKKA 5KWRA 4BIFA 3ILFA 3AXEA 1YI9A 1ZBE2 1C8NA 4QM9A 2YUEA 3MIGA 5CB7A 4E2SA 2HKXA 1CJPA 1M4WA 1ZX5A 4GALA 5AC93 1H1IA 1LOFC 4Q4X2 1G7YA 5CFDB 2GNDA 2VNOA 2WT2A 3AKPA 2QKDA 4JC1A 3WQ7A 2A6VA 4PLNA 4AFMA 1AR61 4BCUA 4Q0VA 3GYDA 3VZLA 1WLDA 5EV7A 1ZZ9A 3VDDB 2ZMLA 1C8M3 2YZ4A 4XMAA 1RUOA 1MR5A 1VBA3 1WCKA 3TN92 3CNAA 1LR5A 2Q1ZB 1LOFA 1ND3C 4W6YA 4OUSA 5L19A 2ZGKA 4ES9A 1AYM2 2GALA 4LBLA 1FV2A 4HT1T 4Q4V3 4QPGA 2VW2A 5JOZA 2YV8A 1CD3G 1HQWA 3MPBA 3RPQA 1TME3 2DWRA 1OA4A 1ASJ3 1FOD1 1JHNA 1RL3A 5H9PA 4R8HA 2NYYA 1UU5A 1KDKA 2PAKA 4XZPA 5DUVA 3SCFA 1VBD2 1ND3A 2QE3A 4XFFA 2MNGA 1A78A 3AZWA 4BA6A 3MIBA 1UKGA 2WINB 5FAXA 1BBT1 4S2FA 4CEWB 1POV3 1N3PA 2UWCA 4M3CB 5GZFA 2IXLA 3A4UA 4HZFA 5K0UA 3ZXEA 1H8TB 2XG3A 4QU2A 1BZWA 5KHHA 5C9AC 2IWGB 1DQ6A 1DZRA 2B45X 1DBNA 4B8EA 1KJRA 4GULA 3V0BA 1IKPA 1YNAA 3AMMA 4Q4Y1 2JJ6A 1CJDA 1PHMA 5IK5A 4YVSC 4C90A 3NV1A 1L3JA 1U5YA 2WNUB 3N35A 4I0BA 3VBOB 5LEJA 1CAUA 1NY72 5C9AA 2B9UA 3ALQA 3PLQA 4GXLA 3FLRA 1CGPA 2DCYA 4IEVA 1BMV2 3WW4A 2R071 3AYCA 4WVVA 2WS92 4YGBA 4YVSA 4E9KA 1IS5A 4LUMA 1V70A 3OBRA 1I1EA 4HL0A 5BNPC 4YG0A 4JGZB 5SV8A 4HPKB 1PVC3 1Z7S2 4A7KA 1D0HA 4MV2A 4I0AA 1QF3A 4YVWC 3P3NA 3POYA 5E1RA 1V6IA 3B69A 1XE8A 3PMSA 5LK5A 3EBRA 1RUE1 3H7YA 4YW1A 2GSYA 2XLAA 3AFGA 3J9SA 2PAMA 4XXAA 4Q2FA 1XU1A 3I59A 2B46X 5EXOA 2PHXA 5C8CB 2TEPA 1X7NA 4YVWA 1CQ9A 1VB4A 2QUOA 3ZX7A 2I07B 3GNEA 4Y22B 3VBUC 1CPNA 1VBB2 1Z78A 2BNOA 4X6RB 2E9QA 4IEQA 2ZZQA 1FNYA 3UKVA 1UMZA 2ZGMA 4R4XA 4F8AA 1OD5A 2ZGRA 1QDCA 1QNWA 2V09A 2PLV2 3D5OA 2PHUA 3AP7A 4Y1UA 3VBUA 1LODA 2VY0A 4XPVA 1C1FA 1AXYA 1GZCA 4JDOA 2QFEA 4LBKA 2DTWA 3GF6A 1X82A 3WDXA 4YW5A 3GZAA 3C2UA 1QXPA 2DFBA 2VULA 3AJYA 3RI9A 4XF4A 3URFA 4K6BA 1WBLA 2DVGA 4E4DX 4NVPA 4AEDB 1FPN3 4MXVA 1R093 3CJXA 2HWE2 5A3LA 4JDNA 2FMDA 5GZEA 1MEC2 2A75A 3R05A 2A6WA 1YFYA 4FPYA 2PHDA 1W6NB 1VRH1 3TNPB 5FDBA 