2VOPA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer auuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
b'EKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vopA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vopA02
1KU9A 4KIBA 1I1SA 2MKSA 1YHQS 2GXBA 4ESBA 1MDMA 2DO4A 2LSOA 2MQMA 2KM8C 2WTEA 4ZYDA 4P9UA 3J81K 2ADBA 2XSFA 1XDSA 3TO7A 3BJAA 4L9NA 3BY6A 4BHCA 3WGIA 1YYVA 1XB4A 4B8XA 1R1TA 1JMTA 1VQ8S 3OW2R 5AIPA 2LF8A 2EVZA 2XAQA 1HD0A 2HYFA 1VQLS 4WK8F 3K2ZA 1VC5A 4RAYA 3HRMA 1Q1HA 4RGSA 3B4DA 5FFZA 3I53A 3TO9A 3FXRA 1P1TA 4CYDA 3FX3A 4AD9A 2LMIA 2CPHA 5D6EA 2A61A 5DCMB 2BEOA 2CO5A 2KRBA 1D8KA 2M88A 3G71S 1VQ4S 4WF2A 1B9MA 1F9NA 2KVIA 2QVOA 2F3JA 1NO8A 2H09A 1YFHA 2HZCA 1S8NA 3I55S 1K9MT 1D5VA 2DITA 2OTJS 2W85A 3OV8A 2CQ2A 3L7WA 4G8XA 3F21A 4FXWA 1YS6A 4Z2XA 2VBZA 5DUKA 2M45A 2QQ9A 5E1WA 3UCZP 2MMYA 1WSUA 1P6RA 3NQOA 2F9JA 5EEGA 4L5JA 1X4BA 3C7JA 4QQBA 5AIQA 4KA4A 1YLFA 3LAPA 2IVMA 1WI6A 4RU2A 1JE8A 1DHMA 2L02A 4LG0B 1X5OA 2KT5A 3G73A 1MKMA 3NNHA 2MZQA 2PG4A 1S7OA 2O03A 5IT3A 2Z33A 1FZPB 1S79A 2JVOA 1FNXH 4BYYA 1W5SA 3EETA 2DNNA 4TV7A 4A5MA 5HS7A 2NYXA 3K0LA 2NS0A 2MQLA 5IFMA 3FXQA 1WWXA 3V4GA 3F6OA 1CF7A 1PGZA 1NHAA 1WF0A 3LA2A 4A6EA 5EN1A 3ZZZA 3CO7C 1H9TA 3G8SA 1SMTA 4L9VA 2OQGA 3SZPA 2M70A 3GFJA 3DQVC 2J76E 2P7VB 3ZQ7A 1FP1D 2AXLA 1NJIT 5LSOA 2M5WA 5LBQA 3ULHA 4F26A 3BO4A 5DDGA 3ZN1A 3GFMA 2E5JA 2XIGA 1I27A 4HYEA 4ZH4F 2DHSA 4C0OC 4QWQA 2FU4A 1P4XA 1U5TA 1VC6A 3U2RA 3KP3A 3M8FA 3B73A 3RYRA 1HA1A 1J0RA 1ZLJA 3VAMA 2U2FA 4OMYA 2DK5A 3VF0B 3IKVA 2Q2EA 2PBIA 4RS8A 1DPRA 1KQ9A 2ISYA 3T5XA 4G9YA 1R7JA 2IRFG 2AYBA 2QM3A 1XGMA 5HDKA 1FHTA 1WKMA 3IRRA 2STTA 1ZHFA 1UHWA 3L9FA 2DNYA 2DTRA 3PIPQ 1AUDA 3V8LA 3TGNA 2CWEA 2O6GE 1J75A 2Z5UA 1UB9A 4WXCA 2HFHA 3RIRA 1I1GA 4M72A 1OPCA 3F8MA 2MLGA 2MPUA 4U7DA 1FNNA 3BJ6A 3FF5A 4B09A 5LXYA 2M9KA 1IN8A 4PR6A 3C1DA 2ESHA 3H92A 4EV0A 3WTWC 4Q48A 3V7RA 5KVRA 1S6LA 3CF5Q 1XDUA 4L0YB 2ELHA 1R5HA 3EYYA 1DRZA 1HSTA 1IN5A 3G4SS 5DDQC 1WEXA 4YB1P 4AVPA 1AWCA 4I0AA 2X4HA 4C7QA 1U1MA 1XMKA 2KIMA 1PP7U 2DNQA 1LB2A 4KIGA 5BMZA 3BJOA 2P8TA 2KYXA 3R4KA 1ZLKA 2MB0B 5DCMA 4R79A 1KQSR 3K1NA 2ZJQQ 4OIQF 2K7LA 4HW0A 3ABUA 5ED4A 2VT3A 5JI6A 3SDEA 3RPUA 4P96A 1XSDA 2KI2A 2XVCA 4EJVA 2V1DA 4IJAA 2EB7A 2L01A 1ZZFA 2KXHA 5L3DA 2JPCA 2OIHA 2ADUA 2RC4A 2HQRA 1U1NA 2LXUA 2DGTA 2N82B 2DHXA 4P5OA 4PDKA 2I38A 1FC3A 4LG0A 5CXTA 1FBQA 1BC7C 1W7PB 2Q79A 5D78A 5BQTA 2MQNA 1UHMA 2A69F 1H2UX 1H2VZ 2YPRA 2DNLA 2J5OA 4LB5A 4CH0S 4IRHA 4KYWA 2MD5A 4F7ZA 4Y00A 3E6BA 4ENKA 3F8BA 1DUXC 1TNTA 3VAHA 4KN7X 5DCFA 2MKKA 2RV8A 1MJBA 5LLQA 2MZJA 3WGGA 1RIOH 2MSSA 5DDRC 4EJUA 1FYKA 2GA1A 1QZYA 3VEPA 2EFNA 4UQTA 4YFKF 1RZ4A 2M30A 4UHTA 2F5CA 5HO4A 4EJWA 3KZZA 3R60A 1UP1A 2E5GA 1RUNA 2CQGA 1O7FA 5GAEU 3V8KA 1VBXA 2NRAC 2DBBA 3EX7B 5GADU 1FJEB 5L3EA 1O57A 2RNEA 2JSCA 4D0PA 3DPTA 1S72S 3TQNA 3BO3A 1UCRA 3J80Z 2EFQA 2IP2A 4CXFA 3KP6A 3TO6A 1TNSA 2VBXA 5FO5A 2GQQA 1WHWA 1YJNS 1BI0A 1L3LA 3KLOA 4MHGA 1N52B 1SJ3P 2O3FA 2KG1A 3CCSS 4EM0B 5GVQA 3ISPA 2G4BA 3WTZA 4ZZLA 2DNZA 3V7SA 3LQVA 3IWNC 2VT2A 2F5FA 2FNPA 4G7HF 2MQPA 3KZYA 2X1FA 2LCWA 3F3XA 2M87A 3TDZC 1HSJA 3HSRA 2R7FA 1XN7A 4EM2A 1D8ZA 3BWGA 2BE5F 3US5A 4R1HA 3WGHA 2M0GB 3OOPA 1WELA 1YIOA 3WU1B 2XNQA 3CXCR 2FSWA 2RQCA 2KM8B 3ZMSA 1BOAA 4M9SA 5D6FA 1R8PA 2DB1A 2LKZA 1GVJA 1R00A 1FT9A 3I58A 1EH8A 3MZHA 3J81Z 3FM5A 1OYYA 2HGCA 3JW4A 2XAGA 1G2EA 1Z7UA 2DH8A 3R27A 4L9JA 3FMSA 2MBFA 1VC0A 2LEAA 3C3WA 3ZMDA 1X5SA 1WI8A 2K4JA 4P6QA 3FZVA 3DV8A 3MUMP 3P5TL 5DEQA 1IAWA 2VODA 4A12A 4U0YA 4C4WA 1KGSA 4A5NA 3I64A 2O3DA 1HXDA 2ZO4A 5HDGA 5LRSA 2UZKA 3THTA 4WKRA 1TBXA 2X1AA 3E5XA 2AYMA 1ON2A 1ONVA 4L18B 3LWFA 1MD0A 1BC8C 1PDNC 2IW5A 2UXNA 1W7PA 1GXPA 2Y0MA 1XD7A 5DYMA 5ICGA 2KU7A 1DPUA 5CVRA 2VBYA 2XROA 2G0CA 1HL6A 2J0QD 5CYJA 2GHPA 1P4AA 4MQVA 2Q8KA 3MXHP 2DO7A 1Z6TA 5MLCV 1QM9A 5E8GA 2DGUA 2XRNA 3F8FA 3B02A 1OIAA 1KYWA 2C6YA 1WRJA 2FE3A 1TQIA 1O3SA 3N4MA 3ECHA 2RRAA 2V79A 3RKXA 3CPWR 4E70A 5K1YA 2WBRA 1TTYA 3DLLQ 5FJ4A 2V1UA 3T1BA 1K78B 3U1LA 1QVFR 1T0FA 5LXRA 3H3UA 1K79A 5GAHU 2DGSA 2IPQX 1D9AA 4XSXF 2F9DA 4O5VA 2CQKA 3IRWP 1VQMS 1A7GE 1N88A 1X4GA 3FWEA 2W24A 4TU7A 3CCQS 1U1QA 5HLGA 2X1BA 4U7BA 2DPUA 3QU3A 4P55A 2COMA 1M5KC 5ICCA 3NS6A 1YW9A 1WEZA 1T2KA 2CPEA 2DIUA 2DIVA 2ACJA 3MURP 3M1EA 4F25A 3KETA 3UE2A 4IHTA 1FLIA 2QA4S 1EH7A 2EK5A 2VONA 1S3JA 4L5IA 2E44A 2MZ1A 2OU2A 4I09A 1XGNA 4YG2F 2DAOA 3RKYA 2M52A 1WHXA 1OPIA 2NNNA 3GUDA 4BHBA 1Q81T 3SHFA 3WE3A 4LGWA 2DH7A 2BBYA 3LA7A 1ZG3A 2DGVA 1HW1A 5HLIA 1VQKS 1U1OA 1BIAA 4YFNF 4KT5C 3QPTA 3GLXA 1EH6A 1SMYF 5ILVA 1SD6A 3QRFF 3CC7S 2YTCA 1Z05A 2AS5F 4Y13A 4RB0A 3K1PA 1XGSA 2P6SA 1SFEA 3UCUP 3QPHA 3E6DA 2I2YA 4HZFA 2NAZA 4PGHA 1J9IA 3ZZYA 1QGPA 5DM7Q 3G8TA 3SFZA 4M9ZA 4S04A 3ELKA 4HBLA 2XB2D 2YKAA 2EV6A 2MH9A 1UW4A 2DLLA 4RAZA 3VB2A 4GYGA 3RW6A 5DD8A 2HGLA 1XSVA 1EV7A 4CHUA 2ZJRQ 2MKCA 4N9HA 2DNGA 3ZMZA 2MZSA 2QBYB 2DK8A 3PQJA 1WHYA 2ZBKA 2FBHA 4UUVA 1ULYA 1R5GA 1YG2A 1ZRFA 5J8FA 5DUIA 3BS9A 1LDKB 3D0SA 