2TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Hydrolase (serine proteinase)
total genus 42
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2trmA02
5DG6A 1UTQA 1XUFA 2EI7A 1FDPA 3RLYH 1ELTA 3Q00A 3LJJA 1TRMA 1O2WA 1VITF 3M37A 4GCHF 3CP7A 4DURA 3EAJA 3SN8A 2G4UA 1DICA 4CRCA 2FS8A 5FCKA 1T8LA 5DGJA 1Y3YA 1V2OT 5A0BA 2BOHB 1ABIH 2EC9H 3M5MA 1T4UH 4INLA 3SHCH 3VEQB 1ZJDA 1V3XA 4ISHH 1D6WA 4Y7BA 2BLVA 3IG6B 3N7OA 5DK1A 1HXFH 2NU0E 1YYY1 1O3PB 1LPKB 1GHBG 2J34A 4KKDA 1ELBA 2VU8E 3KHVA 3T62A 1DT2A 4D9RA 5TJXA 2FX6A 1SHYA 4GHQA 1Z1JA 3R0FA 3U8RH 1ETSH 5EQRA 4MPXA 4TY6A 5J4SA 2ZQ1A 1NM6A 2BQ6B 3RXVA 2J92A 3GCNA 1JOUB 1F0UA 1MU8B 3NUMA 1C5WB 3QO6A 3FVFB 3B8JA 1DY9A 4NFFA 2ZDNA 4NA8A 1T7CA 1P0SH 4E7RG 1HAVA 2QGRA 1S0QA 4FUJA 1HYLA 1UVSH 3GYLB 4DIIH 5DP3A 1SGFG 1TONA 2GTBA 2ZWLH 1OXGA 3ZZ6A 1A5IA 1QL8A 7KMEH 5A8ZA 1TGBA 3MU5A 3T26A 3UNSA 2Y5GA 1PJPA 2R2WU 3E6PH 3SUEA 1BJVA 3GDSA 1DDJA 4Y10E 4ASHA 4GVUA 4M7GA 1ZLRA 1GMHF 3UQVA 4BAMB 4FU9A 5F8ZA 4X6NA 4BTUB 2J2UA 1XVMA 3ZZ9A 4Y7AA 1SOTA 3A8BA 4X1SU 1ELFA 1AU8A 1TQ7B 3SQHE 1EAWA 3VB4A 4ZKNU 2A4GA 2ZA5A 4IN1A 2VWNA 4X6MA 1MBMA 2VWLA 3VGCB 1DWDH 2ZU1A 1O33A 1EPTA 1UHBA 4JYUH 5EU8A 1THRH 3M7UA 2HOBA 5F8XA 1TB6H 1D4PB 4KTCA 3TGJE 2ZIQH 1WSSH 1DWCH 1XXDA 2HNTE 2FYRA 1O3IA 1N8OC 1TBRH 2TGAA 4INKA 1C4V2 1IQFA 3AASA 2VJ1A 2ZU5A 1KLTA 2BM2A 3GY5A 2ZKSA 3RXIA 1BTYA 1QBVH 1UO6A 1NFXA 1ESAA 1MQ6A 1C2MA 1O3MA 1GI3A 1K1PA 2OLGA 4FUIA 4MPVA 4LZ4B 1V2LT 1C5LH 1TPOA 2F9NA 1GWAA 3PLKA 3GY7A 3M35A 1A3EH 1FY1A 3UY9A 1AUTC 4H42U 1DS2E 1F7ZA 3UNQA 3SGQE 1TA2A 1CQQA 1GHZA 5EPYA 2AGEX 4YT7H 1V2TT 1ZMNA 1WAYB 4Z0KA 3RXLA 2BTCE 1W12U 3NZIA 1IQMA 3RXOA 3SJOA 2ZG0H 2BD5A 1O2PA 1P2MA 5E2OA 1AWHB 2PW8H 2ZGJA 1ANDA 3VB6A 2ZZUH 2VVUA 2BY8X 1ZMLA 2RG3A 3RXTA 1ZJKA 2OTVA 1C5PA 1O2LA 3I29A 1W14U 2A2QH 1GL0E 3BTGE 3HATH 3SBKA 2TGTA 1XUKA 1TX7A 3TNTA 1O2YA 3TH2H 5JBCS 3AAVA 1TPPA 4LXBH 3GICB 3RP2A 4IBLH 1F2SE 1CSOE 2IPHA 3LJOA 4AFUA 8GCHG 3T25A 1RIWC 1O2OA 1ORFA 5J4QA 1OYQA 2H1UA 1AD8H 4WXIA 3S0NA 1C2LA 2FWWA 2WUBA 1NFYA 2FODA 3PWBA 2F9BH 1P03A 3MFJA 2QIQA 3UPEA 2BY6X 1E0FD 3VXFH 1JRSA 3PYHA 1GBCA 1K28D 1V2JT 1UVUH 1CT4E 1ELEE 5EW2H 8ESTE 5K0HA 1EASA 1NZQH 3DFLA 4DJZB 4WH8A 3E1XB 2QF3A 3MH7A 2BHGA 3FP8E 1QBOA 2PSXA 1EP6A 1O2HA 2AEIH 2OQ5A 4DCDA 1GI1A 1DPOA 1PYTC 1BTPA 2ALVA 3VB7A 3PWCA 1C1UH 1GVLA 1TBZH 4O97A 1Y5UT 3CENA 2ZC9H 3SU4A 2WINI 2KAIB 1AY6H 3PLPA 4K8YA 3S69A 1GDNA 1AVGH 1SLWB 3HK6B 3LGYA 3SNBA 2BD7A 2OBOA 2D26C 2O8WA 4ABFA 3AVZA 3URCA 4B2CA 1BTXA 2PHBA 1A46H 3TH3H 1O39A 4Q2KA 1DOJA 1K21H 1TMBH 3SJIA 3BTFE 5FX6A 1B5GH 4IC6A 1FY5A 1C5OH 4B1TA 1QB9A 3ZVGA 1QB1A 2JH6D 5FPYA 1KDQB 3RXCA 1DANH 4ABHA 1S5SA 2ZTZA 6GCHG 1C2DA 3ZZCA 2ODYB 1OPHB 5AFZH 4OGXA 1IHSH 1B0EA 2ZGXH 4WMEA 1GBBA 1S83A 4WXVA 2OC1A 1Y5AT 3S7HB 3LGWA 4THNH 3LC3A 5HGGA 1HDTH 1GMDF 1SGPE 2AERH 2I6SA 3NKKA 2BQ7B 4K1SA 1DITH 2BY9X 2BDHA 4LOYH 2FYQA 1Q3XA 1E34B 1VZQH 3OTJE 2A0QB 1O2MA 3AW0A 5E8EH 2GDDA 4FUHA 1FY8E 1GJ8B 1HAGE 1YF4A 1AGJA 1WU1A 3GCTF 1F5LA 1EOJA 1SSXA 1MD7A 4B74A 2ANWA 1O2SA 1XUJA 3L6PA 1O36A 4U2WA 4FVBA 2NU3E 4A1XA 1P57B 2QCYA 2F83A 2ZDVH 1GI6A 4I33A 4Y71A 2ZPRA 3RC6A 4OS6A 3ODFA 2ILNA 2ZCLP 3V13A 4I31A 1FIWA 1K1LA 2ZDAH 2BLQA 2LNCA 3D65E 3ZZ8A 5F03A 3LT3A 1Z1IA 2GV7A 3IWMA 1XM1A 2R3UA 1NRSH 1EAIA 3P8NA 2FOBA 3GCHB 4NSVA 5DP7A 5C3NA 1PPGE 2FMJA 2CJIA 1ESTA 1TQ0B 3U8TH 2F9UA 4CHAB 2QXGA 4X2XA 4Y8YA 2ZGBH 1OWHA 1QJ6B 2Q6GA 1A0HB 2J38A 1C5TA 1CT2E 1C2HA 1GCDA 2PUXB 2R9PA 5DP9A 2A4QA 3I77A 1KLJH 3PMAB 1KXAA 3SI4H 1O2XA 1ID5H 3A7VA 1OOKB 2PFEA 1SGRE 3EA7A 1A5HA 1ZSLA 2H6MA 2HALA 5E0GA 5C5NA 4CBNA 2PWXA 4UFEH 3EE0B 2FS9A 4NA9H 2C93B 3E91A 1TPAE 1LMWB 1HJAB 4E7NA 2XW9A 3SGBE 5EXMA 1GPZA 1SPJA 1CHOG 1QQUA 1C5VA 5CHAB 5IYTA 1NRQH 2H9HA 1IQHA 1QL7A 2GV6A 3T29A 3RLWH 4NIXA 1LPZB 2BDGA 4ABDA 2AS9A 1YPEH 5I25A 4JMYA 4TPYA 5JYIA 2VH0A 2ZFPH 1FPHH 5GXPA 3MI4A 4Y8ZA 1LHDH 2FESH 1SGYE 4O3TA 5AF9H 4RKOB 2WPIS 2FM2A 3U98H 3JZ2B 2ANKH 1NPMA 2VINA 1ZPZA 1K1JA 2BOKA 1DLEA 2ZECA 1YPJH 1O37A 1P2NA 5GPIB 1OSSA 2Z9KA 2SGQE 2ZO3H 1FIZA 3HPTB 3OX7U 2Y6TA 1WYKA 4IC5A 1MQ5A 3RU4T 1G3BA 4WY3A 4AX9H 2F3CE 3PV4A 5L2YH 2FLBH 1NT1A 4FUEA 3SUDA 1O2GH 4NA7A 2QV1A 4ZKSU 3GY2A 3S9BA 4AB9A 1EATA 2TIOA 5JBAS 2UUKB 1BHXF 1P01A 4CR9A 4LZ1H 1GMCF 3PROA 1SG8B 1Y8TA 2CV3A 1PYTD 2VIWA 2W7SA 3F68H 3PLBA 1O3OA 3DT0H 4AGKA 1AKSB 1V6DA 1UTMA 1YCPM 3QZRA 3PMHB 4JZIA 2LPRA 1N6XA 4UONA 5GDSH 3O8CA 3BIVH 1NN6A 1HIAA 1TNGA 2ZGHA 1H9HE 2OINA 2ZDMA 4OS5A 1FN6A 5DKMA 1YCPK 1F5RA 2GMTB 1HBTH 1G3DA 2GZ9A 2P59A 1KY9A 3KNXA 1AB9B 2J94A 1F0SA 1H8DH 4JK5A 1W2KH 4O9VA 1O5FH 2A32A 1LPGB 2GT7A 4CREA 3K6ZA 5HM9A 1FONA 1ESBA 2BXTH 4GSOA 1SFIA 2HLCA 3BEIB 3TJUA 1RTLA 3T28A 3LH3A 1GHWH 2O8LA 3STIA 5EXNA 1V2PT 1A0LA 1TALA 2P94A 4K60A 3AW1A 3KQDA 3LIWA 1ZTLA 2P3TB 1YM0A 1GBMA 4Q7YA 1SGCA 3TITA 1K2I1 2AGIX 1GJBB 4OS2A 1MBQA 3ZZ4A 1NU7B 2YNBA 2P95A 3UWIA 1CO7E 3P8OA 1BRCE 5HXFA 4ABGA 4TWWA 3RXDA 2XXLA 5GCHF 1HJ9A 3RXKA 1LO6A 3ATMA 3K2UA 5ABWA 1YCPH 2WYGA 2EEKA 1E37B 