2XDBA

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
b'MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXN
publication title A Processed Noncoding RNA Regulates an Altruistic Bacterial Antiviral System.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Toxin/rna
total genus 48
structure length 162
sequence length 162
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xdbA00
4GLKA 2XD0A 2XDBA 4RMOA 4ATOA 2XDDA
chains in the Genus database with same CATH superfamily
2CH4W 2MK5A 2E41A 2RQTA 3X28B 1YJWA 4C92G 5CKHA 3SHWA 5I22A 2FB7A 2VXEA 3EHQA 4ZGEB 1O75A 2F1LA 4M75G 2DL3A 4M77A 4Q5WA 4C8QG 3X26B 4Y92A 4M7DC 3G4ST 3DLLA 1VA7A 4EMKB 3OYIA 4C0DB 5IHNA 4ELYC 4J6XA 4J7FA 2F2VA 2CGHA 3NPFA 4HCZA 1ZX6A 1ZA2B 2V8IA 2DJQA 4F17A 1R0CB 1I4K1 1OV3A 2M0YA 1OZ3A 4HKEA 2QI2A 3BFMA 5C6SA 5IXBA 1D1BA 4EMHA 1I5OB 1VQPT 2KEAA 1QVGA 5GAN8 1X75C 4FSXA 1UECA 4OF1A 1MMDA 3CCUQ 1Q86U 2KRSA 4N0AC 3OYJA 1OOTA 3H6ZA 3CCLQ 2QK0A 3CMAT 1HYOA 4C92C 3E9FA 3NHNA 3CXCA 1NYGA 3JB9I 2P84A 2VYTA 4IUPA 4M75C 1WI7A 3UT1A 4C8QC 5I11A 3CCET 1YCSB 2LJ3A 4JS4A 2RHZA 4J9CA 4CC2A 2K5LA 3JCMJ 5DM7R 2XICA 1KK7A 3RUXA 2MYSA 5IAYA 4BY6B 3D7SB 3VV0A 4B6MA 1BB9A 2IVWA 5IXFA 2K3BA 3JB9H 2DTIA 1PCXA 2CP7A 5A0DA 5GAOn 2RMOA 2F69A 4YTLA 3GPLA 2QA4Q 4M78F 1QVPA 4M7AD 2SEMA 1IHWA 3PMIA 1KQ2A 4KGZB 3QSUA 4XTWA 1X43A 2KT1A 2KRMA 1RAHB 1SRMA 2KYMA 3RMSA 5A0LA 1YHQT 3V7SA 1SG5A 2WACA 1G83A 1AOJA 2X3WD 4XK8E 2OTLQ 5LJ3d 3QHSA 4OB1B 3CCQQ 1YIJT 4RCBA 3HL8A 2KGTA 2E3HA 2HD0A 1VQ4A 2BE7D 1WQWA 2EGEA 1IHVA 4KGXB 2KDSA 3V7CA 1EZZB 2FYKA 5I21A 4DOVA 1QKXA 2DL7A 4B9WA 1BIBA 3URGA 2D8HA 5GMKe 2AIRB 1UGRB 1QQJA 3MCAB 3OW2P 3QDFA 3OYKA 1ACMB 1VIEA 3CCMQ 2DZCA 2QEXQ 2DXUA 2DL5A 1A0NB 1IXDA 1WDXA 1MV3A 1X69A 1ZUKA 1Q81R 1KC8R 3CPWP 3UA6A 3L2VA 4BE0A 1ZLMA 4XAXB 4FM4B 3A8MB 1JBMA 4R55A 4JUVA 1Q7YC 4DBQA 5IH2A 1M3CA 2V1RA 3PTAA 3CQTA 3H41A 