3G96A 3HRUA 3S6EA 1U6FA 4LIRA 5LJ3Y 4IOCQ 1L3KA 3UCGA 4JBAA 1E2XA 1G3SA 4UVCA 4HAMA 1WF2A 3U1MA 4EGLA 4LLLA 1ZREA 4KUMA 4EJTA 1X5TA 2XAHA 1LNWA 3FMQA 3LFKA 2MC3A 2LYVA 2D3OR 1XMAA 3BZ6A 3HIFA 3MAJA 3I71A 3CMAS 2EV0A 2M7SA 3R61A 2MKIA 1F9FA 2DK2A 5F64A 2ADCA 1OO0B 3K0JA 2MKJA 4DNCA 1K78A 4Y0FA 5L3BA 3RYPA 2YX4A 2JZYA 4MQ9F 1FJCA 4HQMA 2JVRA 3S01A 2XS7A 4UXNA 5FLXK 3TOBA 3D5LA 1VQ5S 3TKYA 1LDJA 4CO8A 3ZMTA 3CDHA 4DQ2A 2MXYA 3DPLC 3SXLA 5A2QZ 3G6ES 3Q2TC 2FA5A 2V6CA 5LGNA 3TOAA 2IA0A 5H6RA 1U3EM 2GIVA 2CGPA 3HOSA 5HOOA 1WG4A 5JHUA 2CPXA 3WTTC 4EMSA 2RS8A 1K8AT 3P6YC 4ERDA 3MWMA 1DDNA 3KP2A 2GAUA 1P2FA 5E17F 2VOOA 3JAMZ 1U1LA 3G9CA 1N8RT 4AIJA 3B4MA 1IRFA 1O0PA 2BYVE 3DF8A 4HX4A 1TLHB 4CIOA 2CJKA 2U1AA 2N3LA 3FXUA 1VQ9S 2GO9A 1A04A 3I56S 1WF1A 5LSLA 2P5KA 1A9NB 2EA2A 4NB5A 2VE9A 1J7KA 3CCJS 3MD3A 1AOYA 4Y15A 4HQEA 5K5RA 1XCBA 4Q5SF 1IF1A 1HKTA 2ZCWA 2A5YB 1VQ6S 4HF1A 3PQKA 3VAGA 2Z9OA 3E6MA 4Q47A 2ZNZA 4CZZA 2V9VA 5ILUA 1G3TA 2DFIA 1H0MA 2MZRA 2FC8A 2HTJA 1IN6A 3BDDA 3FHZA 1FOKA 3NEUA 3CJNA 1ZGAA 3BPVA 3BOQA 1WG5A 2VBWA 4U0VA 1VBYA 1WTBA 3T8RA 1G3WA 5HLHA 4XLPF 3RPQA 1B1BA 2MZTA 1Q82T 1YITS 3JTHA 4ZZDA 3H3ZA 1YJ9S 4CICA 4M74A 1URNA 3MD1A 1KYZA 4KIFA 1U8RA 1O3RA 2DISA 2XV4S 1JJ4A 2NNYA 2QQBA 5IM0B 1H9GA 1Z9CA 3CLOA 2LKPA 3BROA 2P4WA 1G4DA 1TW3A 4OZ1A 5LGUA 2L3DA 3Q9VA 3TYTA 1W5TA 4YFXF 1ZG5A 1HBXG 5BJRA 4NQWA 2F5EA 1IXCA 4ASNA 1YIJS 1MJ9A 3L3CA 1SJQA 5BS6A 1FSHA 1V3FA 4OIPF 2BZ2A 4WX9A 5CYVA 2RRBA 3V8JA 3L2CA 4IRIA 5HL7Q 2FOKA 5LRRA 5LEJA 1LQ1A 2FHOB 2VE8A 4LMYA 1QQIA 1R23A 1QZZA 4KN4X 3KP5A 1MGTA 2LXIA 4BXUA 2EFPA 3IWFA 4MNUA 3I59B 2YH0A 3FM3A 4I0BA 1FJ7A 2J8AA 1ZAOA 3TO8A 5FD6A 4EGZA 3HHGA 3SXYA 3N9UC 3GXOA 1HW5A 2YX7A 3CTAA 5L3FA 3FMRA 3ABTA 1IW7F 2K86A 5TRDA 1RKJA 1ON1A 3T0YA 1X0FA 4UNOA 5DDPC 1RNLA 1FO1A 1JJ2R 3HHNB 3MOJB 4M6YA 2RQ4A 2RNJA 1HW2A 3GFIA 3LA3A 2MGZB 1DP7P 2DGXA 1M90T 1YS7A 1O7LA 1M5VC 5IQQA 4M9XA 2DO0A 2LA4A 1M5PC 3HSFA 2OZUA 4KMFA 2FNAA 3DEUA 2EK1A 4KICA 3T8TA 1W4MA 4JQFA 1T38A 1ODDA 3GFLA 4G6QA 3JTGA 1K7AA 4GGGA 1X3UA 2HS5A 3WE2A 2SXLA 2GZWA 2K4BA 2YU3A 5TJJA 1KOOA 3MUTP 3JB9k 5FD5A 2A3SA 4BNCA 3E6CC 3EUHA 3CUQC 3GEZA 3Q5FA 4RB2C 1R22A 2DGOA 2CPZA 3NNAA 2YR2A 4XSZF 1QPMA 2HR3A 1JHFA 2A07F 2D1HA 1R36A 2JRTA 4XLNF 1WG1A 2FMLA 4QU6A 2FQ3A 3WTYC 2M8HA 1B9NA 3ZPLA 2E1CA 3CTRA 2M4MA 4HDVA 2ZFWA 4ENJA 4PZJA 2P7CB 4G6DA 2MHNA 5IT9K 3COAC 5L3GA 2OD5A 2UWMA 3KE2A 1STZA 1RK8A 4ZYHA 4YIFA 3I0TA 3NNCA 3I4PA 2DW4A 5DV5A 1F5TA 4JK1X 2PJPA 2OA4A 3DXBA 1FYLA 3ZMVA 3GZ6A 4ENMA 2LNBA 2XAJA 5BPDA 2K27A 5LHIA 5F6FA 3L09A 5DDOC 3MUVP 1SD4A 2IT0A 2R7DA 3DP7A 2QYOA 1BI2A 2M2BA 1SFUA 4IOAQ 1ZZNA 4P9FA 2HZTA 1F1ZA 2QEXS 2IJLA 4M71A 1S29A 1F4KA 5IM0A 2L41A 1LDDA 1B6AA 2FEZA 2XKOA 3KFWX 4IO9Q 2DQRA 4IRGA 1YWXA 5GAGU 4PGGA 2D9PA 3P9KA 5JVGQ 2G1DA 2FY1A 2CPJA 1J2XA 1FWZA 4AIHA 1BBYA 2CFXA 2CW0F 3R1LA 3LQQA 3F8NA 3HYIA 4OMZA 5EEHA 5E18F 3PFIA 3E3VA 1RI7A 4WCGA 1BY9A 2WC2A 3K9TA 2XHKA 2K3KA 4TU8A 2HQNA 3I59A 2N3OA 4ENNA 3Q2SC 5JR3A 1IN7A 2QENA 2CSOA 4L9TA 3VAJA 2F2EA 1J5YA 2MLKA 2ESNA 5FFXA 3EGZA 4WCEQ 3QU6A 3DKWA 1OWXA 3K69A 3VFZA 2STWA 3CCMS 3HRTA 1USSA 3NRVA 2W57A 3CUOA 4EM1A 2BGCA 4WWCA 2KG0A 1Z91A 4WFBQ 2MGZA 2AYEA 1XSXA 3CCUS 2G7HA 1J59A 1BN5A 2ETHA 4YIIA 2XS2A 2YSRA 1ZN2A 3MCZA 3CO6C 2W25A 2KXNB 3HRSA 5FLXZ 2DNRA 1P27B 1OMIA 2MH2A 4OIRF 1B7FA 1Y0UA 3GWZA 4LJZF 3EGNA 2HVZA 1VQPS 2MQQA 3O2PE 1PO6A 3MZYA 5JVHQ 2E7XA 2VXZA 3THPA 4M73A 2Q0OA 1FBUA 2FBIA 2DQLA 2JRSA 1JJHA 4UV8A 3G3ZA 4QPTA 3I5UA 4FHTA 3FEXB 1O3QA 3TDUC 1WHVA 3F23A 2RVCA 4BAYA 4YUDA 1YW7A 1X4AA 2DGWA 2RUGA 2VC0A 2A6HF 2RU3A 3I54A 2Y75A 5D8LB 2KH9A 2YWKA 3CULA 1R1UA 1KQ8A 2R3SA 4OIOF 2OJ3A 3QOPA 2FMYA 3J7YU 3R0JA 3W6JB 5CLSA 3MI7X 2OAZA 3P3DA 3CCVS 2L54A 4MEXF 1BIBA 2XGXA 2FPHX 4F02A 1X5PA 4ESJA 2V94A 2K8GA 1K73T 2WV0A 1YTYA 3EDPA 4OZ0A 1KU2A 4WFNQ 3WG9A 3KLNA 4FXVA 3SDEB 3CCES 1D3YA 3P7NA 5JVTA 2ERRA 2Z3YA 1FPQA 1Q86T 5D77A 4BQAA 3L00A 3LAJA 1RUOA 1U6GA 2MSTA 5DETA 3KEQA 5E20A 1X4CA 3WODF 1H6KX 1K6OA 1SFXA 2KIFA 2M1BA 2CQDA 2QLZA 2DPDA 1UFMA 2X1GA 3IRQA 4A0ZA 4ETSA 4I02A 1YW8A 1WI9A 4CQ1A 3NMRA 5ERIA 3BPXA 2HEOA 1VBZA 3R6SA 3IWZA 4A6DA 5K5OA 1BM9A 2DGQA 2XNRA 5CVVA 2BV6A 2JX2A 1CVJA 2HTSA 5D8KB 5F1RA 1IXRC 2DU9A 5LGTA 4LLGF 4HDUA 3P9CA 1TQPA 2KJBA 2UP1A 1IN4A 5HDNA 1TQMA 2E1NA 2KIUA 4G94A 2WWYA 4LMZA 1WQ2A 3QP6A 3VODA 5ICFA 4J5OA 1FX7A 1IQTA 2DI3A 2LECA 1U5TC 5H1SV 3F72A 2RDPA 5CVUA 5GMKa 3CUNA 2HKOA 4LK0F 5D5WB 4HV5A 2W84A 4U67Q 3GO5A 2E5IA 4QU7A 3E97A 4MTEA 2ISZA 3ULQB 3HTUA 1R1VA 4BHPA 5E8IA 3R1HA 2HYGD 1KU7A 4KDPA 2NZ4A 2DHGA 2B0LA 4GYIA 2LEBA 2E5HA 4QLCU 2MY7A 3HSEA 2CQIA 1U6BA 2J5PA 1P4WA 1N54B 4ZYGA 2HYIB 3KP4A 2PI0A 2RVJA 2FC9A 4LD5A 4ZKAA 1IXSB 1VQ7S 2ZXJA 1CGPA 1Z1DA 1KOHA 1BI3A 1M1KT 2RT3A 3R0AA 5D4SA 1IUYA 4HA8A 1PUEE 1TW2A 2LQ5A 2EK6A 2KJCA 1C0WA 1T98A 4A0YA 1U2FA 2KRRA 1FSEA 2UXXA 1R58A 3CCRS 5E1ZB 2O0YA 2ZKZA 1SD7A 2MA3A 4A0XA 3KEOA 2F5DA 2QFJA 1SJFA 2G7UA 2X0LA 1FBSA 4M6XA 3VALA 4Y17A 2OBPA 4AWXB 4PRFA 3N97A 3CUQB 1VQOS 4XRFA 