4NG9H 4VGCB 5BRRE 5EXLA 2O8UA 3PO1B 1BMMH 1RGQA 1GL1A 2SGEE 2BDBA 5ESBA 1EZUC 5FX5A 1SMFE 2AH4X 2FOCA 2ZCKP 3BTTE 4BAQB 5JB9S 4NIVA 1GJDB 1NRRH 4X0WU 4BOHA 2BVXH 3GCHC 3QTOH 2A5IA 6LPRA 4X2VA 1DUAA 3A7YA 1OWJA 5HYOA 1INCA 3CS0A 1W7XH 1Y3VA 1FZZA 4INHA 4A1VA 4ZHLU 2H2ZA 3V12A 2I6QA 4CHAC 5L2ZH 1LHFH 1XKBC 2CMYA 1O5GH 1OWEA 1SR5C 2BMGB 1RIWB 1EP5A 1GJ6A 3BEUA 3OY5U 1A0JA 4YOGA 1O3DA 1WBGB 2OUAA 1AI8H 2A7JA 1WUNH 2A45B 3GYMA 4SGBE 1UK2A 3VB3A 3VXEH 3RXSA 3TJVA 4X6OA 1HJAC 3SJ8A 1AMHA 1ZYOA 4ISIH 1TYNA 1K1MA 2Z9IA 2BZ6H 5CHAC 1C1NA 2WPMS 3SGAE 4ISOA 1XKAC 1PPHE 1HAYB 3SU0A 3SI3H 4BTIB 2F9PA 3PMBB 1GHBF 5A0CA 1J15A 1BQYA 3RMOH 4K1TA 1W0ZU 1IQIA 3RXJA 1ABJH 1L4DA 2WPKS 1EJAA 2R3YA 3A7ZA 1AE5A 1WTGH 3UFAA 2XWAA 3H7OA 3BIUH 2EI6A 1V2ST 1LKAA 1WV7H 1MCTA 4X1QU 1C1TA 1CBWB 3RXEA 1L0ZA 1GBJA 1P06A 2BXUH 2B9LA 4I8JA 1ELAA 1EOLA 8KME2 2XBWA 2P3UB 1PPBH 4RSPA 1NFUA 3P92A 1TNLA 4Y8XA 1KYNA 1KIGH 2JKHA 4CRBA 3M5LA 4IMZA 1KTSB 5DP8A 1QIXB 3ZZ3A 2GDEH 3NPSA 2FO9A 3LH1A 2GCHG 3BTQE 1HXEH 1TNJA 4HTCH 3U1IB 3ZVFA 2VIQA 1GI9B 1TPSA 2FTMA 2QY0B 3E3TA 3MMGA 7LPRA 3V7TA 1MTVA 5C5OA 1PQAA 1LQDB 4YESB 1XVOA 1VCPA 1QGFA 4PROA 1ELGA 3F9EA 1O38A 3CS7A 2ZHDA 2BY5X 3SO3A 1TX6A 1YGCH 3F1SB 2IN2A 1XMNB 3UTUH 3I78A 2GMTC 5LH8A 3A8CA 6ESTA 1FAKH 5TCAA 5FBEA 4AYVB 2SGPE 3Q3KA 1AB9C 1V2RT 3TIUA 2B0FA 1AO5A 2XC5A 1SQAA 3H5CB 1ZGVA 3OY6U 3PTBA 4AG1A 1YPKH 3LKWA 3FFGA 5EODA 1QRZA 3BEFB 4F4OC 1C4U2 2QC2A 3LGIA 4MDSA 1JBUH 2TGPZ 1CA8B 1G37A 1LVBA 1RXPA 4XSKU 1C5SA 1O5DH 1B7XB 3L33A 1BITA 1ZTKA 2W3KA 3GOVB 3NK8A 4X1PU 1AWFH 2A1DB 1JIRA 2GP9B 1C2GA 1T32A 4VGCC 1HAOH 2FOEA 4I7YH 3PO1C 3RC5A 3QZQA 4I8GA 3LOXA 4XE4A 4ABJA 3O8BA 3U9AH 1SL3A 2C4FH 2W5EA 1UTLM 1FN8A 5LPFA 1QA0A 3SW2B 1VJ9U 1KXBA 5HMAA 1RFNA 2ZHQH 5EPNA 4BAHB 3ELAH 2A4RA 4WMFA 2Y82A 3TJOA 1CT0E 1PPZA 3FAOA 4X6PA 3MNSA 1HPGA 4KTSA 1LVOA 1UCYE 4U30A 1UK4A 1G32B 2Z94A 5AFYH 2ZPQA 1GHAG 8GCHF 4UD9H 2GGVB 4Y6DA 2FTLE 1EUFA 2BD4A 4GAWA 4BXWA 4XFQA 4AORA 1GI2A 1QRWA 1BTUA 2CHAC 2SGDE 2UUYA 2GT8A 3MU8A 4NZQA 1RS0A 1SGEE 1FJSA 4WWYA 5FXLA 1O3HA 2V3HH 2ODPA 1C1VH 1YBWA 3MNXA 1HAZB 1SLXB 1TOMH 1BTZA 3ATWA 5EG4A 1C2KA 1CGHA 3ZZAA 4DIHH 3UQOA 4HFPB 2KAIA 4QT8C 4MPUA 1RJXB 1O35A 1GDUA 2K1QA 4FU7A 1GJ5H 3FZZA 2AIPA 4AZ2B 1FXYA 1DXWA 2Z6BD 4NWLA 1WTHD 5C20A 1CBWC 3NWUA 5BPEA 1DX5M 1E35B 3LONA 1XXFA 1P02A 3ODDA 2SGAA 3RXAA 4NFEA 1KDQA 1FY4A 3PTNA 2OQUA 4AYYB 1DFPA 1JRTA 2PGQB 1GI7B 1C2FA 2A5AA 2BB4A 3A88A 3UIRA 1QBNA 4ABEA 3RXGA 1EZSC 3M3TA 3P17H 3S9AA 1PQ5A 1C5MD 1QJ7B 5A09A 2BDAA 2RDLA 1OKXA 1SGDE 4A1TA 6GCHF 3QLPH 1O3CA 3RXQA 1GJ7B 1TRNA 1ELVA 2HWLB 2ODQA 3TK5A 9ESTA 2PUQH 3BTME 1BTHH 3ZZ5A 1G36A 1P12E 4AOQA 1CE5A 4DOQA 2ZDLA 1G3EA 3A84A 4D8NA 2XBXA 1QY6A 4JYVH 1BMNH 5FPSA 1XUGA 3HKIB 4I8HA 2G4TA 4ISNA 1TE0A 3BTHE 1IQLA 3FP7E 4CRDA 2ZU4A 3MU0A 2WPHS 3MOCA 1SQTA 5DP6A 1C9PA 1SQOA 4B75A 2ANYA 1ARBA 3QGNB 1UTPA 4SGAE 3SNAA 4JYTA 5FPTA 2AMPA 4K69A 1HAXB 1KXDA 1P2OA 1ZZZA 2EA3A 1GHYH 3MO9A 3BTKE 3PM3A 2YNAA 1HNEE 1HJ8A 1Z8GA 2Y7XA 1K1NA 1LVMA 1HV7A 4U32A 3E90B 3MNBA 3A7WA 4CRFA 2NU4E 1ZTJA 1CA0B 1ZHRA 2CXVA 1Z6EA 2Z7FE 2Z3CA 1RD3B 1V2UT 1UTKA 1D6RA 2AMQA 3SHAH 1LQEA 4GUXA 2ZQ2A 1C2JA 1EB1H 2PLXA 1YKTA 3AAUA 2CN0H 3RC4A 4DW2U 2PKAB 1WQSA 2GVFA 2ZFQH 1O0DH 1DWEH 4AB8A 5PTPA 3Q3YA 1CU1A 4MG3A 1KSNA 2BDYA 2CGAA 3QN7A 1O34A 2H9TH 2GX4A 2XYAA 3M36A 4Q7XA 5DPAA 3MH5A 1GI0A 3TU7H 1J17T 1SBWA 1EJMA 4ISLA 5A0AE 2JETB 4B2BA 2OXSA 3GY8A 3RM2H 1A7SA 3UUZA 1Z6JH 2FOHA 4GLYA 1HCGA 2R2MB 1GBEA 4YTAA 3A87A 4I8KA 3RXBA 3EYDA 1L4ZA 3NXPA 1EQ9A 5GWZA 3F9GA 1MCVA 2C8ZB 5H4IB 4D7GA 4O3UA 4UE7H 1ZSKA 2OP9A 2PR3A 1XUIA 1UMAH 6CHAB 1BT7A 1H8IH 3ENSB 1GGDB 5ESTE 5G4BA 1MH0A 3M5OA 3T5FH 1PFXC 3K6YA 1QTFA 4K1EA 1S81A 3SV7A 3BF6H 4K2YA 2PSYA 4NZLA 3EQ0H 4B71A 1ZOMA 2QN5T 1CHOF 2HVXA 5GIBA 3A7XA 4K3JA 3RXUA 2BX4A 1MZDA 1O5AB 1ETTH 1S85A 1W0YH 4CBOA 3T2NA 3S7KB 1D3PB 1G2LA 2FI3E 3M3SA 3R3GB 1PQ7A 1GHXH 4Y11E 3SU1A 2Z9JA 5DJ7A 1ZGIA 1AQ7A 1ZR0A 2SNVA 3K9XB 3ESTA 3LDXH 3UOUA 3SU2A 2OC0A 1NTPA 1SC8U 3HKJB 1QRXA 3HGNA 1H4WA 4X1NU 1HRTH 3MH6A 3SORA 2P8OC 2WV5A 1NRNH 3S9CA 2V0BA 3E0NB 1L1JA 1UVPA 1EZXC 1HAPH 3QGJA 4ZROA 1VITH 3KCGH 2BD2A 2ZTYA 1D3DB 2ZHFH 4Y0YE 1HGTH 3KQBA 3LGVA 1C2IA 4ZHAA 7GCHG 4XDEA 4Q80A 2CF9H 1QFKH 1AKSA 1D3TB 3GY4A 1MKXK 3SV6A 1EAXA 1W3CA 5C1XA 1GBIA 4FUDA 1O2NA 3O8DA 2XBYA 2DE8A 2RCEA 7ESTE 3MU1A 1V2VT 3QTVH 5T6GA 3EGKH 1O2KA 3ZVBA 1GBLA 1IQEA 1EAUA 3RMLH 3MHWU 2STBE 5JDUB 3MTYA 1CGJE 3BSQA 4ZXYH 2W26A 4MNVA 2V3OH 1ZRKA 3KEEA 2ZF0H 1MU6B 2PTCE 1ETRH 3KGPA 1DM4B 1J14A 1FPCH 3DUXH 2Y80A 3O8RA 1A1RA 2V6NA 2BLOA 4J1YA 1K1IA 2UUFB 1L2EA 1DSUA 1Z71A 1AE8H 2O8TA 4BNRA 1SI5H 4FVDA 3FANA 4YOIA 2CF8H 3LC5A 2B7DH 1D9IA 2QA9E 1UTOA 1MKXH 1GCTB 1W7GH 4WVPE 3HK3B 1IQKA 2AMDA 3HGPA 1VJAU 3ZVAA 3SV2H 3ZZBA 1GBFA 2QAAA 4B76A 4JK6A 1C1QA 1DXPA 2XBVA 3RXMA 1BRAA 1W13U 2TPIZ 1K1OA 2PV9B 1CA0C 1OP2A 4DGJA 1MTSA 3BTDE 1TX8A 4ESTE 2G00A 1NFWA 2OCVB 3TK6A 1FI8A 1QURH 1O3NA 2GKVE 4WF8A 2D2DA 2FX4A 1F5KU 1BRUP 3ZZDA 2GD4B 1THPB 