3JZVA 3ILNA 1REFA 2D7FA 3MLLA 4IEPA 5H9RA 1G9DA 4ISRA 3M1HA 2B39A 3WP4A 4LA3A 1B09A 2JENA 1ZA4A 1RITA 3WLUA 2RMU1 4QQLA 1XRUA 3AMPA 3OGGA 1N3OA 3OY8A 1H9PA 4I3PA 1KITA 2UYAA 1B35A 4PF5A 5GLZA 5GLWA 4IEWA 2ZTNA 2D3RA 3UJQA 4K9SA 4CDXC 2JG9A 3FBYA 4LO5B 3MW3A 1KJLA 4P9JA 3H0OA 3ES1A 5CFCC 2WNEA 1ZRFA 4KQ7A 4XFBA 1C5IA 2JE7A 4LULA 4R4ZA 1AR62 3V64A 2WT0A 2PYTA 3ZN6A 4CDXA 5JZGC 1BJQA 4E4ZA 1GZWA 4YM1A 1YXWA 1IHMA 1QH6A 3DKWA 3VKLA 4YW2A 5CFCA 1QQP3 4CDUB 1LOBA 1POV0 2RJKA 3N7JA 3VBFB 2VPVA 3OD4A 4COUA 1FI2A 2NLRA 1I9RA 3E6BA 4AEJA 4GWNA 2E53A 4CP1A 2IFWA 3S7EA 5FO8B 5JZGA 1HXS1 1DQ0A 2AYHA 1FOD2 4XJAA 3O0WA 1D0GA 4LLFA 2JX9A 2VQ0A 2W0XA 5A32B 3WCRA 1WD4A 4XHBA 1MS8A 2Y0IA 2YPJA 4L99A 1BBT2 1U0AA 4RHV1 2ES3A 2RS31 1RUD3 1WCDJ 2UYBA 3ST7A 5FPZA 2RS11 3RG0A 3L9JT 4B29A 2WFPA 4Q26A 4Q4Y2 1S0CA 1QJX3 3MFCA 3USUA 1RUJ1 2NP0A 3KLSA 4MGYE 4S2HA 2HWB1 2PHRA 1R083 3J8F3 2A6YA 5JSPA 5AVPA 3H1YA 1C4RA 4YG6A 4IEZA 1PIV1 2R072 4YGEA 1H2LA 1DDLA 3THTA 1PGW1 4KWKA 1Q5OA 1N1TA 2DF7A 1ENSA 1SLIA 4L2NA 4AGGA 5CG8A 4DB5A 4CYDA 1H30A 5GALA 3BTAA 3W9AA 3EXUA 3B9CA 3AYEA 1K5MC 4OHWA 4Q29A 4TWTA 5JOWA 3HD8B 2OVUA 3TYJA 1CR7A 1RUE2 3RNSA 4MZUA 4PIZA 4KNCA 4FPGA 4XBQA 2OA2A 1G9BA 1WMEA 5CVRA 1LHUA 3VZOA 3ZXKA 3E6DA 3HWJA 2WA3A 3FX3A 4QQHA 1F2NA 3B3QE 3PVEA 5AC91 1K5MA 1RUI2 1O7FA 4HSJA 5I0RA 1LOGA 2YXSA 3B93A 4JDMA 4KL1A 2V5YA 5C6CA 5BNOB 1S0JA 4Q27A 4HVRA 2KXLA 1C8M1 2WIIB 2PHWA 2WC2A 1VBA1 1JW6A 2ZA9A 1UZYA 4K3UA 4XJUA 5JSRA 1X36A 1RUF3 2ZCWA 4Z92B 2ZGLA 4P14A 1C5HA 3VZJA 3E6CC 2AUYA 1XNDA 4Q4V1 3QH6A 3ZFFC 1D2QA 1S0FA 5J48A 1YLLA 1QOOA 1TME1 1OA3A 1ASJ1 4WM8A 3CU7A 3PHMA 3PMEA 4IEYA 4RQPB 4QPIA 4DS0A 4ASMB 2B5HA 1HRI3 5FMOL 1DZQA 4MXWA 4AVCA 4C0BA 1POV1 2ATFA 3ZFFA 1ZZ7A 1UF2C 1VRH2 3CJIB 1AR83 3M3QA 4IERA 5FMOS 2JG8B 3WW2A 1NQJA 4NHLA 4BE3A 3ZSEA 2OIIA 1PK6B 3RMXA 2PAEA 2RMU2 2VW1A 1S0BA 