4IVNA 5HS8A 2FF4A 2PQ8A 4I7HA 4GO1A 4LK1F 2ZJ2A 4XBFA 3ZMUA 4G7OF 2CQ3A 2MJNA 2JPBA 1XGOA 3E5QA 1BI1A 3KCCA 2ZMEB 1NU4A 4IHSA 2CQBA 4Z2YA 2XAFA 2CQ4A 3CCLS 2YH1A 3MQ0A 1W7PD 4ESFA 4RGXA 2H94A 4OOIA 5HVQC 2QQAA 2EFOA 2HOEA 2TDXA 4H0EA 2CPIA 4RGUA 4PCQA 3RTRA 1HQCA 4Q4ZF 4PKDB 1FP2A 3RDIA 1S7AA 3O6BB 3S2WA 5FB2A 1MJAA 4HX8A 2RKHA 2N7CA 3SQNA 2QBYA 5H6QA 2CG4A 1VTNC 1JXSA 1U78A 3BEGB 1I5ZA 1GHCA 5IT9Z 3REOA 5J6XA 1IRGA 1BJAA 4LB6B 1KC8T 2JT1A 5CVIA 3UWTA 3NS5A 3FEYB 4CH1A 4UVAA 2EJRA 2L08A 2B0GA 2J0SD 2L4AA 4UY8T 3H2VE 4G7ZF 2OQRA 1ZH5A 3EQLF 3M7GA 1QBJA 3ERED 2OZ6A 2A6EF 3DFGA 2OSQA 3ZP5A 5D5UB 1FXLA 4EQQA 2DNKA 3RW7A 2PEXA 5J8CA 5E1XA 4EGYA 5L3CA 4LJMA 3RKWA 4NHJA 2XKPA 2CQ1A 4N9IA 1B4AA 1W2BR 1SD5A 1JHHA 1OYWA 5H20A 3AAFA 1R8HA 4N0BA 3VAKA 4OINF 3PIOQ 5D5VB 2D45A 2PE8A 3P49B 4IF4A 1FT8A 2MJUA 3D2WA 2XUBA 2HWVA 3WTUC 5KK1A 2DNHA 1OR7A 2CPYA 4V19X 4UV9A 2KKOA 3EYIA 1SAXA 1DZ5A 1G3YA 1WWHA 5AONA 4HX7A 2PMUA 4I2OA 1G6NA 2V1XA 4HF0A 2KFYA 4O6JA 1FY7A 2DNMA 1UAWA 2CQCA 2JWNA 1YI2S 2K02A 3ECOA 3ROUA 1O3TA 2HKXA 5A2QK 5LHHA 4AIKA 1L0OC 4S05A 4FX0A 1ZGJA 2LDUA 2PMHA 2LF7A 1OYIA 5ILSA 3MEXA 2O61A 1SJ4P 1OKRA 3MDFA 3VAIA 2CPFA 3VOEA 1ZRCA 4WXHA 3HUGA 3IL2A 4M5DB 2G9WA 2D1VA 2HGNA 6PAXA 2PN6A 1HKQA 2OTLS 1REPC 3LSTA 3GZ5A 3JAMK 1SJRA 4BH9A 4I01A 1IZ1A 2IA1A 5BOXA 4LLNA 2GXGA 4IUFA 5DM6Q 1T39A 4A8XA 2EV5A 3V7CA 3O3KA 2EFWA 2CPDA 2L9WA 3UD4P 1ZARA 2DH9A 1I6XA 3K1MA 1KU3A 2M8DB 2EWNA 1B59A 4WXDA 2NLWA 2O8XA 3BP8A 1X4EA 4YOEA 4U88A 1Q7YT 4KMUX 1MDMB 4HF2A 2KXFA 3HOTA 2P6TA 1LJ9A 2RGVA 1JGSA 3CUQA 1U2WA 2PFBA 4R8HA 2MKHA 1V4RA 4RB3C 3S7RA 4IPAA 1XCVA 3JSOA 4MGRA 1M5OC 3DXJF 4TLQA 3F22A 5LJ5Y 1D8JA 1ZRDA 2HGMA 2A68F 4OU0A 2ZJPQ 3C18A 2ZMEA 1KD1T 2FBKA 2Y48A 2RS2A 2VC1A 3M9AA 3WTSC 4ON0A 3MFKA 1LEBA 1X4FA 3J7AO 2VOPA 2IA2A 2JTVA 4GCVA 2LA6A 1LVAA 1QNTA 1YO5C 1KA8A 4O3MA 3M8EA 1Z6RA 3ZN0A 2XS5A 2HDCA 2P5VA 2XASA 1SXLA 3GYHX 2PEHA 5CVJA 4KNYA 3S8SA 2MY8A 1LEAA 5CJ9A 1WEYA 4MTDA 1XN9A 3IKTA 3QAHA 1U1RA 1YJWS 2D9OA 2E7WA 2BOPA 4ZYEA 3IHUA 3WTXC 1FYMA 2QUFA 2EA4A 4WIIA 2MYFA 1U1KA 4MEYF 5JFRA 3U9GA 3CD6S 1X4DA 2KN4A 4KFCA 3HI9A 2OSRA 5ITHA 2AD9A 3WTVC 4TU9A 2MQOA 4RGRA 2GA2A 1HKSA 3Q9SA 2DT5A 2P5LC 1PP8F 3F6VA 3IC7A 3GF2A 2DNOA 2AYGA 2GWRA 3P9IA 1USTA 4FT8A 3CC4S 4CDGA 4HLXA 4LFUA 3LQRA 3RI4A 2CQ0A 1DBDA 2KHCA 3ML6A 1CF7B 2H27A 5K5QA 1T6SA 1E17A 3UD3P 3F8CA 2DNPA 1U1PA 5BPIA 1QVGR 5HS9A 1HD1A 3LPYA 2H6CA 3VAFA 3GVAA 3JSPA 1MZBA 4WF9Q 2CQPA 4HLYA 3HHHA 3J80K 1H2TZ 3KP7A 2FXAA 2CYYA 4U0WA 4HV6A 2KRFA 3HTSB 2CQHA 4L0ZB 5CA5A 1KQ0A 2DHAA 4W92B 2ZNYA 3QP5A 2Z99A 1YQAA 2L4MA 3SMZA 4RB1A 2D2WA 1U5TB 5D5XB 3SZTA 4WFAQ 2M8EA 1QO0D 4K2EA 2H6BA 3RJPA 3GX4X 3TP2A 5LEKA 5D4RA 2PLYA 2A3JA 2VN2A 4W90B 1ZG1A 4FX4A 3W6KB 3GW2A 4ED5A 1ZYRF 3V4MA 5DD4A 4EVIA 1VQNS 5ICEA 1X4HA 4IXAA 1UFWA 4CGZA 2RQPA 1P92A 5LHGA 3WU0A 4EJOA 3BO2A 4GXOA 4HOBA 4A2UA 3H2UB 2QWWA 2FRHA 3E5UA 1GXQA 5FGMA 3CMES 4UVBA 2RN7A 2QZ8A 3CC2S 4BS2A 4I98B 3U1DA 3J7ZT
chains in the Genus database with same CATH superfamily
3DLHA 1I1SA 2MKSA 5CPRB 1MDMA 2DO4A 4CM0A 2Z4PA 2WTEA 3QFHA 3J81K 3M07A 3WGIA 3PR4A 1TKXB 4C6AA 4BEHB 3OW2R 2VL1A 3RKQA 1RZMA 5AIPA 2LF8A 3HC7A 2EVZA 1HD0A 1RHKB 3SIPB 4I69A 2V8PA 1BUXA 2GMHA 2B8QA 3BBFA 3CNQP 4LF4F 4ED8A 2Z56B 3R6LB 1LKXA 4RGSA 3B4DA 3GTYX 3I53A 3FQLA 1RRJA 3M2RB 3FXRA 4JYAJ 1SKRA 1R8BA 4AD9A 2BMBA 4CA0A 3MMYB 3GTGJ 2BEFA 3IUOA 2CPHA 4BY1J 4PQAA 3QIPA 2G2YA 4CWBA 2CO5A 4DPTA 4WF2A 1Y0NA 3TBIA 2IM2A 2CDQA 3C6UA 3QOEA 2HZCA 2Z2SB 3BGRA 4CH7A 2OO4A 3PUBA 3OV8A 5HROA 3QPIA 1G2HA 2BQRA 4FXWA 2WTFA 4Z2XA 1S6UA 5F8LA 3BQ0A 4B3TF 3CCYA 5IOLA 3KUEA 3BJYA 3PG9A 1VRUB 1HLVA 1TL7A 3UVJA 1JE8A 1XC5A 4LG0B 4WK3A 4B3SF 1X5OA 5F0FA 1MKMA 2MZQA 5A6PA 3KLVA 1D09B 1RWUA 3H90A 2O03A 3DEEA 4BYYA 5K8MA 2YWEA 1XQIA 4ZPVR 1N33F 3MMCA 3GZNB 3F6OA 1VFCA 1WF0A 3RZDJ 3ZZZA 4YP3A 2E5ZA 4N56A 5F8GA 1ETVA 4NLWA 1EX8A 4L9VA 1DTTB 2QMWA 2OQGA 4E4HA 2M70A 4TYAA 3GFJA 2B8PA 1SL0A 1RT5B 4TQRA 1TAQA 2DT9A 1TT0A 1U48A 4KJZA 2KHMA 3KIOA 1Q8IA 4Y2MA 3L7OA 3QJJA 1FJGJ 4C0OC 1VRTB 3ZQIA 5EG0B 4H4OB 1D1AA 3KP3A 4KR0B 1ZETA 3R8YA 4OMYA 4IFVB 3C2BA 2OPSB 3DYAB 3Q0AA 3FNNA 3F0CA 3H5AA 2GBYA 3T5XA 2IRFG 2JOQA 3PJWA 4DV7F 5HDKA 1FHTA 2F5VA 1WKMA 3IRRA 2STTA 2R2RA 1UHWA 3L9FA 2DNYA 2V2VA 3HM9A 1AUDA 1X8DA 5T41A 3M9NB 5CKTA 3H1CA 2RREA 2LH9A 4OX9J 4A8FA 5CYMA 2Y1JA 5GADJ 4HI1A 4NYPA 2MPUA 4U7DA 4DZPA 1HQ2A 4F0KA 2Y2ZA 3GR1A 3ILIA 3FF5A 4XLHA 2RQMA 5LXYA 2E2HJ 2M9KA 1IN8A 3DBHB 4NLOA 3MECA 3C8YA 3DGVA 2KHDA 5DG8A 5KVRA 2GFFA 4ZHRA 4ZVRB 1HSTA 1IN5A 3OTDA 1ZR4A 3FSXA 4A93J 2X4HA 4BQQA 4QIWN 4I64A 1S1WA 2AWZA 4BU2A 2DNQA 5DZ7A 1LB2A 3LSGA 5BMZA 3BJOA 1NAQA 3D4JA 2E9RX 3HHLA 4LR7A 2FJVA 2WADA 2XLIA 1ITPA 4MKYA 5KT2A 4RW4B 4R79A 1KQSR 4C3JJ 3K1NA 5A0YB 2ZJQQ 4OIQF 1S0VA 5J1RA 4HW0A 1UJ4A 1RTHA 3CCLI 3MVPA 1ACIA 2FZKB 1EARA 2C3YA 3N6LA 3DU5A 3TUPA 4ZYAA 3MMBA 4EJVA 3EJMA 2X1CA 3DLBA 2ELJA 3C6TB 4BJTA 1ZZFA 4DSKA 1RLCL 5B0GA 1BW6A 3LL7A 3BSCA 3RBXA 3W1YC 3ZR8X 1R43A 1F5CA 2PD1A 3QAUA 