3ATKA 1BBRE 3B23B 3UWJH 4UDWH 5L6NH 1LHGH 1V2MT 1AVWA 1P3CA 1DLKB 4OGYA 2STAE 2VNTA 3VB5A 3RXHA 1KXEA 1L1NA 4R8TB 1DE7H 4F49A 3RXPA 2XWBI 3KIDU 2WUCA 2FLRH 1P2JA 1TMUH 4LK4A 2ULLA 1DVAH 1DWBH 3BV9B 4XBBA 2TGDA 1SB1H 1A61H 1MTWA 1EX3A 2UWPA 3QX5H 4R0IA 2JETC 5JPMH 1H9LB 2C8WB 4NWKA 5FAHA 1BZXE 2ZCHP 3SV8A 2Z9LA 1YPHC 2CHAB 1ZSJA 1MTNB 2J9NA 1TNHA 6CHAC 1IHTH 1SGFA 5T3HA 4IW4E 1GG6B 1TWXB 2ZFFH 1H1BA 4IN2A 5TCCA 2D1JA 1GGDC 1VITG 2WPLS 3JZ1B 2Q1JA 4GCHG 4KTUA 4K5ZA 3UOPA 2ZFRH 2FI4E 2QYIA 2A2XH 2IOTA 3EA9A 3ATLA 2THFB 3A8AA 1LDTT 1F0TA 1GBTA 3ZZ7A 3BN9A 1SGIB 1C4Y2 1BJUA 1LHEH 1QQ4A 2G52A 1Z7KA 1CVWH 4FUCA 1NC6A 1KLIH 1ANCA 1S6HA 5IDKA 1QJ1B 4H4FA 3UNRA 1Y59T 1TRYA 1ZRBA 1BA8B 2VIDA 2OC8A 1DSTA 2C90B 1BB0B 2PGBB 3A7TA 2TRMA 4RN6A 2NU1E 4WH6A 3KF2A 1C5XB 1UCYK 1MUEB 2ZFTA 1HAIH 2P16A 1BRBE 1W10U 2FDAA 1G2MA 4E05H 1NRPH 5CE1A 4JZFH 2BDIA 2BX3A 4X2YA 1RTKA 2AIQA 1V2KT 2A5KA 5HM2A 3DHKH 4GHTA 4BXSA 1SLVB 4E06H 2YOLA 2SGFE 4AFSA 1PQ8A 4Y79A 2GCHF 3A89A 3TK9A 4ABIA 4D7FA 3TVJB 1HAVB 4JZ1A 3OSYA 1SFQB 5CMXH 4A6LA 2XNIA 1T31A 3M7TA 3TLOA 3EDXB 3C27B 1GMHG 3QWCH 4NCYA 1UK3A 3P70B 2ZHWH 1SGNE 4H6SB 1B0FA 2C3SA 1YPLH 5SGAE 1P2QA 4TYDA 1UCYH 1JWTA 4FU8A 2FP7B 1BOQA 1F0RA 5C1UA 3QUMP 2AFQB 1O3KA 2DUCA 1THSH 3GY3A 4AFQA 1MZAA 1C9TA 3L3TA 1CHGA 1YPGH 3U69H 1GCTC 3RM0H 1QNJA 2JH5D 4Y76A 2BD9A 1EPTB 2UWLA 4BAOB 1FV9A 4A7IB 3DD2H 1AHTH 1UHBB 2ZI2H 2VIVA 3ZYDA 3OYPA 1C1RA 2G5NA 4UFGH 1GJAB 2FI5E 3LU9B 2VIOA 1ARCA 2O9QA 4TWYA 2ZHEH 5JB8S 3RU4D 2D8WA 1T8NA 1K22H 1O2UA 2FOFA 4ZKOU 1C2EA 1GDQA 4U01A 2HRVA 2ZDKA 1N6YA 4NIWA 2QF0A 4KP0A 4CH8B 4YOJA 1GJ4H 1O3EA 1TFXA 1IQNA 2NWNA 4XOJA 4CRGA 4XBCA 3F6UH 3T27A 1TGNA 2XCFA 4OS4A 1EZQA 2QXJA 1Z8IB 3A8DA 2FOAA 1ZPBA 3M7QA 1EKBB 1P04A 1FY3A 1GI5A 2W7UA 3BG8A 2ASUB 3A80A 1L1GA 4MPWA 4YO9A 4BANB 3C1KA 5DP4A 1UJ1A 2GZ8A 2WV4A 2WPJS 1SHHB 2HNTF 3Q3XA 3GY6A 5JBBS 1YPMH 1FUJA 2Y5FA 1UVTH 1P11E 2F9OA 1OX1A 4ZH8A 2XCNA 3MO6A 1A3BH 4D76A 5JBTA 1A2CH 1C5YB 3KQEA 1GHAF 2Z9GA 2VIPA 5C67A 1ZPCA 3LPRA 1S84A 1A4WH 1Y3XA 2B5TB 2UUJB 2VGCB 3QK1A 1T8OA 3V3MA 1MTNC 4UFFH 4B73A 1TGTA 2A7HA 3P8GA 3E0PB 1GG6C 1VGCB 2Y7ZA 1ANBA 1A5GH 3KL6A 1SOZA 1AFEH 2G51A 4ZMAH 1ZHMA 4J2YB 1ZMJA 4RKJB 1ELDE 1YC0A 3TJNA 1YLCA 1FQ3A 2QXIA 5LPRA 1S82A 4KELA 1MAYA 3VPKA 4ABBA 2ESTE 1T8MA 2EI8A 5B6OA 1N1LA 3BTWE 1LKBA 1J9CH 3WY8A 2G81E 3KQCA 1QA7A 2RA3A 8LPRA 3LGUA 2OBQA 2ALPA 1AN1E 2P8OB 1P9UA 1BTWA 4UFDH 1GJ9B 1SGTA 3SNDA 1MMJN 4H6TA 1U6QA 4ZXXH 4BAKB 1Z8JB 1RRKA 3TPIZ 5EGMA 4K8BA 4JZDH 3MH4A 3RXFA 2P3FH 1TGSZ 1V2QT 1TNIA 2VWOA 3BTEE 1T4VH 3TH4H 3V0XA 4UEHH 1JMOH 1QL9A 2J95A 1O30A 1QHRB 1O3AA 3SJKA 1Y5BT 5T6DA 2ZNKH 4BTTB 1AZZA 1W11U 1DY8A 1FAXA 1P10A 1Y3WA 2Q6FA 5DO4H 3MO3A 5FCRA 2AYWA 3TGKE 2R0LA 1XX9A 1GBDA 3A81A 1S0RA 4NSYA 4X8VH 3G01A 1BMLA 2SFAA 3ZVEA 4KGAA 2Z3DA 3RU4E 4YM9A 4ZKRU 2WYJA 1GBKA 2FOGA 5ETXA 5FBIA 3SUFA 3SNEA 4ZUHA 3W95A 5GJ4B 5EW1H 1AUJA 2FOMB 2H5DA 3D49H 2P93A 3A86A 1H9IE 4WJG2 2PTNA 2TBSA 2HPPH 4AGJA 2QXHA 1HUTH 1CGIE 1AZ8A 1GI8B 1GMDG 3GCOA 3BG4B 1O2TA 2G55A 1P05A 1P09A 3M61U 3RXRA 1J8AA 3KN2A 2G8TA 1MKWK 4AG2A 1NS3A 4HZHA 4Z6AH 3D23A 2UWOA 1E36B 2HPQH 1GVZA 4DT7B 3VGCC 2VVCA 1AFQB 3P8FA 4AN7A 3SJ9A 1JXPA 2BDCA 3E8LA 4OS7A 2BQWB 4MTBA 1TNKA 2PKSB 3Q76A 3SOSA 1GBHA 1EPTC 1J16A 1PPEE 3FZDA 1SLUB 3RMNH 2VB0A 2HNTC 1LCYA 1C1PA 1ANEA 2BZAA 3GCTG 4X8UH 3K65B 2PKAA 4IMQA 2W3IA 1RTFB 2BVRH 2VVVA 2VH6A 2XC0A 4TY7A 1C5UA 4X1RU 4D9QA 1C1OA 2C8XB 5EQQA 1ZHPA 2BY7X 2GCTB 4X2WA 2ANMH 3SNCA 4X8TH 1MKWH 3U1JB 1FLEE 3ZV9A 3VFEA 1EXFA 1LHCH 3MWIU 1C1WH 5F6MA 5DP5A 1OP8A 5EQSA 3TNSA 5LGOA 1O3FA 1O2RA 2SNWA 2H5CA 1S6FA 3W94A 3H7TA 1PPFE 3E16B 1P2KA 2ZPSA 3PMJA 2A31A 3RUOA 2FIRH 4YT6H 1AVXA 1G3CA 1YPHE 2IJOB 3D62A 3GDVA 3ZVDA 3URDA 5T6FA 5C2ZA 1UTJA 2FXRA 2BVSH 4IGDA 1BDAA 1MAXA 4MVNA 2XRCA 4ZAEA 4CRAA 1QCPA 4HGCA 4MQAA 1BCUH 1O3BA 2VGCC 1KTTB 1KXCA 4XBDA 1E38B 1VGCC 4DVAU 2BD3A 2F9VA 1BBRK 3RDZA 1NO9H 1TLDA 1Y3UA 1FMGA 3A83A 1JIMA 3SUGA 1DUEA 2R0KA 2OC7A 1BHXB 5K7RA 1C1SA 4MLFB 3ZYEA 3LGTA 1O3LA 1O5EH 2A7CA 3SU6A 1P2IA 3PB1E 4FUGA 4X8SH 1G9IE 1UVOA 5A8YA 1O2ZA 3RMMH 1AIXH 2B8OH 3M5NA 4ABAA 1O2JA 1C5NH 1P9SA 1TBQH 4DG4A 1NROH 1O5CB 1QB6A 3UREA 3IITA 1OWDA 3STJA 3GISB 1TOCB 2ZTXA 1P8VC 5E0JA 1MTUA 7GCHF 3FP6E 3F9FA 5C1YA 3UR9A 1BBRH 1X7AC 1KXFA 2Q6DA 1F92A 3SU3A 4CR5A 2ZGCA 1TABE 2RA0A 1O5BB 2FZZA 1GBAA 2XC4A 2ZP0H 4HI3A 4MNXA 1TA6A 1WOFA 1GMCG 4YLUA 4ZHMU 3NCLA 4MNYA 3GDUA 1QR3E 1O2IA 1OYTH 1W8BH 2FPZA 2NU2E 4GPGA 4NGAH 1Q31A 2GZ7A 3MU4A 4FUFA 1IOEA 1C5ZB 1G30B 1MD8A 1ACBE 1YP9A 3A85A 4A5TS 3F9HA 3TGIE 1OS8A 2H9EH 1BMAA 1IQGA 1NY22 1P3EA 1PPCE 1TGCA 3OU0A 2Y81A 3ZVCA 1M9UA 5AHGH 2F91A 3BG4C 1BIOA 1SGQE 4I8LA 4YLQH 2BD8A 3ZV8A 4A92A 1OWIA 5I46H 1HIAB 3SQEE 2OD3B 3ATIA 1O32A 4WMDA 5LPEA 1IQJA 1N8OB 4TPIZ 1UTNA 2DE9A 1NU9A 1O2QA 2BLWA 2J4IA 2C8YB 1AFQC 1GJCB 1IAUA 1V2WT 1SVPA 2ZU2A 1LTOA 4JZEH 1VR1H 2PKSC 1NESE 1YLDA 1C1MA 3M3VA 4AFZA 1HB0B 5EOKA 4JCNA 1WCZA 9LPRA 2BYAX 3B9FH 2M5TA 4O03A 1ELCA 4CH2B 4FUBA 1WQVH 2V35A 1EJNA 5GCHG 3P95A 5AVDA 1EB2A 1V2NT 3UR6A 1LVYA 1O3GA 4MNWA 4IS5A 5A8XA 1O3JA 3SZNA 1HFDA 1HLTH 2ZEBA 3DA9B 1C5RA 2VWMA 2GCTC 2JH0D 3QDZB 5A2MH 1TMTH 1O2VA 1FNIA 1BUIA 3U8OH 4YZUA 1OWKA 1HAHH 2Z3EA 3SU5A 2HGTH 1GVKB 2ZFSA 2AGGX 3SV9A 5FHTA 3MNCA 5F8TA 1C5QA 4Y0ZE 2Y5HA 1OP0A 4NIYA 4I32A 3Q77A 1TAWA 3P6ZB 2FEQH 5L30H 2A4OA 1O31A 1VCWA 3ITIA 3A82A 1K9OE 1VCQA 4FXGH 3DFJA 1GHVH 2XTTB 1Z8RA 1XUHA 4DY7B 3MYWA 4OS1A 2G5VA 4B2AA 2O8MA 5E2PA 2ZU3A 1D3QB 3EA8A 1Q2WA 4Q7ZA 5E0HA 1GI4A 1TIOA