2HL5C 4F7UG 1VQLA 3QZ9B 2F2XA 2RHXA 1YNZA 5CO7A 4PJOD 2DVJA 1KSWA 3E9GA 5EC7A 3PMTA 1PSEA 2GGRA 3FJ5A 3QO3A 4ZGDB 2KY9A 2ZCFB 3PFSA 4QVZA 1FXXA 4M7DD 1P92A 2HBPA 2J05A 2OI3A 3EG1A 5GMKm 4QT7A 1M1KR 1D3BB 2DE0X 2EAYA 3FLGA 3HFOA 3OYYA 3PIPA 2MF2A 5LJ5f 1M2VA 3CC7T 2BUDA 3CC4A 4GLKA 3QJ6A 1AVZC 2JZ2A 2DL4A 3OS0A 1KJWA 4M77F 2DL8A 1PRMC 2DD4A 1NZ9A 1BBZA 1Q7YR 1OI1A 3M4YA 1E6HA 3EG2A 3VU3C 5CQXA 4MZTA 4QKUA 2CP3A 1RLQC 4DA4A 3DKMA 1W2BA 2DO3A 1D1AA 1ZBXA 3VKIA 2O88A 2K3YA 1C0MA 1G2BA 2DXCA 5IHIA 3BY7A 4AFZC 4C92D 3M0RA 4IIOA 2PVDB 2EYQA 5EG2A 1JRIA 2J7IA 3G1JA 3GNGA 4XU2A 4HVUA 2RHIA 1SSFA 2EWNA 4C8QD 2EYYA 2E70A 2QDLA 3BW1A 2QQRA 4HXJA 3BE3A 1WX6A 1BI3A 4JZ4A 4C0ZA 4DQ2A 5GAOp 2CUBA 2K2MA 2XKOC 4QQGA 3EG9B 3JCMg 1R77A 2ZPEB 1VQ9T 1VQMQ 1K76A 1B07A 3INZA 1V76A 2E4HA 3CCUA 2DVEA 2XU8A 2LCSA 3S3OA 3M54A 5GANg 3PNWC 3M0PA 4IURA 3CCLA 2YRVA 3MEWA 1G3TA 1VIFA 1T0JA 1VQ6T 3KFVA 1PM3A 2RQUA 2KSSA 1M1KU 3RESA 5FLXE 3OYDA 4LNPA 3QUIA 3RKXA 2E64A 3FDRA 2DKGA 3CPFA 2GTJA 1YJ9Q 4BUGA 4PJJA 4Z88A 1GCQA 2RJDA 4AFQC 2VWFA 2RF0A 2VB6A 3M5AA 4E2FB 5HK0A 5CAIA 1VQKT 2HMAA 5GAN5 2RQWA 1QVGS 5KYYB 1OQKA 4A4GA 3ZL7C 1NEBA 1Q7YU 3META 3OYMA 1YJWT 2HBWA 2EPDA 3G6EQ 1H8KA 5AT1B 1VQOQ 1B3QA 1ZA1B 1MMAA 3C0CA 1BI2A 2NWMA 2AKLA 4LUDA 4AG2C 3SWNB 2D8JA 3CXCS 1WZOA 3A1PA 5HK3A 3GIBA 2KK4A 1SRLA 3CCQA 1M90C 3JCMf 1KD1R 4ZN3A 2D1XA 2A3LA 3MO8A 1NM7A 2CZ6B 1GFDA 2DEQA 1NEGA 1MNDA 2L0AA 2AHJB 2YSQA 3I56Q 3CMEQ 4PJOE 4PFZA 5GANf 1K4US 2E5KA 2P0KA 1VQNT 3EH1A 5GJVB 5KCOA 3PT9A 1SEMA 2L3SA 4Y28E 3CCVQ 2HSEB 3CCMA 2QEXA 4M7AG 2EVRA 3VYHB 4FT4A 4MDXA 1TUDA 2QAZA 3G7ZA 3P8HA 4M7DE 2RK1A 4FYWB 5DLQE 4GBQA 2KT8A 4DBFA 1QW1A 3OW2A 1LNXA 2ZPGB 4XU1A 2K5IA 2X4XA 1YCYA 5GAMg 1MMNA 4J9DA 3PVQA 1VQ5Q 3FB9A 1OPKA 2PVGB 3CD6Q 4AFSC 2XDDA 5FRMA 5GAMj 1N6AA 4M78A 1OU9A 4VUBA 2MCNA 1UHCA 3GNFB 4B9XA 4N4IA 4XTYA 2CYZB 2KXCA 4MMLA 3L42A 