4C0HA 3K58A 2NUHA 4DGWB 1N5YB 4PDKA 4IH6A 3HMJG 3KJQB 3HPGA 1F6TA 1W7PB 4PSXA 1V3RA 5D78A 1FDNA 4NCGA 1B8IA 4TY8B 3SSRA 3NAUA 4FE4A 2J5OA 1YIJI 4CH0S 2NXNB 3A1YG 4IRHA 2ZFHA 2E1AA 4F7ZA 5HQ8A 2E5LJ 5DLFA 4J01A 1DUXC 1TNTA 2F1FA 1T94A 1LWXA 2MKKA 2DT6A 2RV8A 1RADB 2VPXB 4IQJA 1RTDB 1MJBA 3HM5A 4NLXA 2FZGB 2IBDA 3G8QA 1U49A 3WGGA 1RIOH 3BN7A 3WX8A 4OZJA 3EPGA 3WHCA 2IS1A 1LW2B 4XIUA 1QZYA 3VEPA 4GC7A 5KFMA 4UQTA 1RZ4A 2NXCA 4N7TA 3FUYA 1OQ6A 4UHTA 3EUAA 2BY0A 3P45B 5GMEA 2LVSA 1UP1A 4ECXA 4YY3J 1RUNA 2CQGA 1I5OB 3I31A 4NYOA 2P9CA 1XX5A 1VBXA 1HNWJ 1FJEB 3OR1A 3BG6A 2EFQA 3J7A1 5FO5A 2CJQA 1D9DA 1UPMB 2HG4A 1N52B 3EGWB 3CDWA 1ZTRA 4A46A 3CCSS 4ZTFA 4F8RA 3WTZA 3EXCX 2DNZA 2OTLI 1RT3B 4G7HF 2FNPA 1K6YA 3POTB 3R5GA 1EKRA 1UA0A 4A48A 1HSJA 1MN7A 4DYRA 4R1HA 1CBKA 3WGHA 2W01A 4E6KG 4U95A 5ETLA 3CZ6A 2QSHX 5KFJA 4IHYA 5HSPA 3GJSB 1HBUA 3KJNB 1AA1B 2HZAA 3G86A 1X1CA 2XO7A 4LBHA 4ECYA 3QYBA 4RM2A 3L2VA 5HLFB 3PNIA 2ZC4A 2VJJA 3VQSA 1GEHA 2NS1B 2R7UA 3CE8A 4QWDA 1JUSA 1EH8A 1Y7PA 3FBNB 1G2EA 1Y5NB 2ZWPA 5KFBA 3C14A 1NM2A 3WZ0A 4DV2F 3ZMDA 4DUZJ 3W3CA 1IBKJ 1X5SA 2K4JA 2AEJA 1XJWB 5KNLA 1SUQA 1RT1A 2EZHA 3HPOA 5DEQA 4D1QA 4K2JA 2VIXA 1D0YA 4X64J 2VODA 3R7SB 4C4WA 4D3GA 3DOLA 1HXDA 2M0MA 2OC6A 1WJAA 1TUWA 3W9JA 1RWNB 5LRSA 2X1EA 1YJWI 3DRRA 2JNJA 5D4LA 5E3QA 3THTA 2ROEA 1ONVA 4MKAA 2V9KA 1U6ZA 1R4MB 3DN9A 2DJWA 4L18B 1WH7A 3QGPA 4UOCA 3FFIB 4DR2F 1LW0A 1FK9A 1PDNC 2DFHA 1H73A 1WC3A 2Y0MA 3UKGA 2HQAA 1S6OA 1T3NA 2QF7A 4ZCLA 1S49A 1YSJA 3EUKL 4FBTA 2CIMA 2HOTA 4MQVA 2J7WA 3PW4A 2QGFB 1V6HA 3CC4I 4DR5J 3K4KA 4WU2A 4HACB 4DYQA 1QPIA 3RG6A 3CDLA 4I6WA 4D3HA 4AXIA 4RX6A 3CJ8A 1D0EA 2LVWA 1TL3B 1O3SA 4PABA 3CPWR 4RBTA 3OS0A 2WBRA 3DLLQ 2V1UA 4WE1B 2RU9A 3JCUC 4AM3A 3LF0A 3U1LA 3NGKA 1IXKA 1JLAB 4IDKB 4DR6J 5F8HA 4A8MP 5LXRA 4B3OA 1PBUA 1D9AA 2V1NA 3GFZA 4DX8H 4O5VA 5AJ3J 4EO8A 1HBMB 4DV4J 2AJ0A 3PJXA 4TU7A 3G2BA 1UPPA 3BH7B 2WONA 3NGRA 4XKCA 4P55A 3ZZ0A 3W3SA 2PEBA 5ICCA 3NS6A 1FKPA 2BOAA 3MPUB 2DA3A 4LSLA 3MM6A 1WEZA 2UVUA 1T2KA 1V5GA 2O1PA 3MURP 2PX9A 2HOAA 5KOXA 3UE2A 5FD1A 1EH7A 4MO7A 2R5ZA 1VQNI 1RABB 2FJXA 1S3JA 1MMDA 1VQPI 4A3IJ 5HMWA 3OR2C 2M52A 1YRTA 4BHBA 3PFYA 2DHHA 1W0TA 2GJ2A 2DH7A 3KJVB 1VQSA 3O44A 3FK6A 3LA7A 3HJVA 4QWEA 2F4FA 3ZTPA 4YFNF 1QTMA 2XF6A 1JB0C 5J1PA 3VZHA 1RB0A 2AS5F 3H0PA 2DXEA 4ZDOA 1SFEA 2DXFA 4DR1J 4I2QA 1RYSA 3BQZA 4EYHB 1UG0A 2M3DA 1J9IA 2Y8YA 2D5VA 1QGPA 4NASA 3SFZA 2CMPA 4OL8A 3ELKA 2XB2D 4P52A 2YKAA 3M7VA 2MH9A 4XR6A 4RAZA 4I2PA 3FKBA 4GYGA 1VQ4I 1XSVA 4DV3F 2UXCF 3VVUA 5J1NA 1P7JA 4CHUA 3CESA 2ZJRQ 3ENVA 4B4CA 3S2HJ 2DK8A 3I55I 2M0CA 2LQBA 4J9QA 1LPQA 3GFYA 4WJBA 2XMKA 2W9AA 1ULYA 2R3VA 1HHTP 1G7CB 1XK8A 4CLZA 5DUIA 1BD6A 1QY7A 3QLHB 3BS9A 1LDKB 3IWXA 2BY2A 3UR0A 4KHMA 4PWWA 1FNMA 1L3KA 2XMVA 4LRFA 3M1VA 4DSJA 1WOOA 1RLDA 1JLCA 2Q3PA 1ZREA 2DXDA 2ZXIA 3LFKA 3HZJA 5ETNA 2FD5A 1QHHD 3M6VA 3MAJA 1RT6B 4CLYA 2ZH8A 3CMAS 2EV0A 3R61A 1S1XA 2CNKB 4NEZA 3TVZA 3ZZPA 3QRRA 3GFXA 3K10A 4MTPA 2JZYA 1FJCA 1KHWA 3QT7A 4HQMA 4DLEA 2WSCC 3TOBA 5L39A 2OH2A 2ELKA 1NDPA 3TA0A 4DV5J 1VQ5S 2V7FA 4O44A 2YU9J 4RLFA 4IG0A 2R7XA 4NRUA 3HHEA 4DQ2A 3AD9C 4OHXA 5JLXA 3SXLA 3FKIJ 3AY0A 2YNHB 3G6VA 3Q2TC 2UZAA 4GRIA 5LGNA 4DL4A 3IAM9 5KFVA 1U3EM 2GIVA 2CGPA 3AAWB 5HOOA 3FK4A 1WG4A 5KAIC 2QSGX 2M2EA 1BR2A 4EMSA 2RS8A 6AT1B 4M5KA 4UOHA 3A8EA 2RKIA 4DL3A 1I3OB 5F9LA 1P2FA 3TWZA 5A8KB 1U1LA 5GP9A 3BR8A 4LOCA 3B6BA 4D5FA 4AIJA 1IR0A 1S0MA 5ADZA 4NLYA 4KKOA 4C8NA 1TLHB 4CIOA 3BGOP 4KGKA 1JNZB 1VQ9S 5HODA 4X4TA 1VI0A 1G8XA 4NX9A 4ANJA 5CH7B 2VE9A 4O3OA 2X6YA 2EZIA 2NQPA 2CAJA 3CCJS 4CCOA 1EP4A 1R8AA 4P72A 4CCLA 1IF1A 2ZCWA 4HF1A 3UN5A 3PQKA 3VAGA 4IQMA 1T11A 2W2PP 4CTAA 4PFOA 1YBUA 2ZNZA 1AW0A 2V9VA 5ILUA 2LDYA 3TQEA 1GDTA 2MZRA 2QJ3A 2FC8A 1HWJA 4EBDA 2HIQA 1LWFA 1REVA 2EBGA 1SC7A 5HQLA 5KFRA 1Y6IA 4PJLA 4RBVA 2CWXA 1WTBA 3T8RA 4JI5J 5HLHA 2H1YA 4AU7A 4M8LA 1U09A 2K9LA 2HNYA 2L9DA 1VJQA 1YJ9S 4M74A 3JREA 2VDIA 1KYZA 3GP9A 3DKXA 3TJ8A 3FBFA 3Q83A 3X3UA 2VJIA 2WBMA 1HIYA 5KG2A 4GRSA 3DRXA 2DISA 1TKDA 2CUYA 3J7ZT 3OS1A 2V9WA 1K1SA 2FYXA 3CLOA 2LKPA 3BROA 5JVGF 1G4DA 1HR0F 1TW3A 2J8SA 3X2QH 2QV6A 3Q9VA 1ZG5A 4YFXF 5KG1A 2RAEA 4UUSB 1GT0C 3MR5A 1FSHA 2WOMA 1V3FA 3PKYA 2HHPA 3M4OJ 3RB3A 2PMZA 3CJTA 2RRBA 3V8JA 3L2CA 5HL7Q 1QU3A 4HI2A 2FOKA 4YFUA 2FQQB 2XYGB 5DGAA 2FHOB 2VE8A 5KFHA 1QQIA 1QA6A 1QZZA 4RW6A 3OVBA 3A0HC 3RBEA 1MGTA 1TFYA 1R9TJ 4OV1A 2LXIA 2KB2A 2EFPA 3LMMA 3IWFA 4MNUA 3I59B 1U8SA 1OSDA 1RAOA 1H74A 5IC4B 3TO8A 1RBOB 3I9ZA 2MD0A 3GIKA 2ZH9A 1T7PA 3DM2A 1I6JA 3AJ2A 4RNFA 4PFPA 1QZEA 1D5YA 2VKDA 4C3KA 2E66A 1RKJA 1X0FA 4WP3A 2VQFJ 3MOJB 1O6XA 1U0JA 1HW2A 2DGXA 4O4RA 1YS7A 5IP6A 2ZBCA 5F04A 2KZVA 3FXKA 1XMQF 2OZUA 2FNAA 2EK1A 4M6VA 2PA3A 4ITSA 1HWIA 2RDDA 2P8IA 3DDNA 3GFLA 3JTGA 1K7AA 1FKAF 3K70C 4BBRJ 5LL6d 1T05A 3O2IA 3A12A 4ZLJA 3JRGA 4FXDA 4N41A 2GZWA 1Z3YA 2MG4A 3VTIA 4ECSA 4U96A 4XAKA 3CQZJ 2A3SA 1SL2A 4BNCA 1WTFA 1X7VA 4RNOA 1XNQJ 3E6CC 3EUHA 2DGOA 3NNAA 4W98A 4AQYF 1OYDA 1Y4ZB 2D1HA 1HQUB 4HT7A 