chains in the Genus database with same CATH superfamily
5DG6A 1UTQA 1XUFA 2EI7A 4RT1A 1FDPA 3RLYH 1ELTA 3Q00A 3LJJA 1SKYE 1TRMA 1O2WA 1VITF 3M37A 4GCHF 3CP7A 4DURA 3EAJA 3SN8A 2G4UA 1DICA 4CRCA 2FS8A 5FCKA 1T8LA 5DGJA 1Y3YA 1V2OT 5A0BA 2BOHB 1ABIH 2EC9H 3M5MA 1T4UH 4INLA 3SHCH 3VEQB 1ZJDA 1V3XA 4ISHH 1D6WA 4Y7BA 2BLVA 3IG6B 3N7OA 5DK1A 1HXFH 2NU0E 1YYY1 1O3PB 1LPKB 1GHBG 2J34A 4KKDA 1ELBA 2VU8E 3KHVA 3T62A 1DT2A 4D9RA 5TJXA 2FX6A 1SHYA 4GHQA 1Z1JA 3R0FA 3F0PA 3U8RH 1ETSH 5EQRA 4MPXA 4TY6A 5J4SA 2ZQ1A 3PRDA 1NM6A 2BQ6B 3RXVA 2J92A 3GCNA 1JOUB 4XD7D 1F0UA 1MU8B 3NUMA 1C5WB 3QO6A 3FVFB 3B8JA 1DY9A 4NFFA 2ZDNA 4NA8A 1T7CA 1P0SH 4E7RG 1HAVA 2QGRA 1S0QA 4FUJA 1HYLA 1UVSH 3GYLB 4DIIH 5DP3A 1SGFG 1TONA 2GTBA 2ZWLH 1OXGA 3ZZ6A 1A5IA 1QL8A 7KMEH 5A8ZA 1TGBA 3MU5A 3T26A 3UNSA 2Y5GA 1PJPA 2R2WU 3E6PH 3SUEA 1BJVA 3GDSA 1DDJA 4Y10E 4ASHA 4GVUA 4M7GA 1ZLRA 1GMHF 3UQVA 3F2FA 4BAMB 4FU9A 5F8ZA 4X6NA 4BTUB 2J2UA 1XVMA 3ZZ9A 4Y7AA 1SOTA 3A8BA 4X1SU 1ELFA 1AU8A 1TQ7B 3SQHE 1EAWA 3VB4A 4ZKNU 2A4GA 2ZA5A 4IN1A 3F0OA 2VWNA 4X6MA 1MBMA 2VWLA 3VGCB 1DWDH 2ZU1A 1O33A 1EPTA 1UHBA 4JYUH 5EU8A 1THRH 3M7UA 2HOBA 5F8XA 1TB6H 1D4PB 4KTCA 3TGJE 2ZIQH 1WSSH 1DWCH 1XXDA 2HNTE 2FYRA 1O3IA 1N8OC 1TBRH 2TGAA 4INKA 1C4V2 1IQFA 3AASA 2VJ1A 2ZU5A 1KLTA 2BM2A 3GY5A 2ZKSA 3RXIA 1BTYA 1QBVH 1UO6A 1NFXA 1ESAA 1MQ6A 1C2MA 1O3MA 1GI3A 1K1PA 2OLGA 4FUIA 2LELA 4MPVA 4LZ4B 1V2LT 1C5LH 1TPOA 2F9NA 1GWAA 3PLKA 2XOKD 3GY7A 3M35A 1A3EH 1FY1A 3UY9A 1AUTC 4H42U 1DS2E 1F7ZA 3UNQA 3SGQE 1TA2A 1CQQA 1GHZA 5EPYA 2AGEX 4YT7H 1V2TT 1ZMNA 1WAYB 4Z0KA 3RXLA 2BTCE 1W12U 3NZIA 1IQMA 3RXOA 3SJOA 2ZG0H 2BD5A 1O2PA 1P2MA 5E2OA 1AWHB 2PW8H 2ZGJA 1ANDA 3VB6A 2ZZUH 2VVUA 2BY8X 1ZMLA 2RG3A 3RXTA 1ZJKA 2OTVA 1C5PA 1O2LA 3I29A 1W14U 2A2QH 1GL0E 3BTGE 3HATH 3SBKA 2TGTA 1XUKA 1TX7A 3TNTA 1O2YA 3TH2H 5JBCS 3AAVA 1TPPA 4LXBH 3GICB 3RP2A 4IBLH 1F2SE 1CSOE 2IPHA 3LJOA 4AFUA 8GCHG 3T25A 1YWUA 1RIWC 1O2OA 1ORFA 2IJD1 5J4QA 1OYQA 2H1UA 1AD8H 4WXIA 3S0NA 1C2LA 2FWWA 2WUBA 1NFYA 2FODA 3DSPA 3PWBA 2F9BH 1P03A 3MFJA 2QIQA 3UPEA 2BY6X 1E0FD 3VXFH 1JRSA 3PYHA 1GBCA 1K28D 1V2JT 1UVUH 1CT4E 1ELEE 5EW2H 8ESTE 5K0HA 1EASA 1NZQH 3DFLA 4DJZB 4WH8A 2YMSD 3E1XB 2QF3A 3MH7A 2BHGA 3FP8E 1QBOA 2PSXA 1EP6A 1O2HA 2AEIH 2OQ5A 4DCDA 1GI1A 1DPOA 1PYTC 1BTPA 2ALVA 3VB7A 3PWCA 1C1UH 1GVLA 1TBZH 4O97A 1Y5UT 3CENA 2ZC9H 3SU4A 2WINI 2KAIB 1AY6H 3PLPA 4K8YA 3S69A 1GDNA 1AVGH 1SLWB 3AK5A 3HK6B 3LGYA 1OHHD 3SNBA 2BD7A 2OBOA 2D26C 2O8WA 4ABFA 3AVZA 3URCA 4B2CA 1BTXA 2PHBA 1A46H 3TH3H 1O39A 4Q2KA 1DOJA 1K21H 1TMBH 3SJIA 3BTFE 5FX6A 1B5GH 4IC6A 1FY5A 1C5OH 4B1TA 1QB9A 3ZVGA 1QB1A 2JH6D 2KR7A 5FPYA 1KDQB 3RXCA 1DANH 4ABHA 1S5SA 2ZTZA 6GCHG 1C2DA 3ZZCA 4AC9A 2ODYB 1OPHB 5AFZH 3WWBA 4OGXA 1IHSH 1B0EA 2ZGXH 4WMEA 1GBBA 1S83A 4WXVA 2OC1A 1Y5AT 3S7HB 3LGWA 4THNH 3LC3A 5HGGA 1HDTH 1GMDF 1SGPE 1WDIA 2AERH 2I6SA 3NKKA 2BQ7B 4K1SA 1DITH 2BY9X 2BDHA 4LOYH 2FYQA 2M2AA 1Q3XA 1E34B 1VZQH 3OTJE 2A0QB 1O2MA 3AW0A 5E8EH 2GDDA 4FUHA 1FY8E 1GJ8B 1HAGE 1YF4A 1E1RD 1AGJA 1WU1A 3GCTF 1F5LA 1EOJA 1SSXA 1MD7A 4B74A 2ANWA 1O2SA 1XUJA 3L6PA 1O36A 4U2WA 4FVBA 2NU3E 4A1XA 4F55A 1P57B 2QCYA 2F83A 2ZDVH 1GI6A 4I33A 4XRNA 2ZPRA 4Y71A 3RC6A 4OS6A 3ODFA 2ILNA 2ZCLP 3V13A 4I31A 1FIWA 1K1LA 2ZDAH 2BLQA 2LNCA 3D65E 3ZZ8A 5F03A 3LT3A 1Z1IA 2GV7A 3IWMA 1XM1A 1KMHB 2R3UA 1NRSH 1EAIA 3P8NA 2FOBA 3GCHB 3PV5A 4NSVA 5DP7A 5C3NA 1PPGE 2FMJA 2CJIA 1S6LA 1ESTA 1TQ0B 3U8TH 2F9UA 4CHAB 2QXGA 4X2XA 4Y8YA 2ZGBH 1OWHA 1QJ6B 2Q6GA 1A0HB 2J38A 1C5TA 1CT2E 1C2HA 1GCDA 2PUXB 2R9PA 5DP9A 2A4QA 3I77A 1KLJH 3PMAB 2KCOA 1KXAA 3SI4H 1O2XA 1ID5H 3A7VA 1OOKB 2PFEA 1SGRE 3EA7A 1A5HA 1ZSLA 2J5UA 2H6MA 2HALA 5E0GA 5C5NA 4CBNA 2PWXA 4UFEH 3WWFA 3EE0B 2FS9A 4NA9H 2C93B 3E91A 1TPAE 1LMWB 1HJAB 4E7NA 2XW9A 3SGBE 5EXMA 1GPZA 1SPJA 1CHOG 1QQUA 1C5VA 5CHAB 5IYTA 1NRQH 2H9HA 1IQHA 1QL7A 2GV6A 3T29A 3RLWH 4NIXA 1LPZB 2BDGA 4ABDA 2AS9A 1YPEH 3UAIC 5I25A 2WZQA 4JMYA 4TPYA 5JYIA 2VH0A 2ZFPH 1FPHH 2J98B 5GXPA 3MI4A 4Y8ZA 1LHDH 2FESH 1SGYE 4O3TA 5AF9H 4RKOB 2WPIS 2FM2A 3U98H 3JZ2B 2ANKH 1NPMA 2VINA 1ZPZA 1K1JA 2BOKA 1DLEA 2ZECA 1YPJH 1O37A 1P2NA 5GPIB 1OSSA 2Z9KA 2SGQE 2ZO3H 1FIZA 3HPTB 3OX7U 2Y6TA 1WYKA 4IC5A 1MQ5A 3RU4T 1G3BA 3OFND 4WY3A 4AX9H 2F3CE 2KFWA 3PV4A 5L2YH 2FLBH 1YLNA 1NT1A 4FUEA 3SUDA 1O2GH 4NA7A 2QV1A 4ZKSU 3GY2A 3S9BA 4AB9A 1EATA 2TIOA 5JBAS 2UUKB 1BHXF 1P01A 4CR9A 4LZ1H 1GMCF 3PROA 1SG8B 1Y8TA 2CV3A 1PYTD 5EJZA 2VIWA 2W7SA 3VG8A 3F68H 3PLBA 1O3OA 3DT0H 4AGKA 1AKSB 1V6DA 1UTMA 