4FU6A 1Z9QA 3OBYA 1G3WA 1Q82C 3VUBA 4RTUA 3GBQA 5CKFA 2HNIA 2JN0A 5DLOA 2JT4A 4C92E 2MOXA 3CEYA 3SFMA 2RHYA 1JXOA 2VC8A 1MUZA 1AZGB 1VYUA 4TVRA 3X20B 4JRPA 4F14A 4M7AC 4M75E 4C8QE 4J9FA 4OMMA 5GAOm 1HSQA 3OMCA 1WJSA 2B86A 3JAME 2BZ8A 2QASA 1WHLA 5KYYA 2OAUA 3MEUA 1NBEB 1BIAA 4IKFA 2PQWA 3QIIA 2DYIA 3FJPA 1G3SA 1N9RA 2EKHA 2M51A 4OMOA 3L2RA 2F2WA 4HT8A 2XDBA 5GJWB 4FYYB 2QQAA 2A37A 2BZYA 2EYXA 3SWNA 3MKDA 3L2QA 1UGPB 1K73R 1R0BG 4CC4B 4X1VA 4BE2A 2JXBA 2GQIA 2RA2A 1FYNA 2RQRA 5GMKl 3REAB 2OAWA 3DLMA 3JV3A 4LDWA 2FG0A 8AT1B 3PE0A 3SD4A 2HQEA 2KROA 3LYIA 2WSFE 1VQLT 1BCOA 2L8DA 2RNAA 1BYMA 4OB0B 2FPEA 1VQMA 4JJCA 1QVFP 2AKKA 4FSSA 4OMLA 2LT1A 4RG2A 3MHXA 3C12A 3TEEA 8ATCB 1W2BS 1OX9A 1XOVA 2X4YA 4J9GA 4MZPA 3T9NA 2M02A 2LMJA 3LH5A 1M4ZA 4CI0C 3SEMA 2LVMA 4XU0A 2VV5A 2O9VA 4WF2A 3J81E 3G71T 2LZ6B 5A0GA 2JUFA 4KRTA 2ZAEA 1OYXA 4AFUC 3CCRQ 2VKNA 3BDUA 2X35A 1YJ9A 2JMAA 3H9NA 1WJRA 1K8AR 1YWOA 2ATCB 2DBKA 5LJ3h 4PJNA 4OGEA 3CC4T 5HCKA 3EFSA 3R6OA 2EYWA 2HKNA 1ZSZC 2MAMA 2C0OA 3TREA 1KFZA 4DEXA 2CZ7B 1M1GA 5KH6A 2CS7A 1RACB 4RTTA 1VQPQ 3G6EA 4FT2A 4DBHA 1Y96B 3QXEB 1I1JA 2C0IA 2DJZA 1VQOA 3VRYA 3MPUB 4R0KA 3ULRB 2LQKA 5FW9A 2CP0A 4BI4A 2ED0A 3OB9A 1AWJA 3M59A 1UJ0A 1K73U 2HEQA 3VS7A 4AG1C 3SDZA 3NTHA 1X01A 1PWTA 3TVTA 1H92A 3EFOB 2L89A 4JRIA 4QQDA 1Q82U 3A8OB 2PVOB 1IZ6A 3H8ZA 3CCEQ 5KYXB 1VQ8Q 2EW3A 2LDMA 2KNBB 3FIFA 1QMCA 3I56A 5FROA 1X6BA 5J3BA 3CMEA 1WJQA 5FU6B 4FCYA 4PJOB 2DA9A 2M9UA 3CC2Q 4KBMB 3ER0A 4J5YA 1BKBA 4LD9K 2BKDN 1Y71A 4F7UE 3CCVA 1ZUYA 2AT1B 2CP2A 2W10A 3RIRA 2LTOA 2LC4A 3PGGA 3L2ZA 3CCLT 4IUQA 1JU5C 1Q81C 4M7DB 4J8OA 4KULA 1KC8C 5J39A 2CT4A 3VS2A 4D8KA 3LW5E 1KHIA 2DM1A 4A4EA 2DRKA 3WXMB 2A7YA 5I2SA 1VQ5A 1WNLA 1K8AU 3CD6A 2RI5A 1EFNA 4OVAA 4E7SA 3HHTB 4JJNK 1JQQA 2COYA 1NG2A 2LJ0A 1KIKA 3RERA 2RJFA 4V2SA 4ME7A 4Z89A 2J6OA 4OMPA 3A98A 3JCMe 5CVIA 1M5Q1 2EJFA 1RUWA 1YITQ 