2ZMEC 3RQIA 3D0GE 3UN2A 1JX4A 3OUYA 3CJQB 2N4CA 2M8HA 1B9NA 3HVTB 3ZPLA 2E1CA 4BDYA 1AFJA 1O8BA 2ZFWA 4JX6A 2R4FA 4G6DA 2MHNA 2GV1A 2WVBA 3QO9A 3MMAA 2AV5A 3G1LA 3OXLA 2UWMA 3KE2A 3CO9A 4X6AJ 4KB7A 3I0TA 1S6PB 4Y34A 2DW4A 4CYUA 2DMQA 2ZZNA 5DV5A 5I3UA 5ETVA 2LEPA 1BGXT 2DODA 1N6QB 2OA4A 3H5UA 4OI4A 2XAJA 2C2EA 3J7YJ 5DDOC 3BDEA 2R7DA 4A3EJ 1BI2A 3OL7A 3W6VA 2K5CA 1JWWA 1S1UA 4R5PA 3DKYA 1S29A 4ES1A 2L41A 1NJYA 5IPAA 1ZBTA 4CLTA 2ZH6A 3HT0A 5IQ6A 3C46A 3GTQJ 5GAGU 3QZ8A 2R7OA 4KTQA 3WIUA 1BQMA 4YEAA 3F41A 1FJGF 3NOCA 4CO4A 2Q1ZB 3R1LA 2CS3A 3V81A 3F8NA 3BCBA 3KEYA 5C7PA 2VASA 5BR8J 4LIUA 2EIKH 4LITA 2X85A 2CW8A 4WCGA 3K9TA 1R31A 4JV2A 2HFZA 2K3KA 4USIA 3MFHA 3LGHA 3DRYA 1FCAA 2A1BA 2RSQA 2N3OA 1S9GA 1IN7A 3LSPA 2CSOA 1EZZB 4IRKA 2K1RB 4L9TA 2CJ9A 3S1QJ 3D68A 2XM3A 5FFXA 1EQ0A 5KFOA 3QU6A 3DKWA 1IV8A 3CCMS 1JKPC 3CUOA 3DBLB 1ZR2A 4OX9F 5T7LB 2J6SA 1SC6A 1Q79A 4HL9A 4HDGA 2AJFE 2BGCA 4WK1A 4G3IA 1GNKA 4FVCA 1NRKA 1J59A 1VQMI 3CP2A 3MCSA 5B7WA 4CLFA 3D28A 2W25A 3HRSA 3BGFA 2F48A 5FLXZ 5B0DA 2DNRA 1W0UA 2HBRB 2DTZA 4OIRF 3HHLD 1Y0UA 1EETB 2KFNA 4LF5J 2H3EB 1Q7LB 3ABMH 1HYSB 3LP0B 3O2PE 4FCYA 2WHOA 4ES3A 1MMAA 2R4GA 2E7XA 2VXZA 1UKUA 1NPKA 2AGQA 3K89A 4HTJA 1EIYB 4P74A 2HWIA 4U87A 4WWSA 5J1EA 3EPZA 2HVDA 2W7PA 2HLTA 3GTPJ 4FHTA 1MMNA 2RVCA 4BAYA 4YUDA 3ASOH 2DGWA 2ATLA 4FYWB 2ZDPA 2X1DA 1BR4A 2VC0A 1VQKI 3SV4A 2A6HF 5J2QB 4X65J 2Y75A 5D8LB 1XWLA 1R1UA 2ZKUA 4JUZA 5H9EJ 2W2MP 2DJNA 2OGUA 4U9RA 3BZQA 3KNAA 1JJCB 3VYRB 5CYQA 5DG7A 2APOA 3TANA 5CLSA 4ZITA 3P3DA 1XEZA 2FVPA 1X5PA 1NK8A 4XKBA 2W1OA 1Q8LA 1MW7A 4NC8A 3ZXWA 3WG9A 2RAQA 1D3YA 1S57A 2OTJI 3QJLA 2Z3YA 3OS2A 1Q86T 3L00A 2GHWA 1RUOA 1T9UA 4PXCA 1Y3JA 2MSTA 3AL0B 1NKBA 4YHHJ 4FS2A 1U25A 1H6KX 1K6OA 5IOYA 2CQDA 2DPDA 2CUZA 1JLGA 4QTRA 3JSMB 2CFOA 2X1GA 3DTKA 3IRQA 4CUGA 1CQNA 4RDUA 4ETSA 1YW8A 3DI6A 4HEA9 4MK7A 2A2CA 3JS9A 4BLGA 4C8OA 2V69A 3M2UB 1RTJB 1KVJA 2RQQA 2OKQA 1HNWF 4EU0A 5M2RA 1QUPA 3O3LA 3VHQA 4M1KA 4LLGF 4JI1F 3P9CA 5GTHC 3FBCA 3J80Y 3GR0A 2E1NA 3ENWA 5K9FA 2GIQA 3CMQA 1G1XA 3MR2A 3F72A 1K1QA 2RDPA 5GMKa 1UEUA 2HKOA 3CUNA 2AHQA 4AYBA 2W84A 2Q43A 2K3FA 3FXJA 1R1VA 5E8IA 2HYGD 4IKFA 4DS4A 4OAZA 4GYIA 5G4DA 4PXEA 3ITHB 3CIZA 2MY7A 2PJRB 4MFBB 2BE2B 1WNEA 1P4WA 4DLGA 4ZYGA 1Y5IB 3KK1B 1XG1A 3AH6A 2RQKA 2RVJA 2FC9A 4ZVTB 3I4HX 3LAMA 2JLEA 4ZKAA 4DV6J 4B48A 1CGPA 3PR5B 2XI3A 3JRAA 2LY9A 3ZQGA 5D4SA 5C24A 1PUEE 2LQ5A 2IAIA 2EK6A 5KFDA 4X1EA 1RT4A 4JV5J 4A0XA 3DKDA 3OL6A 3RAQA 3BM7A 1ZQ3P 3J81Y 4M6XA 7AT1B 2YX1A 2ZE2A 4DV1J 1VQOS 3M8PA 4XRFA 4IVNA 3KWMA 5J40A 2ZJPF 4ZPCA 3RQ4A 5E5NA 2ZJ2A 3ZMUA 2G0EA 4KFBB 2JPBA 2VG7B 3QQAA 4RUCA 1DY3A 4X64F 3E5QA 4DX7A 2VKHA 3KCCA 3PTWA 2CQBA 2CQ4A 5CD4A 3CCLS 4ESFA 2W4DA 2TDXA 2EFOA 5F8IA 5GAGI 3TAPA 4H0EA 2BE9B 1WC6A 1IBMJ 2EIMH 1Z1ZA 4Q4ZF 1F3FA 4PKDB 2RKHA 3OVAA 2KRCA 5EDWA 2QBYA 4LFCF 2G2OA 2V4JC 1U78A 3BEGB 2PT0A 1TZLA 3RAMA 1NK9A 4ZVEA 1GHCA 5IT9Z 4U6PA 2JN6A 3DGPA 4LB6B 4CCKA 5EWFA 3FEYB 4CH1A 2KLOA 3OSPA 2L08A 1L3TA 2L4AA 3GYGA 1RTIA 1IG7A 2OQRA 4ZVSB 3EQLF 1UTAA 4DU8A 5E3AA 2HHVA 2EPIA 2A6EF 2OSQA 3TNVA 4F93B 2Z30B 4EQQA 1S1VB 1YRUA 3RW7A 3OSNA 1KLMA 4EGYA 2XHWA 1G59A 4NHJA 2ZUGA 1SD5A 2BJ1A 1N25A 1BC6A 4DR6F 1OYWA 1N0VC 2HHHF 2D45A 1U26A 2PE8A 1JT0A 1W2IA 2UXBJ 1BW5A 1UMJA 3N5BA 4J9VA 1FMVA 2HWVA 2FGOA 1OR7A 4XICA 4ZK7M 2KKOA 1RCXB 2GMLA 1LWEA 4K2XA 2PMUA 2R5YB 4I2OA 1U9NA 4Z6YA 2KFYA 1Z2LA 2DNMA 1IJWC 1UAWA 3OTOJ 3F9KA 2ZM6J 3ECOA 3TEHB 5ETTA 5LMUF 5A2QK 1NEEA 3L7UA 5LHHA 4U7UD 1JTYA 2BRKA 2VICA 1ZGJA 4J7CA 3R9LA 2PMHA 3HK2A 5ILSA 1QAJA 2Y31A 3QYEA 1S72I 2CPFA 2LYCA 2BXZA 1QSLA 6PAXA 4NI2B 3M8RA 4FKYA 3H9JA 1REPC 5HK4A 2OTLS 3GZ5A 3JAMK 4BH9A 1ZM9A 5L9NA 3LGNA 2XY6A 5BOXA 4LLNA 2GXGA 3T5JA 1T39A 2FVSA 3UD4P 2R92J 4OYWA 2IMOA 2DH9A 3QAEA 3FCVA 4X4OA 3OYHA 1KU3A 2EWNA 1IBCB 4AE5A 1KDNA 1TL5A 1QAXA 2EZLA 4CNZA 5HJYA 4ZCIA 4LF7F 2CJYB 4B3MJ 1MDMB 3FCHA 4X4QA 2DA5A 3R7NB 3SDGA 5D0EA 1JGSA 1UHSA 4DL0C 2BANA 1Q78A 2HGMA 1ETXA 2FBKA 4NLVA 3M9AA 3WTSC 2A10A 2I5UA 1X4FA 2FB0A 3J7AO 1FVSA 4ZCMA 2IA2A 2EG2A 1Q0NA 3M8EA 1Z6RA 2HDCA 3VWBA 3QIPB 4ZN3A 1M5HA 1U02A 5CJ9A 1TWAJ 1XN9A 3IKTA 3QAHA 1YJWS 3GLJA 3C6UB 3GIIA 3BGRB 1RT2A 3SCKE 4WIIA 5MAOA 5HROB 4MEYF 3T1YF 5EYRA 4BGDA 1RTZA 5E3RA 1N34F 1UZCA 2QLWA 4Q0BA 4NWBA 3FMWA 2AD9A 2NXEA 4TU9A 2GA2A 1HKSA 1PP8F 3C2GA 1R0AA 3VYTB 2XLJA 2OFGX 3DOMA 1IUJA 3KMQA 1TL7B 2DNOA 5J2NA 3UVJB 4FNIA 2GWRA 3G1MA 1USTA 1H98A 2QEXI 3CC4S 4B3XA 4BJ6C 3IR6B 4UQGA 4HLXA 2JEIA 2ZSHB 3H0GJ 2F4OB 2HFNA 4LFUA 3RI4A 2CQ0A 2GQ2A 1YKWA 1TK5A 2KHCA 3MMCB 4X2BA 5K5QA 1E17A 4DV5F 3F8CA 1E3PA 5BPIA 5F08A 1DAXA 2H6CA 3LPYA 3VAFA 3GVAA 2CQPA 5E33A 4NXNF 1EKEA 4M3DA 1HNVA 4DQPA 1SI9A 4MIMA 1NKCA 3KYLA 1T0FC 5FKLA 2ZITA 2CQHA 4JYKA 1IKXA 1J5OA 2Z99A 5E3NA 4GMKA 5D5XB 3SZTA 1MWZA 2BR0A 3HXLA 2M8EA 4B3RF 4K2EA 3RJPA 1N48A 5LEKA 1XTZA 3MPWA 2VFTA 4W90B 2IAJA 3GW2A 4M5DA 3UDEA 2HIYA 3IFEA 3V4MA 3R2DJ 4OYBA 2XSJC 2QSFX 1NMEB 2PA8D 3TUIC 1VQNS 5ICEA 1X4HA 1P92A 3WU0A 3BO2A 5F8MA 2OEKA 4A2UA 1V9OA 