1YCPM 3QZRA 3PMHB 4JZIA 2LPRA 1N6XA 4UONA 5GDSH 2K8IA 2RDEA 3O8CA 3BIVH 1NN6A 2KX4A 1HIAA 1TNGA 2ZGHA 1H9HE 2EQNA 2OINA 2ZDMA 4OS5A 1FN6A 5DKMA 1YCPK 1F5RA 2GMTB 1HBTH 1G3DA 2GZ9A 2P59A 1KY9A 3KNXA 1AB9B 2J94A 1F0SA 1H8DH 4JK5A 1W2KH 4O9VA 1O5FH 2A32A 1LPGB 2GT7A 4CREA 3K6ZA 5HM9A 1FONA 1ESBA 2BXTH 4GSOA 1SFIA 2HLCA 3BEIB 3TJUA 1RTLA 3T28A 3LH3A 1GHWH 2O8LA 3STIA 5EXNA 1V2PT 1A0LA 1TALA 2P94A 4K60A 3AW1A 3KQDA 3LIWA 1ZTLA 2P3TB 1YM0A 1GBMA 1BMFD 4Q7YA 1SGCA 3TITA 1K2I1 4M9FA 2AGIX 1GJBB 4OS2A 1MBQA 3ZZ4A 1NU7B 2YNBA 2P95A 3UWIA 1CO7E 3P8OA 1BRCE 5HXFA 5HIZA 4ABGA 4TWWA 3RXDA 2XXLA 5GCHF 1HJ9A 3RXKA 1LO6A 3ATMA 3K2UA 4TT3D 5ABWA 1YCPH 2WYGA 2EEKA 1E37B 4NG9H 4VGCB 5BRRE 5EXLA 2O8UA 3PO1B 1BMMH 1RGQA 4P02A 1GL1A 2SGEE 2BDBA 5ESBA 1EZUC 5FX5A 1SMFE 2AH4X 2FOCA 2ZCKP 3U28C 3BTTE 4BAQB 5JB9S 4NIVA 1GJDB 1NRRH 4X0WU 4BOHA 2BVXH 3GCHC 3QTOH 1UW7A 2A5IA 6LPRA 4X2VA 1DUAA 3A7YA 1OWJA 5HYOA 2K0QA 1INCA 3CS0A 1W7XH 3SZEA 1Y3VA 1FZZA 4INHA 4A1VA 4ZHLU 2H2ZA 3V12A 2I6QA 4CHAC 5L2ZH 1LHFH 1XKBC 2CMYA 1O5GH 1OWEA 1SR5C 2BMGB 1RIWB 1EP5A 1GJ6A 3BEUA 3OY5U 1A0JA 4YOGA 1O3DA 1WBGB 2OUAA 1AI8H 2A7JA 1WUNH 2A45B 3GYMA 4SGBE 1UK2A 3VB3A 3VXEH 2L6OA 3RXSA 3TJVA 4X6OA 1HJAC 3SJ8A 1AMHA 1ZYOA 4ISIH 3N7EA 1TYNA 3FKSD 1K1MA 2Z9IA 2BZ6H 5CHAC 3OEHD 1C1NA 2WPMS 3SGAE 4ISOA 1XKAC 1PPHE 1HAYB 3SU0A 3SI3H 4BTIB 2F9PA 3PMBB 1GHBF 5A0CA 1J15A 1BQYA 3RMOH 4K1TA 1W0ZU 1IQIA 3RXJA 2EY4C 1ABJH 1L4DA 2WPKS 1EJAA 2R3YA 3A7ZA 1AE5A 1WTGH 3UFAA 2XWAA 3H7OA 4OM9A 3BIUH 2EI6A 1V2ST 1LKAA 2VBCA 1WV7H 1MCTA 4X1QU 1C1TA 1CBWB 3RXEA 5DSFA 3KYGA 1L0ZA 1GBJA 1P06A 2BXUH 2B9LA 4I8JA 1ELAA 1EOLA 8KME2 2XBWA 2P3UB 1PPBH 2WPDD 4RSPA 1NFUA 3P92A 1TNLA 4Y8XA 1KYNA 3W1EA 1KIGH 2JKHA 4CRBA 3M5LA 4IMZA 1KTSB 3PV2A 5DP8A 1QIXB 3H09A 3ZZ3A 2GDEH 3NPSA 2FO9A 3LH1A 2GCHG 3BTQE 1HXEH 1TNJA 4HTCH 3U1IB 3ZVFA 2VIQA 1GI9B 1TPSA 2FTMA 2QY0B 3E3TA 3MMGA 7LPRA 3V7TA 1MTVA 5C5OA 1PQAA 1LQDB 4YESB 1XVOA 1VCPA 1QGFA 4PROA 1ELGA 3FOAA 2QF5A 3F9EA 1O38A 3CS7A 2ZHDA 2BY5X 3SO3A 1TX6A 1YGCH 3F1SB 2IN2A 1XMNB 3UTUH 3I78A 2GMTC 5LH8A 3A8CA 6ESTA 1FAKH 5TCAA 5FBEA 4AYVB 2SGPE 2KCAA 3Q3KA 1AB9C 1V2RT 3TIUA 2B0FA 4Z1MD 3FO8D 1AO5A 2XC5A 1SQAA 5C17A 3H5CB 1ZGVA 3OY6U 3PTBA 4AG1A 1YPKH 3LKWA 3FFGA 5EODA 1QRZA 3BEFB 4F4OC 1C4U2 2QC2A 3LGIA 4MDSA 1JBUH 2TGPZ 1CA8B 1G37A 1LVBA 1RXPA 4XSKU 1C5SA 3OAAD 1O5DH 1B7XB 3L33A 1BITA 1ZTKA 2W3KA 1NBMD 3GOVB 3NK8A 4X1PU 1AWFH 2A1DB 1JIRA 2GP9B 1C2GA 1T32A 4VGCC 1HAOH 2FOEA 4I7YH 3PO1C 3RC5A 3QZQA 2W6ID 4I8GA 3DSOA 3LOXA 4XE4A 2IPQX 4ABJA 2GJGA 3F2GA 3O8BA 3U9AH 1SL3A 2C4FH 2W5EA 1UTLM 1FN8A 5LPFA 1QA0A 3SW2B 1VJ9U 1WXRA 1KXBA 5HMAA 1RFNA 2ZHQH 5EPNA 4BAHB 5HIYA 3ELAH 2A4RA 4WMFA 2Y82A 3TJOA 2HVYB 1CT0E 1PPZA 3FAOA 4X6PA 3MNSA 5GNDA 1HPGA 4KTSA 1LVOA 1UCYE 4U30A 1UK4A 1G32B 2Z94A 5AFYH 2KM0A 2ZPQA 1GHAG 8GCHF 4UD9H 2GGVB 4Y6DA 2FTLE 1EUFA 2BD4A 2WV9A 4GAWA 4BXWA 4XFQA 4AORA 1GI2A 1QRWA 1BTUA 2CHAC 2SGDE 2UUYA 2GT8A 3MU8A 4NZQA 1RS0A 1SGEE 1FJSA 4WWYA 5FXLA 5B6LA 1O3HA 2V3HH 1C1VH 1YBWA 2ODPA 3MNXA 1HAZB 1SLXB 1TOMH 1BTZA 3ATWA 5EG4A 1C2KA 1CGHA 3ZZAA 4DIHH 3UQOA 4HFPB 2KAIA 4QT8C 4MPUA 1RJXB 1QZ8A 1O35A 1GDUA 2K1QA 4FU7A 1GJ5H 3FZZA 2AIPA 4AZ2B 1FXYA 1DXWA 2Z6BD 4NWLA 1WTHD 1EFRD 5C20A 1CBWC 3NWUA 5BPEA 1DX5M 1E35B 3LONA 1XXFA 1P02A 3ODDA 1W0JD 2SGAA 3RXAA 4NFEA 1KDQA 1FY4A 3PTNA 2OQUA 4AYYB 1DFPA 1JRTA 2PGQB 1GI7B 1C2FA 5KECA 2A5AA 2BB4A 3A88A 2JDID 3UIRA 1QBNA 4ABEA 3RXGA 1EZSC 3M3TA 3P17H 3S9AA 1PQ5A 1C5MD 1QJ7B 5A09A 2BDAA 2RDLA 1OKXA 1SGDE 4A1TA 6GCHF 3QLPH 1O3CA 3RXQA 1GJ7B 1TRNA 1ELVA 4HG6A 2HWLB 2ODQA 3TK5A 9ESTA 2PUQH 3BTME 1BTHH 1SQRA 3ZZ5A 4ASUD 1G36A 1NBME 1P12E 4AOQA 1CE5A 4DOQA 2ZDLA 1G3EA 3A84A 4D8NA 2XBXA 1QY6A 4JYVH 1BMNH 5FPSA 1XUGA 3HKIB 4I8HA 2G4TA 4ISNA 1TE0A 3BTHE 4ZCNA 1IQLA 3FP7E 4CRDA 2ZU4A 3MU0A 2WPHS 3MOCA 1SQTA 5DP6A 1C9PA 1SQOA 4B75A 2ANYA 1ARBA 3QGNB 1UTPA 4SGAE 3SNAA 4JYTA 5FPTA 2WHXA 2AMPA 4K69A 1HAXB 1KXDA 1P2OA 1ZZZA 2EA3A 1GHYH 3MO9A 3BTKE 3PM3A 2XNDD 2YNAA 5EIYA 1H8ED 1HNEE 1HJ8A 1Z8GA 2Y7XA 1K1NA 1LVMA 1HV7A 4U32A 3E90B 3MNBA 3A7WA 4CRFA 2NU4E 1ZTJA 1CA0B 1ZHRA 2CXVA 1Z6EA 2Z7FE 2Z3CA 1RD3B 1V2UT 1UTKA 1D6RA 1VKYA 2AMQA 1LQEA 3SHAH 4GUXA 5CHBA 3F2HA 2ZQ2A 1C2JA 1EB1H 2PLXA 1YKTA 3AAUA 2CN0H 3RC4A 4DW2U 1W0KD 2PKAB 1WQSA 2KCYA 2GVFA 2ZFQH 1O0DH 1DWEH 4AB8A 5PTPA 3Q3YA 1CU1A 4MG3A 1KSNA 2BDYA 2CGAA 3QN7A 1O34A 2H9TH 2GX4A 2KZ4A 2XYAA 3M36A 4Q7XA 5DPAA 3MH5A 1GI0A 3TU7H 1J17T 1SBWA 1EJMA 4ISLA 5A0AE 2JETB 4B2BA 3FN8A 2OXSA 3GY8A 3RM2H 3SYJA 1A7SA 3UUZA 1Z6JH 2FOHA 4GLYA 1HCGA 2R2MB 1GBEA 4YTAA 3A87A 4I8KA 3RXBA 3EYDA 1L4ZA 3NXPA 1EQ9A 5GWZA 3F9GA 1MCVA 2C8ZB 5H4IB 4D7GA 4O3UA 4FOUC 4UE7H 1ZSKA 2OP9A 2PR3A 1XUIA 1UMAH 6CHAB 1BT7A 1H8IH 3ENSB 1GGDB 5ESTE 5G4BA 3DSGA 1MH0A 2L74A 3M5OA 3T5FH 1PFXC 3K6YA 1QTFA 4K1EA 1S81A 3SV7A 3BF6H 4K2YA 2PSYA 4NZLA 3EQ0H 4B71A 1ZOMA 2J98A 2QN5T 1CHOF 2HVXA 5GIBA 3A7XA 4K3JA 3RXUA 2BX4A 1MZDA 1O5AB 1ETTH 1S85A 1W0YH 4CBOA 3T2NA 3S7KB 1D3PB 1G2LA 2FI3E 3M3SA 3R3GB 