1WHGA 4P5NA 4ORZA 3EG3A 3JCMb 1M1KC 4QW2A 1TG0A 3OW2S 3WVDB 4GY5A 4C92B 5CR2A 3CCQT 1XTDA 2L3RA 4EMKA 2X51A 4M75B 2E1HA 5GANe 4E7JA 4C8QB 4A4FA 2J06A 3MEAA 4ESRA 3MP6A 4LDVA 2JMCA 1T3SA 3OBWA 2EKOA 4M78G 1C1AA 3CCJQ 4PKCC 1W6XA 2YLBA 2GQVA 3JB9F 1Y96A 1Q95G 1TUGB 1W70A 4E7LA 4XTXA 2OJ2A 2BIVA 3CCMT 2DYBA 2QEXT 3VYGA 3V8KA 1UTIA 2DETA 2GFUA 1B34B 1U3OA 4ZGJB 1YI2Q 2OTJQ 4BI8B 1M30A 2DEUA 3LGLA 3EFOA 2MIOA 1HD3A 1U1TA 1KQSP 2W0ZA 3VS3A 5J26A 1ZUUA 4GLMA 4EMGA 5KYXA 3I55Q 1S72Q 1IGQA 3P8BB 4ZNXA 4CRIA 5GAOl 2FVUA 2KXDA 2QQSA 4PJOA 3LWIA 4QVCA 1OEBA 2DF6A 1AT1B 1PNJA 9ATCB 4BACA 1D0XA 1UB4A 3NMZC 5ECAA 2PZ1A 1FWZA 4M78C 1I0CA 2FPDA 2YXYA 5FWBA 1QP3A 1NLPC 1QVFA 4PL6A 5D7UA 3HKSA 5GAN6 2JJ9A 4E7KA 3CCRA 2KAFA 2HKQB 2HQXA 4JLGA 4BDZA 3EH2A 4RTXA 4RTZA 1G5VA 2L3PA 3OS1A 2EQUA 2VGNA 2ROLA 1Q81U 2LCCA 3VJPA 3JCMX 4WCIA 1N8RR 1KC8U 2R58A 4PNOA 4O5VA 3EGXB 3VS1A 4CC3A 5GAMe 1VQPA 4N0AA 2A28A 1WPYA 5LJ5h 2ZPHB 4HCKA 2QDYB 1N27A 1JEGA 4C92A 1D0YA 5IHKA 4PFPA 4RCCA 4J6WA 4M75A 1VQ7Q 1IRXA 2OX7A 4M77G 3I5SA 1KD1C 1QCNA 4M7AE 3OA6A 2O4XB 3MP1A 3CCEA 5IT9E 1VQ8A 2EQKA 4PJMA 4UC4A 5GAN4 1VOMA 2DXBA 1UFFA 2FHDA 1UEBA 3QG1A 1VQMT 1V1CA 4LE9A 1OULA 1SHGA 1TH7A 1W4SA 3QYGB 1UDLA 3CC2A 2DNUA 5CCAA 3VS4A 4F7UB 1GBRA 1MGQA 2YUQA 3GF5A 4OP0A 4LD6A 2DLPA 2CP6A 1G8XA 5LL6S 3OYGA 4JJBA 2VXFA 1RAGB 3I9QA 2KE9A 1YBYA 1YJNQ 4J9BA 2QA4A 2GTOA 1CKBA 2CDTA 2RI3A 4FW1A 1D3BA 1WFWA 1YJ9T 2ED1A 1SF9A 1M1FA 2COWA 4EIKA 2OTLA 2WSEE 1NYFA 4M77C 4ANJA 4II1A 2PU9B 2ZPIB 2DTHA 1N8RU 2RJCA 3HRSA 1WHKA 4KT0E 1TU0B 4PLLA 2G3RA 2ZGWA 2RPNA 2ZPBB 2MPXC 4BB7A 2V26A 3M0UA 4LDUA 1VQNQ 1VQOT 3O8VA 5LJ5d 4HCCA 4JRKA 3EGUA 4JDSA 1YITA 2CP5A 3S3NA 4RTVA 3TSWA 1PRLC 1G3YA 1LJOA 3SB2A 4KUDK 3CCSQ 2QQBA 1RAFB 2IIMA 2RQVA 5D6XA 5I2MA 4IIMA 3QWXX 2YUOA 1NPRA 1UHFA 3UATA 1YFNA 2FZGB 2Y90A 2XK0A 3CCJA 3I56T 4A4HA 3OYFA 3EGXA 5FU7C 4RG8A 4E7HA 