2J0XA 3H2UB 2LRDA 3E5UA 5CYMB 3S14J 1ERDA 2RN7A 2QZ8A 2DR9A 1P6TA 4PXDA 1KU9A 4ZPBA 2E1MB 1YHQS 4PG5A 4DR4J 2LSOA 2KM8C 2POKA 5F0WA 4ZYDA 3MECB 1XDSA 3TW7A 2YKMA 1JNRB 2ZUAA 3BR9A 4BHCA 5KFXA 1JKHA 4GKKJ 3RR7A 1VQ8S 4TLRA 5DG9A 4ZHRB 2VA2A 5C42A 5F8JA 1NK5A 3MEEA 2HYFA 1VQLS 4F3QA 2VJ4A 5K8PA 1VC5A 4JI5F 4RAYA 1N77A 2XY7A 1M0SA 3HRMA 2PMZN 3PFOA 2JFDA 5EUHA 1Q1HA 2DFEA 3ETMA 3TO9A 2ME0A 3HHLB 4CYDA 3FX3A 4JI6J 3M4XA 4NDLA 5D6EA 2BEOA 4DV0J 2ZSIB 2KRBA 2M88A 4NNJA 1VQ4S 2DR6A 4X0GA 5E7OB 1RTHB 2GX8A 2KVIA 2Y9YA 3VSLA 2BOLA 3BYRA 3Q8SB 4CLLA 1GMUA 1OY8A 3MMBB 5J2PA 3I55S 1NBEB 1K9MT 1TK0A 4XONA 2BW7A 2DITA 3CJKA 2UVVA 2RHSB 1RAEB 3H9QA 2CQ2A 5IP7J 4D7MA 4LSNA 3BR2A 3OXFA 2VBZA 2M45A 3UCZP 2FJAB 3EXYA 5CABA 4KYZA 4L5JA 1MNDA 3C7JA 4QQBA 5AIQA 4AT1B 3Q0VA 4PAAA 4RU2A 3ZOBA 2DOAA 2L02A 3WC2A 2KT5A 3OYMA 3G73A 5KOWA 2E60A 2OJED 1S7OA 2VFRA 2JVOA 1FZPB 2DNNA 4TV7A 3Q0UA 4DL2A 2FOWA 4NCGB 1LEOA 5HS7A 1B8IB 3K0LA 2NS0A 2ROPA 5IFMA 3FXQA 3V4GA 1KN6A 2BVLA 1U4BA 1P9YA 3G8SA 1R7IA 2W2NP 2W48A 3UD5A 5D6GA 2VQFF 3HKZN 1LE8A 1NJIT 2HHQA 1IKVA 3BO4A 4ED0A 1RKTA 2DN0A 3BPSP 4OX8A 2XIGA 3CF2A 3A4TA 2EINH 3G2XA 4HYEA 1V54H 4UZCA 2KQRA 4QWQA 2FU4A 2HRUA 1VC6A 3M8FA 3B73A 3RYRA 3OWTA 5FKOA 1HMVA 1RBLA 5J1YA 2OP5A 3VAMA 2U2FA 1LUJB 4OQJA 2DK5A 3VF0B 2DA2A 2PI5A 1KQ9A 1NK6A 3OR1B 1LNQA 3IWLA 2QM3A 1XGMA 1FXRA 2JVHA 4OWRB 1ZHFA 2DTRA 3PIPQ 1HCRA 4IEJA 3K59A 4K59A 4L3KA 2CWEA 5B09A 3PDNA 4A3FJ 5GAEJ 3H4BA 2EFGA 4M72A 3MZIA 5FLVA 4DR3J 4QR0A 4B09A 1AKHA 2HS4A 1F0XA 4V1Ak 4PR6A 2E1OA 2JLFA 2XGDA 2ESHA 4J9LA 4DFJA 5B0AA 1N32J 3PJ9A 3PX0A 4Q48A 3VGUA 3PEJA 4MAKA 1HBUB 1PYTA 2ZB9A 1DRZA 4NA2A 2L3MA 3GMGA 1FD8A 4YB1P 4AVPA 4I0AA 4C7QA 2C3UA 1U1MA 4IFYA 1XMKA 2YPZA 1SAUA 2XYPB 1YJRA 3NARA 4KIGA 2RILA 4U7UK 1MMGA 1PC5A 3R5JB 3R4KA 3M8ZA 2AQ4A 2LQ8A 4UTGA 4HNVA 3HCXA 5L9XA 4BKXA 1IBLJ 1IR1A 1Y8RB 3C14B 4NXMJ 3S1MJ 3TUZC 4V2FA 3JQKA 3A8JA 1W5CC 5JI6A 3SDEA 2XVCA 4ED3A 1LFBA 1SUQB 1RT1B 2ZH2A 4NCBA 1T9TA 2CU7A 5L3DA 1FOWA 2IXSA 2H8WA 2GVDA 3H8YA 5E41A 2ADUA 3DOLB 4N5SA 5KFYA 3D6TB 2BA9A 3DRRB 3AXMA 4IZZA 2IS4A 1GMWA 1IUFA 5SZTA 4CLKA 2V68A 4P5OA 2L7MP 5LFAA 4ICLA 3L2UA 2JH3A 3LP2A 3UW1A 1N56A 1ETYA 1LW0B 1FK9B 3FBBA 3NWRA 1BC7C 5K20B 1UZDA 2BW3A 2Q79A 1WSVA 4ELVA 1H7XA 3LOCA 1H2VZ 2YPRA 4LB5A 4KYWA 2R7TA 2MD5A 5KHDA 3A1YA 2VIHA 4ENKA 3VPRA 3D1QA 4KN7X 2MZJA 4LRCA 2VQEJ 2HVEA 2WSFC 5DDRC 1MNMC 2ASYA 2GA1A 2BY3A 3VGSA 4ZDLA 2M7BA 4YFKF 2AU0A 3V6JA 3EZ5A 2NOJB 5GAGJ 4HH0A 2F5CA 1W26A 5F3ZA 1YI2I 4B3OB 2W2QP 1IKWA 2ID3A 3HFZB 1F60B 4I99C 2W9CA 5GADU 3K6GA 1O57A 1PUFA 2JSCA 2RNEA 3BO3A 2HRTA 4X4UA 4CXFA 2W82A 2WONB 1E3HA 1S9HA 3TO6A 1TNSA 5ETPA 1JKRC 2GQQA 2HRYA 3PHTA 2V8GA 5B0FA 1FKPB 4GKJF 3TMOA 3DMJA 4LSLB 3MM6B 4E0DA 3KYDB 2O3FA 1YJ7A 1IV6A 3KG1A 2FHJA 5GVQA 1A31A 4DCPB 3SZ2A 2G4BA 1L3SA 4ZZLA 2R5ZB 1VOMA 1T8EA 1D1BA 3V7SA 3LQVA 3IWNC 2F5FA 4IH7A 5JJBA 3KZYA 1TL1A 2LCWA 2X1FA 1F36A 3PNYA 4KT6A 2R93J 3X1LB 1C2PA 2KTQA 2KT2A 4PG8A 3TDZC 1VLOA 3GZ7A 3HSRA 3Q86A 2HNHA 1XN7A 4E2FB 4BACA 3DRPA 1X2NA 1WELA 2HBYB 7FDRA 1YIOA 5C5JA 2DMNA 5HATA 2QO3A 3G87A 2E19A 1HNZJ 4F67A 3GJRB 3WIVA 4DQIA 1R8PA 1R3NA 4WP8A 2DB1A 4LR8A 2HOSA 5I3PA 4DSEA 4HR2A 1XTAA 1GVJA 1OS5A 2QSWA 3PXGa 3FM5A 2HGCA 4BC7A 3CCWA 2XAGA 2DH8A 3I0SA 4I2QB 4OJ1A 3HKWA 5KTQA 9ANTA 3FMSA 2ZXWH 3UNGC 2GZOA 4YHHF 1WI8A 4IOBA 4DZJA 4P6QA 3FZVA 3DV8A 3ILJA 3MUMP 2E29A 3C19A 4QR2A 3FSYA 1ZYQA 1OY9A 3DRSA 4I2PB 4U0YA 3MF5A 2B4OA 4QZVB 4A5NA 2O3DA 3M8YA 5BXIA 4KISA 4WZQA 4GO7X 4LSZB 3S3MA 1AROP 5AXMA 1TBXA 2X1AA 4OI1A 1RHRB 2IDEA 1GVDA 4ELUA 3NBPA 3PW7A 3LWFA 2N8GA 3GTOJ 1MD0A 4IOCF 2IW5A 1PBAA 2UXNA 3HSDA 4ZA1A 3QRQA 4AYBD 5ICGA 3A01A 1DU0A 1DPUA 3HZEA 2VBYA 2XROA 1K4TA 3C3LA 1CJKA 2VKEA 2EXUA 5DO2A 3RCOA 3D1NI 3GJTB 2GHPA 2Q8KA 3MXHP 3M1VB 1Z6TA 1JLCB 1D3WA 2DGUA 5ETQA 2XRNA 2XGEA 5IV3A 3HJFA 2FJEB 5F41A 4JI7J 1KYWA 3DBRB 3FK7A 1WRJA 4KO0A 2X6XA 3HPHA 4F4WA 2N4DA 3C2HA 3RSNA 1ZOTA 2DEIA 2RRAA 4BE2A 1S1XB 4XTTA 2HZVA 1G6BA 3T1BA 5LOQA 3O8HA 3K4NA 2R8KA 1Z21A 1E6VA 1Z4UA 1QVFR 4FYDA 2IPQX 3SV3A 3LNQA 2VFVA 3V4IA 5J1UA 1VQMS 3GWCA 1N88A 2J5AA 3CCQS 2XI2A 4F36A 5HLGA 4O44B 3ERMA 4ZLPA 3OYBA 1FIPA 4IG0B 3NY0A 2COMA 2QTWA 2BKOA 2VA3A 2IVYA 2HQDA 1MBJA 1ROFA 2EEYA 2WA0A 3PNVA 3WX4A 3KETA 2DFFA 4IHTA 4MK8A 2GAHC 4OFZA 4PG4A 4A8SA 2VONA 5ETSA 3A4CA 3W60A 4OYZA 4I09A 1TV6A 4YG2F 2DAOA 3RKYA 1Q5YA 3V6DA 1OPIA 2RKIB 5BYSA 1BJZA 2MYSA 3SHFA 1WGXA 1HWUA 2BBYA 1FX4A 5CD4H 2H1LA 4Z37A 3SSSA 2DGVA 1HW1A 2CQQA 4HG2A 1NJWA 3SCJE 1VQKS 2BXJA 3HZGA 4KKOB 2GGPA 2GM4A 3QPTA 3GLXA 3HSGA 3D3CJ 3H59A 2J6UA 5HQMA 2KL8A 1SD6A 2CH0A 2C2NA 3AJ1A 5FLXU 1GV5A 3JQJA 1EP4B 4XIDA 1Z05A 1VYAA 2F7VA 1OQYA 1FWKA 1J09A 1XGSA 3ENQA 2NXUA 2WB1A 4HSTA 4XRMA 4O0IA 3UCUP 3PX4A 2IPOB 4CTAB 4A3MJ 3E6DA 2I2YA 2NAZA 4PGHA 4ED1A 3ZZYA 1J5EF 5KFCA 4HHJA 3G8TA 4AL6A 3GIRA 4S04A 4HBLA 1LWFB 1REVB 3VV2B 3CCVI 2V2ZA 3M32A 1UW4A 2J9EA 2J6TA 3VB2A 3RW6A 2CA9A 3DCAA 3DNCA 3OD2A 3CCEI 2HNYB 3PQJA 4LIWA 2DCLA 2UXBF 1ZGWA 2UV1A 2MEWA 