3PRBA 1PQ7A 1GHXH 4Y11E 3SU1A 2Z9JA 3OEED 5DJ7A 1ZGIA 1AQ7A 1ZR0A 2SNVA 3K9XB 3ESTA 3LDXH 3UOUA 3SU2A 2OC0A 1NTPA 1SC8U 3HKJB 1QRXA 3HGNA 1H4WA 4X1NU 1HRTH 3MH6A 3SORA 2P8OC 2WV5A 1NRNH 3S9CA 2V0BA 3E0NB 1L1JA 1UVPA 1EZXC 1HAPH 3QGJA 4ZROA 1VITH 3KCGH 2BD2A 2ZTYA 1D3DB 2ZHFH 4Y0YE 1HGTH 3KQBA 3LGVA 1C2IA 4ZHAA 7GCHG 3DCLA 4XDEA 4Q80A 2CF9H 4ACAA 1QFKH 1AKSA 1D3TB 3GY4A 1MKXK 3SV6A 1EAXA 1W3CA 5C1XA 5KEDA 1GBIA 4FUDA 1O2NA 3O8DA 2XBYA 2V3MA 2DE8A 2RCEA 7ESTE 3MU1A 2WSSD 1V2VT 3QTVH 5T6GA 3EGKH 1O2KA 3ZVBA 1GBLA 4B6FA 1IQEA 1EAUA 3RMLH 3MHWU 2STBE 5JDUB 3MTYA 1CGJE 3BSQA 4ZXYH 2W26A 4MNVA 2V3OH 1ZRKA 3KEEA 2ZF0H 1MU6B 2PTCE 1ETRH 3KGPA 1DM4B 1J14A 1FPCH 3DUXH 2Y80A 3O8RA 1A1RA 2V6NA 4I86A 2BLOA 4J1YA 1K1IA 2UUFB 1L2EA 1DSUA 2PP6A 1Z71A 1AE8H 2O8TA 4BNRA 5CDFE 1SI5H 4FVDA 3FANA 3F3BA 4YOIA 2CF8H 3LC5A 2B7DH 1D9IA 2QA9E 1UTOA 1MKXH 1GCTB 1W7GH 4WVPE 3HK3B 1IQKA 2AMDA 3HGPA 1VJAU 3ZVAA 3SV2H 3ZZBA 1GBFA 2QAAA 4B76A 4JK6A 1C1QA 1DXPA 2XBVA 3RXMA 4YXWD 1BRAA 1W13U 2TPIZ 1K1OA 2PV9B 1CA0C 1OP2A 4DGJA 1MTSA 3BTDE 1TX8A 4ESTE 2G00A 1NFWA 2OCVB 3TK6A 1FI8A 2HLDD 1QURH 1O3NA 2GKVE 4WF8A 2D2DA 2FX4A 1F5KU 1BRUP 3ZZDA 2GD4B 1THPB 3ATKA 1BBRE 3B23B 3UWJH 4UDWH 5L6NH 1LHGH 1V2MT 1AVWA 1P3CA 1DLKB 4OGYA 2STAE 2VNTA 3VB5A 3RXHA 1KXEA 1L1NA 4R8TB 1DE7H 4F49A 3RXPA 2XWBI 3KIDU 2WUCA 2FLRH 1P2JA 1TMUH 4LK4A 5C0TA 2ULLA 2KCPA 1DVAH 1DWBH 3BV9B 4P00A 2TGDA 1SB1H 4XBBA 1A61H 1MTWA 1EX3A 2UWPA 3QX5H 4R0IA 2JETC 5JPMH 1H9LB 2C8WB 4NWKA 5FAHA 1BZXE 2ZCHP 3SV8A 3WW7A 1YY3A 2Z9LA 1YPHC 2CHAB 1ZSJA 1MTNB 2J9NA 1TNHA 6CHAC 1IHTH 3CNRA 1SGFA 5T3HA 4IW4E 1GG6B 1TWXB 2ZFFH 1H1BA 4IN2A 5TCCA 2D1JA 1GGDC 1VITG 2WPLS 3JZ1B 2Q1JA 4GCHG 4KTUA 4K5ZA 3UOPA 2ZFRH 2FI4E 2QYIA 2A2XH 2IOTA 3EA9A 3ATLA 2THFB 3A8AA 1LDTT 3GS9A 2QE7D 1F0TA 1GBTA 4F48B 3ZZ7A 3BN9A 4FETA 1SGIB 1C4Y2 1BJUA 1LHEH 1QQ4A 2G52A 1Z7KA 1CVWH 4FUCA 1NC6A 1KLIH 1ANCA 1S6HA 5IDKA 1QJ1B 4H4FA 3UNRA 1Y59T 1TRYA 1ZRBA 1BA8B 2VIDA 2OC8A 1DSTA 2C90B 1BB0B 2PGBB 3A7TA 2TRMA 4RN6A 2NU1E 4WH6A 3KF2A 1C5XB 1UCYK 1MUEB 2ZFTA 1HAIH 1BRBE 2FDAA 1W10U 2P16A 1G2MA 4E05H 1NRPH 5CE1A 4JZFH 1H8HD 2BDIA 2BX3A 4X2YA 1RTKA 2AIQA 1V2KT 2A5KA 5HM2A 3DHKH 5DN6D 4GHTA 4BXSA 1SLVB 4E06H 2YOLA 2SGFE 4AFSA 1PQ8A 4Y79A 2GCHF 3A89A 3TK9A 4ABIA 4D7FA 3TVJB 1HAVB 4JZ1A 3OSYA 1SFQB 5CMXH 4A6LA 3EE7A 2XNIA 1T31A 3M7TA 3TLOA 3EDXB 3C27B 1GMHG 3QWCH 4NCYA 1UK3A 3P70B 2ZHWH 1SGNE 4H6SB 1B0FA 2C3SA 1YPLH 5SGAE 1P2QA 4TYDA 1UCYH 1JWTA 4FU8A 3ZIAD 2FP7B 1BOQA 1F0RA 5C1UA 3QUMP 2AFQB 1O3KA 2DUCA 4Q63A 1THSH 3GY3A 4AFQA 1MZAA 1C9TA 3L3TA 1CHGA 2JJ1D 1YPGH 3U69H 1GCTC 3MQKC 3RM0H 1QNJA 2JH5D 4Y76A 2BD9A 1EPTB 2UWLA 4BAOB 1FV9A 4A7IB 3DD2H 1AHTH 1UHBB 2ZI2H 2VIVA 3ZYDA 3OYPA 1C1RA 2G5NA 4UFGH 1GJAB 4RI0A 2FI5E 3LU9B 2VIOA 1ARCA 2O9QA 4TWYA 2ZHEH 5JB8S 3RU4D 2D8WA 1T8NA 1K22H 1O2UA 2FOFA 4ZKOU 1C2EA 1GDQA 4U01A 2HRVA 2ZDKA 1N6YA 4NIWA 2QF0A 4KP0A 4CH8B 4YOJA 1GJ4H 1O3EA 1TFXA 1IQNA 2NWNA 4XOJA 4CRGA 4XBCA 3F6UH 3T27A 1TGNA 2XCFA 4OS4A 1EZQA 2QXJA 1Z8IB 3N7DA 3A8DA 2FOAA 1ZPBA 3M7QA 1EKBB 1P04A 1FY3A 1GI5A 2W7UA 1E79D 3BG8A 2ASUB 3A80A 1L1GA 3OTPA 4MPWA 4YO9A 4BANB 3C1KA 5DP4A 1UJ1A 2GZ8A 2WV4A 2WPJS 1SHHB 2HNTF 2F4LA 1E1QD 3GY6A 3Q3XA 5JBBS 1YPMH 3N99A 1FUJA 2Y5FA 1UVTH 1P11E 2F9OA 1OX1A 4ZH8A 2XCNA 3MO6A 1A3BH 4D76A 5JBTA 1A2CH 1C5YB 3KQEA 1GHAF 2Z9GA 2VIPA 5C67A 1ZPCA 3LPRA 1S84A 2F43B 1A4WH 1Y3XA 2B5TB 2UUJB 2VGCB 3QK1A 1T8OA 3V3MA 1MTNC 4UFFH 4B73A 1TGTA 2A7HA 3P8GA 3E0PB 1GG6C 1VGCB 2Y7ZA 1ANBA 1A5GH 3KL6A 1SOZA 1AFEH 2G51A 4ZMAH 1ZHMA 4J2YB 2W6JD 1ZMJA 4RKJB 1ELDE 1YC0A 3TJNA 1YLCA 1FQ3A 2QXIA 5LPRA 1S82A 4KELA 1MAYA 3VPKA 4ABBA 2ESTE 2CK3D 1T8MA 2EI8A 5EJLA 5B6OA 1N1LA 3BTWE 1LKBA 1J9CH 3WY8A 2G81E 3KQCA 1QA7A 2RA3A 8LPRA 3LGUA 2OBQA 2ALPA 1AN1E 2P8OB 1P9UA 1BTWA 4UFDH 1GJ9B 1SGTA 3SNDA 1MMJN 4H6TA 1U6QA 4ZXXH 4BAKB 1Z8JB 1RRKA 3TPIZ 5EGMA 4K8BA 4JZDH 3OE7D 3MH4A 3RXFA 2P3FH 1TGSZ 1V2QT 1TNIA 2VWOA 3BTEE 1T4VH 3TH4H 3V0XA 5KGOA 4UEHH 1JMOH 1QL9A 2J95A 1O30A 1QHRB 1O3AA 3SJKA 1Y5BT 5T6DA 2ZNKH 4BTTB 1AZZA 1W11U 2AHME 1DY8A 1FAXA 1P10A 1Y3WA 2Q6FA 5DO4H 3MO3A 5FCRA 2AYWA 3TGKE 2R0LA 1XX9A 1GBDA 3A81A 1S0RA 4NSYA 5HKKD 4X8VH 3G01A 1BMLA 2SFAA 3ZVEA 4KGAA 2Z3DA 3RU4E 4YM9A 4ZKRU 2WYJA 1GBKA 2FOGA 5ETXA 5FBIA 3SUFA 3SNEA 4ZUHA 3W95A 5GJ4B 5EW1H 1AUJA 2FOMB 2H5DA 3D49H 2P93A 3A86A 1H9IE 5F53A 4WJG2 2JJ2D 2V7QD 2PTNA 2TBSA 2HPPH 3KQ5A 4AGJA 2QXHA 1HUTH 1CGIE 1AZ8A 1GI8B 1GMDG 3GCOA 3BG4B 1O2TA 2G55A 1P05A 1P09A 3M61U 3RXRA 1J8AA 4TSFD 3KN2A 5FL7D 2G8TA 1MKWK 4AG2A 1NS3A 4HZHA 4Z6AH 3D23A 2UWOA 1E36B 2HPQH 1GVZA 4DT7B 3VGCC 1K0HA 2VVCA 1AFQB 3P8FA 4AN7A 3SJ9A 1JXPA 2BDCA 3E8LA 4OS7A 2BQWB 4MTBA 1TNKA 2PKSB 3Q76A 3SOSA 1GBHA 1EPTC 1J16A 1PPEE 3FZDA 1SLUB 3RMNH 2VB0A 2HNTC 1LCYA 1C1PA 1ANEA 2BZAA 3GCTG 4X8UH 3K65B 2PKAA 4IMQA 2W3IA 1RTFB 2BVRH 2VVVA 2VH6A 1FX0B 2XC0A 4TY7A 1C5UA 4X1RU 4D9QA 1C1OA 2C8XB 5EQQA 1ZHPA 2BY7X 2GCTB 4X2WA 2ANMH 3SNCA 4X8TH 1MKWH 3U1JB 1FLEE 3ZV9A 3VFEA 1EXFA 1LHCH 3MWIU 1C1WH 5F6MA 