3QDRB 3OS5A 3EG9A 2JS2A 1D09B 1VYTA 3UWNA 4M78D 2P0PA 3JCMh 1X2KA 1O9SA 2IG0A 3NFCA 5GMKh 3CPWA 2DZ9A 2DD5A 2K2VA 5FWCA 2EQIA 3KXTA 2O01E 1YI2A 4A54A 2OTJA 1K73C 2RD1A 1SHFA 2JVVA 2YUPA 3LGFA 4PJOF 5GANh 1K9MR 2E6NA 3X24B 2O4XA 3R6NA 5LJ3g 3I55A 4XTVA 1S72A 1TOVA 1AD5A 1VQ5T 4C0FA 5CK9A 2RB6A 1LPLA 4DBRA 4FYXB 5LJ3j 3EHRA 5HKCA 2FRWA 4LDYA 4M7DF 1PD0A 1NJIR 3I35A 4ZTJA 3OYEA 1KQSA 2L3QA 1M8MA 1KD1U 1BI1A 2XI9A 5AYFA 1JJ2P 2RO0A 1VQ4T 4X34A 1ARKA 1RI9A 3OYBA 1PKTA 2LQNA 1H641 3PVLA 2GNCA 2YDLA 2ABLA 1JB0E 1U8RA 4PK4A 3J7AF 1Y0MA 1GFCA 1GRIA 2K4YA 2MMPA 4PLIA 1J3TA 3JB9D 3C94A 2AK5A 2ENMA 3U23A 1IB8A 2BZXA 1K8AC 2L2PA 1D0ZA 2CSIA 5GAMf 2E3IA 3ZFJA 1XJWB 1H3ZA 4EMKC 4C0DC 2B8AA 4A63B 3QPHA 5D6YA 2FPFA 2YHTA 4C92F 2JOYA 4QQ6A 2D0NA 2FO0A 5IN1A 1I8FA 2F5TX 4JPBW 4M75F 4C8QF 3J80E 3OY9A 3JCMd 4C5GA 2ZZDA 2H3JA 3LWHA 1GBQA 4L59A 3JRZA 1IREB 1QVFS 2NYSA 1QKWA 1FMKA 4OMNA 5KYWB 3FC3A 1VQ7A 3QWYA 5GANd 3JCMc 1K9MU 3A8LB 2NUPB 4F04B 2X4WA 2CH4A 4M7AB 2KRNA 3HRUA 4HA8A 3G71Q 1AEYA 2DILA 2ESWA 3TQ7P 4M77D 2QGFB 2WSCE 2YWWA 3OYHA 3G4SQ 3QZ5B 1WYXA 4LDXA 1NJIU 4HVVA 2LP5A 2R5MA 2XDPA 1Y07A 1OX8A 2GFAA 1N5ZA 1XNIA 1D1CA 6AT1B 4RKUE 1M2OA 2I0NA 4XTZA 4BY6C 1NLOC 2LNHB 1TWBA 3M0QA 5M9OA 5HY6A 4CC7A 3OQ5A 1TSFA 3VRZA 3FEOA 4C0GA 1YJNA 1I5LA 3RKWA 4HVWA 3CCRT 3EAEA 1WHHA 3OYAA 7AT1B 3VS0A 2LX9A 4BD3A 4FIBA 3RMQA 3OYCA 1PHTA 2Z0WA 1CKAA 2DBMA 3CMAQ 4OGCA 3C95A 3EFRA 4ATOA 4M4ZA 1H3HA 3E2UA 2C0TA 1N9SA 4FYVB 5L23A 1QLYA 1VQNA 3M57A 4M78E 2O2OA 3MEVA 2JTMA 1WGSA 4D8DA 3CBOA 3ZBDA 1TTHB 3RKYA 1OZ2A 1PC0A 2XHCA 2FEIA 2PUKB 3A8GB 2EGAA 4N4GA 4ELZC 3CCUT 2CUDA 3UDCA 2CZ0B 2DERA 4IUTA 2V8KA 3HP9A 3CCSA 4HCBA 4LUEA 2VUBA 1PSFA 2JNGA 1HXDA 1QP2A 2RJEA 3QBYA 3TCJA 3IQLA 3Q1JA 3RNJA 3HFNA 4EDUA 3NGPA 1VQ8T 3BDLA 2NUZA 4NL3A 2M0OA 1SKUB 1YHQQ 2FL7A 1S1NA 1WXTA 1ZSZB 4OB2B 3CC2T 5GAMd 2P4TA 1M2VB 1YIJQ 1T0HA 2EYZA 