5DS9A 1FJLA 4EWTA 3S1RJ 4G6VB 3D0SA 3G96A 3FISA 1V3ZA 5GADI 3S6EA 4XLCA 1U6FA 2RDJA 2UUAJ 2RDIA 5C3EJ 1KP6A 3N28A 3R3TA 4NLTA 1G3SA 3T1HF 3U1MA 2ZEJA 3KLFA 3RYLA 4EJTA 3OYFA 2DVIA 2WOMB 1NZ8A 3NLCA 3AT1B 3W5YA 2D3OR 2RHQB 3CJTB 3Q22A 3G6YA 1XMAA 3CJ5A 3DLKA 1WJEA 2QLJB 3I4MJ 1TMMA 4F3MA 2M7SA 2DMTA 4NLDA 2MKIA 4W4MA 2DK2A 2H65B 4RW6B 5IS2A 2ADCA 1OO0B 4DNCA 2CZ4A 4IL6C 1K78A 3RYPA 2WB4A 1BWVA 1RWMB 5J4YA 1E0EA 1HW9A 2HFOA 2JVRA 3S01A 3DM2B 5FLXK 2DOFA 4XPCA 3D5LA 3BR5A 3DC2A 2D69A 1YK9A 1LDJA 2X51A 4LF8J 4AFFA 2AJ4A 3CDHA 1W1WE 3DPLC 2BRLA 5CAAA 4USVA 4DI6A 4OYIA 1FOXA 1R6VA 3V2UC 4P2SA 3G6ES 2V6CA 3TOAA 4G1QA 2AQFA 3HOSA 1B3TA 3VWSA 1Y0HA 5JHUA 1SV5A 2F8MA 3I9V9 3H4DA 2D1CA 4PPZA 3WTTC 4RW8A 3D5MA 1T05B 1ETKA 2EBIA 3ENAA 1K8AT 1ACMB 4ERDA 4ZIWA 3PYGA 1DDNA 3SCIE 4LF6F 2ZBQA 3IAS9 1XNRF 4B47A 5JLWA 1FTCA 1YJTA 5LT5A 3A3OB 3FXLA 3AQOA 2IS6A 2LLKA 2K3IA 4OHVA 2OAUA 4HX4A 1AYEA 2CJKA 2GMJA 1V5FA 2B9WA 2N3LA 3RRHA 2GO9A 1WF1A 2QKMB 5LSLA 1A9NB 2XC9A 3M8WA 1AOYA 2RB7A 4DCOB 4Y15A 5K5RA 4J90A 3ZQLA 4Q5SF 1MNEA 4ALZA 3OUYB 2B4UA 3LSRA 2L5QA 2W1BA 2Y30A 2QGUA 1ENHA 1NK2P 2H51B 4Q47A 4CZZA 1H0MA 2JA6J 3GIJA 3QO9B 3MMAB 1X4PA 2V50A 2HTJA 3ZQQA 4ZVPB 1GTHA 3FHZA 4WPAA 5DQGA 1RESA 3CJNA 3IM9A 4YS2A 5H2FC 4CYUB 3HBLA 2LY2A 1DARA 2CNNB 5E3LA 1B70B 5I3UB 2A18A 2J7KA 2OPQA 4XLPF 3ISNC 1PJ7A 2M7AA 1UVIA 2CXEA 1LWCA 3T5HA 4XK8C 4H4KC 5CCLA 1S4FA 3THVA 1O3RA 4IH5A 3ZNUA 1UZHA 1N75A 3PNTA 5M2UA 4KY3A 2EILH 4HH1A 5L1IA 4ABZA 1S1UB 4R5PB 2QQBA 1V5VA 1HPZA 1CULA 3HOYJ 2LXFA 5D0GA 3GB0A 5F0UA 4OZ1A 2L3DA 3TJ9A 4B9VA 1W5TA 3EVMA 4DUYF 5L1LA 4NQWA 1DFDA 3GONA 2BACA 2V9PA 1IXCA 3E1SA 1NDLA 1MJ9A 1BQMB 5J2MA 1WC0A 1LK7A 1B64A 2VF3A 3V81B 1XERA 4AL7A 5LRRA 4B1RA 5IT9U 5ETRA 4FP9A 4O23A 2HNDA 2FD2A 3KP5A 4BXUA 2W7NA 3W5XA 3FM3A 1S9GB 1X3ZB 2FJDB 2EH3A 3HHGA 3GXOA 1ELOA 3EWGA 1UCNA 5C2CA 4LFAF 2Z58B 3FMRA 3OOUA 4RLEA 1ON1A 2PI4A 3T0YA 2FY8A 4IRDA 1RNLA 4PWDA 4IR1A 1JJ2R 3H7HB 1YDLA 4M6YA 2RQ4A 2B3TB 3GFIA 4QWAA 2A6OA 1QRYA 1ZTTA 4JP0A 4DR4F 2LA4A 2VQGA 3PO2J 2NSCA 5U47A 1M5PC 3W2VA 4EEYA 3UPFA 2HDDA 1IGNA 3SYZA 4E7LA 3EMTA 1T8IA 3AHPA 3ETOA 2I8EA 2HS5A 4DL5A 2HK3A 2XPWA 4ZVGA 1K0VA 4R0EA 1GXLA 4K0KJ 2K4BA 3R7BB 2YU3A 5TJJA 3MUTP 4QYZJ 5FD5A 4C8KA 2X6WA 3S1TA 5AE1A 3RBZA 2F8EX 3CUQC 3Q5FA 5J1EB 3QQCD 4LBIA 3IMQJ 2LBFA 1UVMA 5AE3A 2YR2A 4DV0F 2KDZA 1VIOA 3TAQA 2L7FP 2DDAA 1Z67A 1JHFA 1KRPA 4A3KJ 2QX0A 4XLNF 3GSIA 4DFPA 4QU6A 2OUMA 4OYAA 2A6TA 2M4MA 4YDXA 4PZJA 4LIVA 2DYSH 5B0CA 4PG6A 5IT9K 5CYQB 3GV7B 3CJRA 1STZA 4ZVHA 4Y28C 5IT4A 1FVQA 3K4JA 2Y69H 4P73A 2JZ5A 2PJPA 5F1JA 3DXBA 1FYLA 2VLAA 3ZMVA 3GZ6A 3BKTA 4Z7CA 1FEHA 2HXOA 2GOXB 1SD4A 4KHPF 2IT0A 3DP7A 2RE1A 4WFXA 2M2BA 3DTIA 3MTKA 1SFUA 4P9FA 2HZTA 1F1ZA 2MHEA 2QEXS 2IJLA 2JSPA 1MLAA 1KZHA 2EQRA 2JJ7A 1RWPB 4NE9C 2FEZA 4NA3A 4RO0A 1JLGB 2R8HA 3P9KA 5JVGQ 2FY1A 3GV5B 3ZCOA 3CMMA 3DI6B 1BBYA 2CFXA 4CO5A 1X4OA 3LQQA 3D0IE 3LOUA 5E18F 5GMDA 1DP3A 3D3BJ 3NGTA 1YGYA 1BY9A 1DQ8A 1Y11A 1G3OA 3Q2SC 5JR3A 2RMLA 5KFKA 2NOGA 1KVIA 2XMTA 1TMJA 4N8OA 3VAJA 2CUFA 2MLKA 3EGZA 4ZJOA 1IC8A 3VFZA 5A2QY 1M1GA 1TTHB 3CCTA 3NRVA 1ETWA 2XRLA 3L2QA 2ASDA 3M8QA 3AG3H 1Z91A 2P81A 2MGZA 2AYEA 1BE4A 2YXLA 3O8WA 2XS2A 5LSRA 3ZTOA 1N32F 3JAMY 3EDQB 1P27B 1OMIA 2MH2A 2IYIA 4LJZF 3EGNA 2HVZA 3DFEA 3NGUA 5K14B 2JMWA 2MQQA 3IAS2 4NLSA 3OJUA 2LLZA 1PO6A 3THPA 3ELHA 4M73A 2C28A 1AU7A 2XCPA 4DR7F 5C24B 4JI8J 2JRSA 4NOHA 4PZVA 3W63A 8AT1B 3OR2A 1N36F 4QPOA 4UV8A 1RT4B 4QPTA 1RYRA 2YQ3A 3KX2A 3I5UA 3TDUC 1NLKL 3BSAA 1S5LC 1GT8A 1YW7A 1X4AA 2ZE2B 1YJUA 4M5NA 4IQ4A 2V8DA 1YX5A 3M8PB 1VHIA 2RU3A 2Z1DA 1GMWD 3BPDA 1OCOH 4F4XA 2YWKA 3AJDA 5C25A 2R3SA 1R71A 2DCEA 2LKXA 2Q6CA 1U47A 3M9MB 4F4ZA 2YBVA 2OJ3A 3QOPA 3W5ZA 3J7YU 5J4VA 1MBHA 1RXOB 4LF2A 4Q44A 3DOKA 5KG5A 2L54A 2FPHX 4F02A 4PJ0C 5KAFC 4OJ3A 2K8GA 4F7VA 2WV0A 1YTYA 3ZC4A 2UXDJ 4HKQA 4WFNQ 1ZM2A 4FXVA 1C1CA 1CQMA 1D0ZA 3JRHA 3NCQA 3P7NA 2ICWG 2CV2A 5KG0A 3DPUA 4C2MA 4IHXA 3DGPB 2MABA 4FF4A 2HHWA 5FDLA 5J3LA 5KG4A 2BW2A 4C8ZA 3HLUA 2BE7D 1S10A 1RTIB 2YNGB 5DETA 3KEQA 3QSIA 1KQGB 5KT4A 1TAUA 2QLZA 2GW8A 1CJVA 1KLMB 1OCTC 4A0ZA 5M5YJ 4K5RA 4HACA 3IRXA 1IM6A 4LQ9A 4AIDA 4ZLNA 5E0OA 3J7AY 4CQ1A 4ANCA 3RB6A 3BGLA 3BPXA 4JX4A 3R6SA 4C9YA 3IWZA 3KG0A 5K5OA 1BM9A 3OL8A 2DGQA 2OPTA 1TVRA 2FHJD 5D8KB 1IXRC 3NG8A 1LWEB 3TX0A 1TQPA 2KJBA 1KEKA 4XOPA 3KTQA 3LSJA 1WQ2A 1RAGB 3QP6A 1U5TC 2Y1LB 2FX0A 3PFEA 1C0TA 2E34A 2RH3A 3AOBA 4B43A 1F9EB 1TKZA 4HV5A 4C8LA 3L95X 9ATCB 4U67Q 2E5IA 4MIAA 3CGIA 4NYZA 4MTEA 4WP9A 4BHPA 4KDPA 2NZ4A 2B0LA 3PVXA 3OPKA 2WW4A 2LOOA 2HYIB 3M6XA 1ORKA 3OFFA 3PACA 5A8RA 4IO1A 2O01C 1HNZF 2ASLA 4Q7AA 3KXDA 1SPBP 3R0AA 1OMSA 2FVQA 1TW2A 4RJVA 1T98A 2KVQE 4LF1A 1FSEA 1CJTA 4L76A 2UXXA 4LF9J 4A3JJ 5E1ZB 2ZKZA 3ZQCA 2MA3A 4CZCA 4DQSA 1FBSA 4Y17A 1EKSA 1ZS6A 2VPZB 3MFIA 2C2MB 5C44J 4PRFA 2QG9B 4HLBA 2DY1A 4MK9A 2DA4A 2PQ8A 4I7HA 1HI0P 2BANB 4G7OF 2XULA 3MHYA 4OMFG 3I56I 1FA0A 2COBA 4CP5A 1FESA 4IHSA 1NU4A 4R0JA 4Z2YA 4XL9A 2ID6A 2XAFA 5M3MJ 3MQ0A 2JEJA 5EX0A 