5DP5A 1OP8A 5EQSA 3TNSA 5LGOA 1O3FA 1O2RA 2SNWA 2H5CA 1S6FA 3W94A 5EJ1A 3H7TA 1PPFE 3E16B 1MABB 2YMSB 1P2KA 2ZPSA 3PMJA 2A31A 3RUOA 2FIRH 4YT6H 4ACBA 1AVXA 1G3CA 1YPHE 2IJOB 3D62A 3GDVA 3ZVDA 3URDA 5T6FA 4DT4A 5C2ZA 1UTJA 2FXRA 2BVSH 4IGDA 1BDAA 1MAXA 4MVNA 2XRCA 4ZAEA 4CRAA 1QCPA 4HGCA 4MQAA 1BCUH 1O3BA 2VGCC 2J97A 1KTTB 1KXCA 4XBDA 1E38B 1VGCC 4DVAU 2LP6A 2BD3A 2F9VA 1BBRK 3RDZA 1NO9H 1TLDA 1Y3UA 1FMGA 4RT0A 3A83A 5IK2D 1JIMA 3SUGA 1DUEA 2R0KA 2OC7A 1BHXB 5K7RA 1C1SA 4MLFB 3ZYEA 3LGTA 1O3LA 1O5EH 2A7CA 3SU6A 3UB0A 1P2IA 3KYFA 3PB1E 4FUGA 4X8SH 1G9IE 1UVOA 5A8YA 1O2ZA 3RMMH 1AIXH 2B8OH 3M5NA 4ABAA 1O2JA 1C5NH 1P9SA 1TBQH 4DG4A 1NROH 1O5CB 1QB6A 3UREA 3IITA 1OWDA 3STJA 3GISB 1TOCB 2ZTXA 1P8VC 5E0JA 1MTUA 7GCHF 3FP6E 3F9FA 5C1YA 1COWD 3UR9A 1BBRH 1X7AC 1KXFA 2Q6DA 1F92A 3SU3A 4CR5A 2ZGCA 1TABE 2RA0A 1O5BB 2FZZA 1GBAA 2XC4A 2ZP0H 4HI3A 4MNXA 1TA6A 1WOFA 1GMCG 4YLUA 4ZHMU 3NCLA 4MNYA 3GDUA 1QR3E 1O2IA 4Q4LA 1OYTH 1W8BH 2FPZA 2NU2E 4GPGA 4NGAH 1Q31A 5T1VA 2GZ7A 3MU4A 4FUFA 1IOEA 1C5ZB 1G30B 4B6EA 1MD8A 1ACBE 1YP9A 3A85A 4A5TS 3F9HA 3TGIE 1OS8A 2H9EH 1BMAA 1IQGA 1NY22 1P3EA 1PPCE 3NRLA 1TGCA 3OU0A 2Y81A 3ZVCA 1M9UA 5AHGH 2F91A 3BG4C 1BIOA 1SGQE 4I8LA 4YLQH 2BD8A 3ZV8A 4A92A 1OWIA 5I46H 1HIAB 3SQEE 2OD3B 3ATIA 1O32A 4WMDA 5LPEA 1IQJA 1N8OB 4TPIZ 1UTNA 2DE9A 1NU9A 1O2QA 2BLWA 2J4IA 2C8YB 1AFQC 1GJCB 1IAUA 1V2WT 1SVPA 2ZU2A 1LTOA 4JZEH 1VR1H 2RFKC 5C94A 2PKSC 1NESE 1YLDA 1C1MA 3M3VA 4AFZA 1HB0B 5EOKA 4JCNA 1WCZA 9LPRA 2QF4A 2BYAX 3B9FH 2OK5A 2M5TA 4O03A 1ELCA 4CH2B 4FUBA 1WQVH 2V35A 1EJNA 5GCHG 3P95A 5AVDA 1EB2A 1V2NT 3UR6A 1LVYA 1O3GA 2JIZD 4MNWA 4IS5A 5A8XA 1O3JA 3SZNA 1HFDA 1HLTH 2ZEBA 3DA9B 5C0UA 1C5RA 2VWMA 2GCTC 2JH0D 3QDZB 5A2MH 1TMTH 1O2VA 1FNIA 1BUIA 3U8OH 4YZUA 1OWKA 1HAHH 2Z3EA 3SU5A 2HGTH 1GVKB 2ZFSA 2AGGX 3SV9A 5FHTA 3MNCA 5F8TA 1C5QA 4Y0ZE 2Y5HA 1OP0A 4NIYA 4I32A 3Q77A 1TAWA 3P6ZB 2FEQH 5L30H 2A4OA 1O31A 1VCWA 3ITIA 3A82A 1K9OE 1VCQA 4FXGH 3DFJA 1GHVH 2YMSC 2XTTB 1Z8RA 1XUHA 4DY7B 3MYWA 4OS1A 2G5VA 4B2AA 2O8MA 5E2PA 2ZU3A 1D3QB 3EA8A 1Q2WA 4Q7ZA 5E0HA 1GI4A 1TIOA
chains in the Genus database with same CATH topology
5DG6A 1UTQA 1XUFA 2EI7A 1FDPA 3RLYH 1ELTA 3Q00A 3LJJA 1TRMA 1O2WA 1VITF 3M37A 4GCHF 3CP7A 4DURA 3EAJA 3SN8A 2G4UA 1DICA 4CRCA 2FS8A 5FCKA 1T8LA 5DGJA 1Y3YA 1V2OT 5A0BA 2BOHB 1ABIH 2EC9H 3M5MA 1T4UH 4INLA 3SHCH 3VEQB 1ZJDA 1V3XA 4ISHH 1D6WA 4Y7BA 2BLVA 3IG6B 3N7OA 5DK1A 1HXFH 2NU0E 1YYY1 1O3PB 1LPKB 1GHBG 2J34A 4KKDA 1ELBA 2VU8E 3KHVA 3T62A 1DT2A 4D9RA 5TJXA 2FX6A 1SHYA 4GHQA 1Z1JA 3R0FA 3U8RH 1ETSH 5EQRA 4MPXA 4TY6A 5J4SA 2ZQ1A 1NM6A 2BQ6B 3RXVA 2J92A 3GCNA 1JOUB 1F0UA 1MU8B 3NUMA 1C5WB 3QO6A 3FVFB 3B8JA 1DY9A 4NFFA 2ZDNA 4NA8A 1T7CA 1P0SH 4E7RG 1HAVA 2QGRA 1S0QA 4FUJA 1HYLA 1UVSH 3GYLB 4DIIH 5DP3A 1SGFG 1TONA 2GTBA 2ZWLH 1OXGA 3ZZ6A 1A5IA 1QL8A 7KMEH 5A8ZA 1TGBA 3MU5A 3T26A 3UNSA 2Y5GA 1PJPA 2R2WU 3E6PH 3SUEA 1BJVA 3GDSA 1DDJA 4Y10E 4ASHA 4GVUA 4M7GA 1ZLRA 1GMHF 3UQVA 4BAMB 4FU9A 5F8ZA 4X6NA 4BTUB 2J2UA 1XVMA 3ZZ9A 4Y7AA 1SOTA 3A8BA 4X1SU 1ELFA 1AU8A 1TQ7B 3SQHE 1EAWA 3VB4A 4ZKNU 2A4GA 2ZA5A 4IN1A 2VWNA 4X6MA 1MBMA 2VWLA 3VGCB 1DWDH 2ZU1A 1O33A 1EPTA 1UHBA 4JYUH 5EU8A 1THRH 3M7UA 2HOBA 5F8XA 1TB6H 1D4PB 4KTCA 3TGJE 2ZIQH 1WSSH 1DWCH 1XXDA 2HNTE 2FYRA 1O3IA 1N8OC 1TBRH 2TGAA 4INKA 1C4V2 1IQFA 3AASA 2VJ1A 2ZU5A 1KLTA 2BM2A 3GY5A 2ZKSA 3RXIA 1BTYA 1QBVH 1UO6A 1NFXA 1ESAA 1MQ6A 1C2MA 1O3MA 1GI3A 1K1PA 2OLGA 4FUIA 4MPVA 4LZ4B 1V2LT 1C5LH 1TPOA 2F9NA 1GWAA 3PLKA 3GY7A 3M35A 1A3EH 1FY1A 3UY9A 1AUTC 4H42U 1DS2E 1F7ZA 3UNQA 3SGQE 1TA2A 1CQQA 1GHZA 5EPYA 2AGEX 4YT7H 1V2TT 1ZMNA 1WAYB 4Z0KA 3RXLA 2BTCE 1W12U 3NZIA 1IQMA 3RXOA 3SJOA 2ZG0H 2BD5A 1O2PA 1P2MA 5E2OA 1AWHB 2PW8H 2ZGJA 1ANDA 3VB6A 2ZZUH 2VVUA 2BY8X 1ZMLA 2RG3A 3RXTA 1ZJKA 2OTVA 1C5PA 1O2LA 3I29A 1W14U 2A2QH 1GL0E 3BTGE 3HATH 3SBKA 2TGTA 1XUKA 1TX7A 3TNTA 1O2YA 3TH2H 5JBCS 3AAVA 1TPPA 4LXBH 3GICB 3RP2A 4IBLH 1F2SE 1CSOE 2IPHA 3LJOA 4AFUA 8GCHG 3T25A 1RIWC 1O2OA 1ORFA 5J4QA 1OYQA 2H1UA 1AD8H 4WXIA 3S0NA 1C2LA 2FWWA 2WUBA 1NFYA 2FODA 3PWBA 2F9BH 1P03A 3MFJA 2QIQA 3UPEA 2BY6X 1E0FD 3VXFH 1JRSA 3PYHA 1GBCA 1K28D 1V2JT 1UVUH 1CT4E 1ELEE 5EW2H 8ESTE 5K0HA 1EASA 1NZQH 3DFLA 4DJZB 4WH8A 3E1XB 2QF3A 3MH7A 2BHGA 3FP8E 1QBOA 2PSXA 1EP6A 1O2HA 2AEIH 2OQ5A 4DCDA 1GI1A 1DPOA 1PYTC 1BTPA 2ALVA 3VB7A 3PWCA 1C1UH 1GVLA 1TBZH 4O97A 1Y5UT 3CENA 2ZC9H 3SU4A 2WINI 2KAIB 1AY6H 3PLPA 4K8YA 3S69A 1GDNA 1AVGH 1SLWB 3HK6B 3LGYA 3SNBA 2BD7A 2OBOA 2D26C 2O8WA 4ABFA 3AVZA 3URCA 4B2CA 1BTXA 2PHBA 1A46H 3TH3H 1O39A 4Q2KA 1DOJA 1K21H 1TMBH 3SJIA 3BTFE 5FX6A 1B5GH 4IC6A 1FY5A 1C5OH 4B1TA 1QB9A 3ZVGA 1QB1A 2JH6D 5FPYA 1KDQB 3RXCA 1DANH 4ABHA 1S5SA 2ZTZA 6GCHG 1C2DA 3ZZCA 2ODYB 1OPHB 5AFZH 4OGXA 1IHSH 1B0EA 2ZGXH 4WMEA 1GBBA 1S83A 4WXVA 2OC1A 1Y5AT 3S7HB 3LGWA 4THNH 3LC3A 5HGGA 1HDTH 1GMDF 1SGPE 2AERH 2I6SA 3NKKA 2BQ7B 4K1SA 1DITH 2BY9X 2BDHA 4LOYH 2FYQA 1Q3XA 1E34B 1VZQH 3OTJE 2A0QB 1O2MA 3AW0A 5E8EH 2GDDA 4FUHA 1FY8E 1GJ8B 1HAGE 1YF4A 1AGJA 1WU1A 3GCTF 