3HBZA 1BVVA 1ULDA 1PZ8A 1SDWA 1LRHA 3KS7A 1JUHA 2GH2A 1NA1C 4LBOA 3BALA 3C3VA 3MLKA 1NCRB 1YUDA 1HQLA 4X6QB 5J98B 1FV3A 2EXJA 3JQXA 1PVC1 5FCCA 4ZXKA 3LAGA 3BOWA 1DFQA 4G4FA 4YW3A 1X8MA 5CFDC 2WL1A 4I02A 4EJRA 1GNHA 5T3NA 4UW3A 2GN7A 2RJLA 3WUCA 3B00A 1NA1A 5FTTC 3JQWA 4BYYA 5T54A 2CGPA 2DVDA 1QWRA 3VDDC 5E88A 4YGDA 1APNA 2EA7A 3HN1A 1Y9QA 5L73A 2C0ZA 3S6PA 4XBLA 3RS6A 1FMD3 3Q9OA 1OHFA 3FFQA 4L9BA 1H8VA 5T50A 4IESA 4XBNA 4Y4YA 4Z07A 2EAAA 3NV3A 2D43A 3R0RA 5JR7B 4AQSA 2XL7A 1ZZ8A 1HXS2 4G9SB 2A6XA 1SFNA 4Z82A 1YWKA 4H7LA 2WFF3 5CAZA 2VU9A 3U4XA 4Q0PA 4B3NA 1W6OB 1UAIA 4ATFA 3U10A 1MS5A 4XQWA 3AMNA 4CEWC 4RHV2 2RS32 3ZVXA 1RUC3 1UU6A 1H8TC 1UW8A 1FX5A 2RS12 5KXCA 3IN9A 4KG0A 2ETEA 3LOIA 5GZCA 4BPZA 3IIAA 4N7UA 5AFBA 5KXBA 1VALA 1RGSA 3ACLA 4BHPA 4NO4A 1FPN1 1R091 3GBFA 1EYBA 5JOXA 3DUIA 5T5LA 2WNUC 1RUJ2 5T5PA 2AREA 4CEWA 2CGNA 2NPIA 2XJUA 5FQ0B 3VBOC 2VMIA 4UW4A 2VW0A 3U0ZA 1AX1A 1H8TA 2HWB2 1PNGA 1Z0HA 4LTAA 4XTPA 3OJBA 1NY71 4FTSA 3LSEA 1CAWA 3AKSA 4PBPA 4W6WA 3NWKA 1PIV2 4AF9A 4XFCA 2A71A 1PGW2 3RYRA 1D2SA 1BEV3 5T5JA 3ZFEB 1H4HA 1RC6A 4JGZC 3SNMA 4WM7B 1UPIA 1W0PA 3WDVA 3E5XA 2RE9A 1QJY3 4S2GA 2R30A 5GLUA 4XMIA 3KT1A 1PGSA 2JECA 1QU0A 3IPVA 2R0HA 1G86A 2C5DA 2BVBA 1I6XA 4OHXA 4JGZA 4OZXA 4HPKA 4D94A 4EROA 4FT8A 1DHKB 5C8CC 3R4UA 4OHVA 1S2KA 1J3QA 2BYVE 1HQNA 3LZZA 5AC92 1U5XA 5IK4A 2XWBB 1JBCA 1CPMA 4FO9A 3VGIA 4EWDA 4CDQC 2NN8A 1ZNPA 4OI1A 4O9GA 1WCSA 1MVQA 1D4VB 3SXWA 3RDIA 1KRIA 4HN1A 2P3IA 2XB6C 4QGMA 3R6SA 3WDTA 3IKWA 5DUUA 5C8CA 1QOTA 1C8M2 1VBA2 4Y22A 2PLV1 2XL9A 5TSWA 1J1TA 1NE6A 1RVF3 4KG8A 3SLIA 4ITCA 4BLJA 1QQP1 2YROA 1CVNA 2D3SA 3VZKA 4PCRA 4RS5B 4CDQA 4LUKA 5J7MA 1AHSA 1SBEA 4Q4V2 4J1XA 4YFZA 2AR6A 1LGBA 1TME2 3H8UA 1ASJ2 3I7DA 4DXZA 4XF3A 3B02A 1ND2A 2PFWA 4D7SA 1Q8VA 4AEDC 2Z69A 4GH4B 2P3KA 1ZZCA 1NXMA 4PDWB 3JU9A 5CU1A 3CO2A 4RR3A 2A73B 