4PJMA 1K47A 2C2ZB 4GVBA 5D4PA 2CPIA 4RGUA 3K8VA 4PCQA 2BQUA 3HSJA 2GXAA 3ILOA 1CSJA 1U45A 2EW9A 3K57A 3RDIA 4LR9A 3O6BB 3MKLA 4EO6A 4LF4J 2KISA 4HX8A 2R8JA 1Y5LB 4II2A 2LQ9A 1H89C 1JXSA 2FHKA 5K8OA 2GIZA 3REOA 2UV8A 1RT2B 5D4NA 1IRGA 4HT5A 2JT1A 3NS5A 1CLFA 4UVAA 4F91B 1YITI 2YKQA 2EJRA 4Q0BB 1TKTA 2ZWOA 4G7ZF 1LFWA 4JI7F 4FTHA 1QBJA 3ERED 4B02A 5A76A 1SQFA 3ZP5A 1R0AB 3PSIA 3QWLA 5EGYA 3DOMB 1SEUA 5J2NB 4P71A 5J8CA 5E1XA 2EFVA 3GG0A 2QIFA 3N0VA 5L3CA 1NSPA 2XKPA 1W2BR 3JYTA 2R7WA 1VDHA 3MM8A 3KLGA 5H20A 4DSLA 3AAFA 4DL7A 4F2RA 4N0BA 3WBZA 5KG7A 2NSBA 3E51A 3MAAA 1FT8A 4Y7NJ 2MJUA 1R27B 5H9EK 4MJKA 5KK1A 4FQGA 2DNHA 1BHNA 4UV9A 3MKZA 4BDPA 4XRSG 4B3SJ 3HD2A 2XMWA 4BL0B 1VR6A 2GIRA 4HF0A 1HNVB 1N33J 2UUBJ 1JQGA 4O6JA 1FY7A 2CQCA 4CO1A 1YI2S 3ROUA 3LALA 1O3TA 2HKXA 4C3IJ 1YRNA 1L0OC 1IKXB 2NVYJ 5H9FJ 2FQ4A 1J5OB 2WB1N 1X9WA 1RKWA 3OXGA 2ZHBA 2HVHA 1RACB 1NG7A 2G9OA 4X62F 4AUKA 1U8BA 3HOVJ 3JXOA 2CW7A 3MDFA 2IAJB 2WCXA 3VOEA 3ZQHA 1ZRCA 1K44A 3EM1A 1FWPA 4M5DB 1LOUA 2G9WA 4C2UA 1V5EA 3OT9A 3T5LA 3I3LA 2H4WB 2B9SA 3LSTA 3OFGA 1Y10A 1SJRA 1T9WA 3J7YI 1IZ1A 2WB1D 4TNOA 3IO1A 3CCSI 2EBEA 3LSKA 3JTPA 2EFWA 1UETA 2IFXA 2PO4A 4D9JA 3K1MA 1W36C 2R2SA 4DV7J 4G1IA 3HB9A 4YOEA 3AFHA 4TKTA 3CDBA 5AE2A 1UJ6A 1Q7YT 3FKJA 3H35A 4QIGA 4HF2A 2KDOA 4A47A 3HOTA 1IR2A 1LJ9A 2RGVA 2YKMB 1OJLA 2MKHA 4RB3C 1JKHB 1Q8KA 5IY5H 1XCVA 3JSOA 4MGRA 3DXJF 3JRFA 2Y8WA 3D5SC 2W8LA 5C42B 3MEEB 3IG1A 4OU0A 2ZJPQ 2ZMEA 2ZH5A 1O5JA 2Y48A 4KV8A 2RS2A 1PIEA 5EWGA 4USHA 2EKYA 3TA1A 3MFKA 4B9NA 1LEBA 3SQOP 3KLEA 2VOPA 2JTVA 1APLC 4GCVA 2LA6A 1LVAA 1QNTA 1PYSB 1YO5C 4O3MA 3MM9A 3IP4B 2P5VA 1NTCA 1IVZA 3ZGKA 4CT9A 2QFIA 4IHWA 1QHGA 3ZXSA 2HBZB 3OFHA 5J2PB 2Y1RI 5BYRA 2DA6A 3E01A 3CJKB 4UY85 2K40A 2KL4A 1WOSA 4LSNB 1WKKA 5JFRA 5L1JA 3N05A 3CDIA 5IYBJ 4BQNA 3OQ2A 3R5AA 4ZVQB 5ITHA 3WTVC 2H5JB 5IV4A 3Q9SA 3NAHA 3HEFA 2P0WA 3IGVA 3GF2A 2JDJA 4UUSA 1UA1A 4Q5VA 1FF2A 4PG7A 4M95A 4D5CA 4IG3A 3LQRA 1S99A 1QD1A 3AB4B 4WBFA 1DBDA 1AUSL 1R0CB 3ML6A 3IBFB 1T6SA 2UUTA 1JLBA 3PYEA 1RT7A 2DNPA 3UN3A 2CQXA 1NPRA 4BJ5C 3JSPA 3KOAA 4Q45A 4DXLA 4Y65A 3HHHA 4BC9A 3QBCA 1LE8B 5LD2C 1OLTA 3KP7A 1IKVB 2L9RA 2Z16A 3HTSB 1TC3C 5HVHA 5CA5A 2DHAA 2ZNYA 3QP5A 1I94F 2D2WA 1HMVB 3MM5A 2YKNA 3TP2A 2C42A 1ZG1A 4FX4A 3W6KB 4LREA 4WFZA 4X4RA 1HI8A 2VPLA 4GO5X 1VIXA 1ZYRF 2LFVA 4FZVA 4EVIA 2KJWA 6FDRA 1GLNA 4K4WA 1UEKA 5LHGA 4GXOA 3HOWJ 2XZWA 4C48A 2BKNA 4URSA 1TR0A 2CV0A 1A6LA 4DIQA 5FGMA 2EI5A 3PW2A 5GPAA 4CO2A 1X58A 4FN5A 4DWIA 5KFLA 4KIBA 1TELA 2HMIA 2LP0A 1AKHB 1JLEA 2MQMA 5DQHA 3CF5F 2XSFA 2OUGA 3TO7A 3MKWB 7FD1A 1FXDA 3BY6A 3CDAA 3S3NA 1JLFA 1XB4A 3PRVA 2ME6A 2KJVA 2HHSA 1RDRA 4R25A 2XAQA 1IKYA 1UJ5A 1V5IB 3WQPA 4WK8F 1KTQA 3K2ZA 2R2TA 2R0QC 5IWAJ 2XF5A 4IFYB 1R5ID 3QMQA 5FFZA 2B4VA 4URGA 3M30A 3NCRA 2LMIA 3QGIA 3I5AA 2A61A 3W8GA 4CT8A 3G71S 3OV7A 1RBAA 2B5JA 4FYYB 1F9NA 2JSXA 4M5JA 2QVOA 2F3JA 2AQEA 3LANA 2H09A 3SJMA 4YELA 1YFHA 1VMBA 3G82A 3HVAA 1S8NA 3MEGA 1D5VA 2W85A 1X1PA 3IR7B 2JA5J 2GVDB 3L7WA 4G8XA 1WD6A 2B43A 1YS6A 1S97A 2QQ9A 5E1WA 1EJ9A 2MMYA 1WSUA 4KH1B 1D9FA 1F3VA 1P6RA 1YQHA 1X4BA 1RP5A 2V67A 2YPYA 4I7FA 3CIMA 4KA4A 2VG6A 1YLFA 3LAPA 4DQRA 2ZC2A 1OSCA 4ICLB 5KFNA 1DHMA 2DTJA 3LP2B 3V5RA 1FDBA 3CWJA 4DW6A 2OD4A 2BW3B 2PG4A 3AG2H 4XN0A 3P5BP 2Z33A 3B54A 2UVWA 1W5SA 3EETA 3PO5A 2NYXA 3KZIC 1WWXA 1PGZA 2VUGA 1NHAA 1WC4A 4A6EA 3CO7C 4ELTA 1H9TA 3LW5C 1SH0A 4DR2J 1SMTA 4BBYA 4OLOA 3HOUJ 3SZPA 4OHYA 4NEYA 2VQHA 2JHEA 1K61A 2H5EA 1FP1D 3CMAI 1S0NA 4CRJA 5LBQA 1RQ0A 4F26A 5DDGA 1BR1A 1HWKA 4L72B 3K4CA 5D0HA 3EE3A 2WY7Q 3UO0A 3GFMA 4E7SA 2XWXA 4ZH4F 2FLLA 4C9DA 3HX9A 4ZP9A 2QLFB 1P4XA 3TZZA 1CG2A 4ZOSA 2HHUA 1JJ6C 4C3MA 3MCOA 1HA1A 1J0RA 1S9FA 1IKWB 5DLGA 2W9CB 2Q2EA 2PBIA 2L2OA 2ZXHA 4RS8A 2ISYA 2DCUB 1PUFB 1HNXJ 2VJ5A 4G9YA 1R7JA 2ZBIA 4PJNA 1P9QC 1XR6A 4KE5A 2CRLA 2CV1A 2VU5A 3HT3A 3DMJB 5K7HA 3TGNA 2WAFA 2AXTC 3IR5B 4WXCA 1VCTA 2GLOA 4J37A 3RIRA 3J7Z5 1I1GA 4ZDNA 3F8MA 2HI3A 1QDUB 1FNNA 4WXWA 3BJ6A 1TL1B 1VQ7I 4ATNA 2JEGA 2R8GA 1WC1A 3NOGA 4RBOA 3DRPB 1SC1B 3IM8A 4J9UE 3OFEA 3V42A 3N6NA 3V7RA 4NZ7A 4KBIA 1S6LA 1DTQA 2QMUB 2VB6A 4L0YB 3W7BA 1VQ9I 2FZCB 5DDQC 1LQ9A 3FQKA 3CCJI 1AWCA 2ZH7A 4OYMA 2KIMA 1LXJA 3VR1A 5I4MA 4HHUA 1C0UA 4UW2A 2P8TA 4K4ZA 3DLEA 1YOVB 1KTVA 3LTOA 2DMUA 2MB0B 5DCMA 3CSKA 5M5WJ 2Z0GA 3I0SB 4CCMA 1IN0A 2XC7A 2WK4A 5ED4A 4R8UA 3OYAA 3Q8VA 3RPUA 1XSDA 4UUWA 1IJEB 1UW9A 5LM7E 2H5IB 4IJAA 2EB7A 2L01A 5KFQA 3MEDA 2KXHA 3DRSB 4OAYA 2N7YA 4HYKA 5F0HA 3CD7A 4P7VA 3QODA 2V4JA 4RW7A 3OSGA 3TUJC 2RC4A 4DG1A 2IRXA 3Q8RB 2QYCA 1L3VA 1YJ9I 2HPMA 3IS9A 2OCEA 3QPLA 1ZELA 3PY8A 5THWA 1U1NA 2LXUA 2DGTA 2N82B 1A6IA 5CQGA 2DHXA 3CJSA 3NBPB 4M3FA 3W2WA 1AZSA 5HMXA 3DTEA 4DFMA 1FBQA 4DV3J 2UXCJ 3BGUA 3A01B 3GBGA 5BQTA 1CJKB 2VJUA 2PIIA 2OMLA 2DNLA 1SKSA 4USJC 4Y00A 1K4SA 2CUJA 2AHOB 2YS9A 3E7LA 3KJFB 5LLQA 3VDXA 4L74A 4EJUA 2IHR1 1T03A 2EFNA 4HDHA 2M30A 5KCMA 1E6VB 1E6YA 1KKHA 5HO4A 1UVLA 4EJWA 3KZZA 2VQLA 3R60A 3EPIA 1FOYA 5FLXY 1O7FA 5GAEU 2ZBPA 3V4IB