1F5LA 1EOJA 1SSXA 1MD7A 4B74A 2ANWA 1O2SA 1XUJA 3L6PA 1O36A 4U2WA 4FVBA 2NU3E 4A1XA 1P57B 2QCYA 2F83A 2ZDVH 1GI6A 4I33A 4Y71A 2ZPRA 3RC6A 4OS6A 3ODFA 2ILNA 2ZCLP 3V13A 4I31A 1FIWA 1K1LA 2ZDAH 2BLQA 2LNCA 3D65E 3ZZ8A 5F03A 3LT3A 1Z1IA 2GV7A 3IWMA 1XM1A 2R3UA 1NRSH 1EAIA 3P8NA 2FOBA 3GCHB 4NSVA 5DP7A 5C3NA 1PPGE 2FMJA 2CJIA 1ESTA 1TQ0B 3U8TH 2F9UA 4CHAB 2QXGA 4X2XA 4Y8YA 2ZGBH 1OWHA 1QJ6B 2Q6GA 1A0HB 2J38A 1C5TA 1CT2E 1C2HA 1GCDA 2PUXB 2R9PA 5DP9A 2A4QA 3I77A 1KLJH 3PMAB 1KXAA 3SI4H 1O2XA 1ID5H 3A7VA 1OOKB 2PFEA 1SGRE 3EA7A 1A5HA 1ZSLA 2H6MA 2HALA 5E0GA 5C5NA 4CBNA 2PWXA 4UFEH 3EE0B 2FS9A 4NA9H 2C93B 3E91A 1TPAE 1LMWB 1HJAB 4E7NA 2XW9A 3SGBE 5EXMA 1GPZA 1SPJA 1CHOG 1QQUA 1C5VA 5CHAB 5IYTA 1NRQH 2H9HA 1IQHA 1QL7A 2GV6A 3T29A 3RLWH 4NIXA 1LPZB 2BDGA 4ABDA 2AS9A 1YPEH 5I25A 4JMYA 4TPYA 5JYIA 2VH0A 2ZFPH 1FPHH 5GXPA 3MI4A 4Y8ZA 1LHDH 2FESH 1SGYE 4O3TA 5AF9H 4RKOB 2WPIS 2FM2A 3U98H 3JZ2B 2ANKH 1NPMA 2VINA 1ZPZA 1K1JA 2BOKA 1DLEA 2ZECA 1YPJH 1O37A 1P2NA 5GPIB 1OSSA 2Z9KA 2SGQE 2ZO3H 1FIZA 3HPTB 3OX7U 2Y6TA 1WYKA 4IC5A 1MQ5A 3RU4T 1G3BA 4WY3A 4AX9H 2F3CE 3PV4A 5L2YH 2FLBH 1NT1A 4FUEA 3SUDA 1O2GH 4NA7A 2QV1A 4ZKSU 3GY2A 3S9BA 4AB9A 1EATA 2TIOA 5JBAS 2UUKB 1BHXF 1P01A 4CR9A 4LZ1H 1GMCF 3PROA 1SG8B 1Y8TA 2CV3A 1PYTD 2VIWA 2W7SA 3F68H 3PLBA 1O3OA 3DT0H 4AGKA 1AKSB 1V6DA 1UTMA 1YCPM 3QZRA 3PMHB 4JZIA 2LPRA 1N6XA 4UONA 5GDSH 3O8CA 3BIVH 1NN6A 1HIAA 1TNGA 2ZGHA 1H9HE 2OINA 2ZDMA 4OS5A 1FN6A 5DKMA 1YCPK 1F5RA 2GMTB 1HBTH 1G3DA 2GZ9A 2P59A 1KY9A 3KNXA 1AB9B 2J94A 1F0SA 1H8DH 4JK5A 1W2KH 4O9VA 1O5FH 2A32A 1LPGB 2GT7A 4CREA 3K6ZA 5HM9A 1FONA 1ESBA 2BXTH 4GSOA 1SFIA 2HLCA 3BEIB 3TJUA 1RTLA 3T28A 3LH3A 1GHWH 2O8LA 3STIA 5EXNA 1V2PT 1A0LA 1TALA 2P94A 4K60A 3AW1A 3KQDA 3LIWA 1ZTLA 2P3TB 1YM0A 1GBMA 4Q7YA 1SGCA 3TITA 1K2I1 2AGIX 1GJBB 4OS2A 1MBQA 3ZZ4A 1NU7B 2YNBA 2P95A 3UWIA 1CO7E 3P8OA 1BRCE 5HXFA 4ABGA 4TWWA 3RXDA 2XXLA 5GCHF 1HJ9A 3RXKA 1LO6A 3ATMA 3K2UA 5ABWA 1YCPH 2WYGA 2EEKA 1E37B 4NG9H 4VGCB 5BRRE 5EXLA 2O8UA 3PO1B 1BMMH 1RGQA 1GL1A 2SGEE 2BDBA 5ESBA 1EZUC 5FX5A 1SMFE 2AH4X 2FOCA 2ZCKP 3BTTE 4BAQB 5JB9S 4NIVA 1GJDB 1NRRH 4X0WU 4BOHA 2BVXH 3GCHC 3QTOH 2A5IA 6LPRA 4X2VA 1DUAA 3A7YA 1OWJA 5HYOA 1INCA 3CS0A 1W7XH 1Y3VA 1FZZA 4INHA 4A1VA 4ZHLU 2H2ZA 3V12A 2I6QA 4CHAC 5L2ZH 1LHFH 1XKBC 2CMYA 1O5GH 1OWEA 1SR5C 2BMGB 1RIWB 1EP5A 1GJ6A 3BEUA 3OY5U 1A0JA 4YOGA 1O3DA 1WBGB 2OUAA 1AI8H 2A7JA 1WUNH 2A45B 3GYMA 4SGBE 1UK2A 3VB3A 3VXEH 3RXSA 3TJVA 4X6OA 1HJAC 3SJ8A 1AMHA 1ZYOA 4ISIH 1TYNA 1K1MA 2Z9IA 2BZ6H 5CHAC 1C1NA 2WPMS 3SGAE 4ISOA 1XKAC 1PPHE 1HAYB 3SU0A 3SI3H 4BTIB 2F9PA 3PMBB 1GHBF 5A0CA 1J15A 1BQYA 3RMOH 4K1TA 1W0ZU 1IQIA 3RXJA 1ABJH 1L4DA 2WPKS 1EJAA 2R3YA 3A7ZA 1AE5A 1WTGH 3UFAA 2XWAA 3H7OA 3BIUH 2EI6A 1V2ST 1LKAA 1WV7H 1MCTA 4X1QU 1C1TA 1CBWB 3RXEA 1L0ZA 1GBJA 1P06A 2BXUH 2B9LA 4I8JA 1ELAA 1EOLA 8KME2 2XBWA 2P3UB 1PPBH 4RSPA 1NFUA 3P92A 1TNLA 4Y8XA 1KYNA 1KIGH 2JKHA 4CRBA 3M5LA 4IMZA 1KTSB 5DP8A 1QIXB 3ZZ3A 2GDEH 3NPSA 2FO9A 3LH1A 2GCHG 3BTQE 1HXEH 1TNJA 4HTCH 3U1IB 3ZVFA 2VIQA 1GI9B 1TPSA 2FTMA 2QY0B 3E3TA 3MMGA 7LPRA 3V7TA 1MTVA 5C5OA 1PQAA 1LQDB 4YESB 1XVOA 1VCPA 1QGFA 4PROA 1ELGA 3F9EA 1O38A 3CS7A 2ZHDA 2BY5X 3SO3A 1TX6A 1YGCH 3F1SB 2IN2A 1XMNB 3UTUH 3I78A 2GMTC 5LH8A 3A8CA 6ESTA 1FAKH 5TCAA 5FBEA 4AYVB 2SGPE 3Q3KA 1AB9C 1V2RT 3TIUA 2B0FA 1AO5A 2XC5A 1SQAA 3H5CB 1ZGVA 3OY6U 3PTBA 4AG1A 1YPKH 3LKWA 3FFGA 5EODA 1QRZA 3BEFB 4F4OC 1C4U2 2QC2A 3LGIA 4MDSA 1JBUH 2TGPZ 1CA8B 1G37A 1LVBA 1RXPA 4XSKU 1C5SA 1O5DH 1B7XB 3L33A 1BITA 1ZTKA 2W3KA 3GOVB 3NK8A 4X1PU 1AWFH 2A1DB 1JIRA 2GP9B 1C2GA 1T32A 4VGCC 1HAOH 2FOEA 4I7YH 3PO1C 3RC5A 3QZQA 4I8GA 3LOXA 4XE4A 4ABJA 3O8BA 3U9AH 1SL3A 2C4FH 2W5EA 1UTLM 1FN8A 5LPFA 1QA0A 3SW2B 1VJ9U 1KXBA 5HMAA 1RFNA 2ZHQH 5EPNA 4BAHB 3ELAH 2A4RA 4WMFA 2Y82A 3TJOA 1CT0E 1PPZA 3FAOA 4X6PA 3MNSA 1HPGA 4KTSA 1LVOA 1UCYE 4U30A 1UK4A 1G32B 2Z94A 5AFYH 2ZPQA 1GHAG 8GCHF 4UD9H 2GGVB 4Y6DA 2FTLE 1EUFA 2BD4A 4GAWA 4BXWA 4XFQA 4AORA 1GI2A 1QRWA 1BTUA 2CHAC 2SGDE 2UUYA 2GT8A 3MU8A 4NZQA 1RS0A 1SGEE 1FJSA 4WWYA 5FXLA 1O3HA 2V3HH 2ODPA 1C1VH 1YBWA 3MNXA 1HAZB 1SLXB 1TOMH 1BTZA 3ATWA 5EG4A 1C2KA 1CGHA 3ZZAA 4DIHH 3UQOA 4HFPB 2KAIA 4QT8C 4MPUA 1RJXB 1O35A 1GDUA 2K1QA 4FU7A 1GJ5H 3FZZA 2AIPA 4AZ2B 1FXYA 1DXWA 2Z6BD 4NWLA 1WTHD 5C20A 1CBWC 3NWUA 5BPEA 1DX5M 1E35B 3LONA 1XXFA 1P02A 3ODDA 2SGAA 3RXAA 4NFEA 1KDQA 1FY4A 3PTNA 2OQUA 4AYYB 1DFPA 1JRTA 2PGQB 1GI7B 1C2FA 2A5AA 2BB4A 3A88A 3UIRA 1QBNA 4ABEA 3RXGA 1EZSC 3M3TA 3P17H 3S9AA 1PQ5A 1C5MD 1QJ7B 5A09A 2BDAA 2RDLA 1OKXA 1SGDE 4A1TA 6GCHF 3QLPH 1O3CA 3RXQA 1GJ7B 1TRNA 1ELVA 2HWLB 2ODQA 3TK5A 9ESTA 2PUQH 3BTME 1BTHH 3ZZ5A 1G36A 1P12E 4AOQA 1CE5A 4DOQA 2ZDLA 1G3EA 3A84A 4D8NA 2XBXA 1QY6A 4JYVH 1BMNH 5FPSA 1XUGA 3HKIB 4I8HA 2G4TA 4ISNA 1TE0A 3BTHE 1IQLA 3FP7E 4CRDA 2ZU4A 3MU0A 2WPHS 3MOCA 1SQTA 5DP6A 1C9PA 1SQOA 4B75A 2ANYA 1ARBA 3QGNB 1UTPA 4SGAE 3SNAA 4JYTA 5FPTA 2AMPA 4K69A 1HAXB 1KXDA 1P2OA 1ZZZA 2EA3A 1GHYH 3MO9A 3BTKE 3PM3A 2YNAA 1HNEE 1HJ8A 1Z8GA 2Y7XA