3ZYPA 5FO7B 3USSA 1RUD1 1QJU3 4BZ4A 4FAHA 5F6KA 4ZKTB 3AKQA 3INAA 2EXIA 3N4MA 1IQAA 3M8LA 3H3ZA 3WD5A 1MZ5A 3OD0A 3U07A 4E2GA 1MS9A 4Y1XA 3FMGA 3E5QA 1TNFA 1QJX1 2XJRA 5I91A 1CAVB 5BNQA 3JBG3 5K8SA 5T52A 4D7YA 3VBSA 1R081 3J8F1 3H9AA 1RJ7A 3TWIA 4M0NA 4AI0A 1LENA 1T6GC 2AZ5A 3MLJA 4PIXA 1OQ1A 3VL8A 1FYUA 1ULEA 3E97A 2XBO3 1JH5A 4XW3A 2XKOA 3MW4A 4GIQA 2O8OA 4HKWA 1PVC2 3K51A 3B5LB 3THPA 4DZGA 3ZXDA 2OZ6A 4DINB 3ENRA 1LESA 1DGWX 4M01A 2HYKA 2BGCA 3D82A 3UK9A 5DUXA 3ZIWA 1U5ZA 2XJPA 4AI8A 1GICA 2PQQA 3TNQA 3ETQA 4QD2A 4AHXA 4IL7A 4N9IA 3D6EA 4B7EA 1G6NA 2X5IB 2P2KA 2SLIA 5CIRA 1MS0A 1KS4A 2AH2A 2Z2SB 5JI7A 1TE1B 4CDUC 4FAGA 3VBFC 3OTFA 4ATEA 4NHKA 1J3RA 1V00A 2LUWA 4BMEA 1AJKA 3H50A 4P9IA 4LBNA 4AVSA 1NQDA 3JD73 4RFT0 5FLHA 1A3KA 4WVMB 2R32A 1H1MA 4LO8A 1WW4A 3KT4A 3IMNA 4CDUA 1AR93 4WZFA 2VOWA 3QH7A 1RUF1 5GZDA 4M3CE 1AL23 1UU4A 2ZHNA 1ZRRA 4KWLA 1WLCA 3N7LA 2QCSB 2EAKA 2RM23 4KU7A 1UIJA 3LGRA 4GMP3 5JIUA 1EY2A 5CA6A 1PO23 3WNXA 1W6QB 1FPN2 5A32A 1R092 1OI6A 1RB8G 4MGZE 3NAPB 5IUQA 4XF1A 3H7JA 1YI7A 2UWAA 5I8SA 4EN8B 1HRI1 2HWC3 3D0JA 4N43B 1UIKA 1VBE3 1IPKA 3EO6A 1VBC3 4IV1B 1YFWA 4Z8BA 1O5LA 1CX4A 4M00A 5EYXA 3V0AB 2VVDA 1AR81 1MS4A 2E63A 1GSLA 3AM2A 3UV9A 2DUOA 4RA0A 2E7AA 4QPYA 4HKLA 2D6KA 5GLVA 4P9LA 1RJ8A 2H6BA 5A33A 1QJZA 3I2DA 2TBVA 3VBHB 1PGL1 1JXNA 3ZXLA 4JV4A 2DCTA 3FHIB 4CDWB 5GJ6A 2F6BA 4A3XA 3AK0A 1TQ5A 3RWNA 5I8TA 4S2DA 5BNPA 1DQ2A 1UL9A 1MVEA 2WQ4A 3IBMA 4W65A 4FTBA 3V56A 1RUI1 2DUPA 3RZZA 1U5IA 2ENRA 1LOAA 2GC3A 2E51A 1GLHA 1NG0A 2Q30A 3FUOA 5LRRA 5BNOC 4QXKA 2NMOA 5GZGA 4W6XA 2O1QA 2R063 5J96B 4HN0A 4QM8A 2R1BA 1IS4A 1A8DA 4WBBA 1LEDA 2WZPP 2K2SA 3VKNA 2DV9A 3PJQA 4XQ4A 1QQP2 4KGQA 4OI4A 1YJKA 2WZR3 4OLLA 4BQ1A 4TLFA 4UW6A 5F9TA 3VUOA 1OOPB 4YZ5A 2CNAA 2IC1A 4AVBA 4DOUA 4MGIE 5C8WA 2DVBA 1D4M3 5L36A 1LHVA 2FQPA 3SISA 1F9KA 1JUIA 2RR13 2WFF1 3WQ0A