3JCMV 4N4HA 3E19A 2YRDA 4X9CA 4MMKA 4JZ3A 4HT9A 2CREA 3P8DA 2D0QB 2HCKA 5KYWA 1GCQC 2LJ1A 2M16A 2VASA 2SRCA 2V8JA 1LOJA 1QCOA 4NS5A 3PIOA 2NUPA 2PUOB 3M56A 2QA4T 4M7AA 4BI3A 2MWOA 4F7UF 5GAN3 2AZVA 2RK2A 3S6WA 1ABOA 4J9EA 1YP5A 1AWOA 2OTLT 3M58A 3VS5A 1GXIE 3H0HA 1WXBA 3UPUA 1CSKA 3JCMW 5LJ5g 2NUTB 2X3XD 2KBTA 2K5FA 1JXMA 3UA7A 1RABB 3OYLA 3CPWS 4E7IA 4C5HA 5LJ5j 4RTYA 1X2QA 1YITT 1ZHIA 2EFIA 3MP8A 3RDVA 4ZN1A 1M27C 1UGQB 1JJ2A 2YUNA 1MHNA 4XTUA 5CKDA 1BI0A 4L5GA 2EJGA 1M3BA 3HSBA 3GP8A 1W1FA 1PG5B 1ZSGA 2QTVA 4PFOA 1EX4A 3CCJT 3EGDB 1BU1A 4M77E 1KQSS 3OYNA 1N8RC 1KHCA 2CKKA 1RAEB 2MI6A 4AMCA 2L5QA 1AWWA 1HK9A 4KUIA 4LXCA 4Z02A 1I81A 1BK2A 1BCMA 2YRCA 3VUZA 2HL3A 2KMTA 5KYUB 3L2UA 3CC7Q 1WXUA 2LQWA 4FL6A 2E12A 2DAQA 1YI2T 2OTJT 2K3XA 1WIEA 1RAAB 2P4RA 3N5BB 4BDYA 3M55A 4PJLA 4M7DA 3I55T 1WA7A 1S72T 2JTFA 3JB9G 1K0XA 2LT4A 4KGVB 1ZQ1A 3G71A 1WHJA 1QWEA 1Z9ZA 4BE1A 1UUEA 1KQ1A 1ZSZA 3L2WA 4LN2A 3G4SA 3GLXA 3EG0A 2GF7A 1NPPA 2DIGA 1RADB 4OMQA 1TUCA 1OPLA 2QXFA 1AWXA 3DB3A 1Y7XA 1ABQA 3O5ZA 1T3LA 2XMFA 2HSPA 1U1SA 2XIDA 3A5ZB 3QYHB 3RR6A 2V1QA 1RL2A 2ROTA 4A53A 4MZMA 4J9IA 1VQ9Q 2E65A 3LLRA 4XQ3A 2JW4A 5GAN7 3F70A 1X6GA 4E6RA 1MMGA 3X25B 2EBPA 2DK3A 3ASKA 2EQJA 4M75D 2J6KA 3OSVA 2VVKA 2RM4A 2PTKA 3SWNC 3CMAA 3LX7A 3M53A 4C8QA 1VQ6Q 2NUTA 1E6GA 3WVEB 2HDAA 1TXQA 1UGSB 3H0IA 1FX7A 2E5QA 3AHUA 1GL5A 5LJ3e 2AZSA 3V8LA 1SPKA 2NLUA 3OS2A 3HTRA 1LCKA 3THKA 4M78B 1M8VA 2Y4YA 4MDWA 4XU3A 2A36A 4DOWA 2KI7A 1M3AA 2HQHA 2EJ9A 2QQ9A 4L6V5 5GMKj 3S3MA 5CKBA 1OU8A 2X4JA 2JTEA 1KG1A 2ECZA 1VQKQ 2LQ8A 1RI0A 1VQ7T 1B34A 2VGMA 3CBPA 1RAIB 2GCXA 2LNVA 4JLIA 5GANj 4O6JA 1YJWQ 3TU4K 2C06A 4JJDA 2DPPB 3EGDA 1IO6A 1XQHA 4Y91A 5KCHA 4J9HA 2FRYA 4C5IA 1K1ZA 5GAOr 2CT3A 1YHQA 3LH0A 1TS9A 5L8RE 1I07A 1E7OA 1YIJA 1QVGP 1EIFA 5KYUA 4F16A 2K9GA 2H3EB 3L1AA 4QVDA 4M7AF 2COZA 2KYBA 4E47A 3QKJA 4FW2A 1WLPB 3NTIA 5KE2A 2BE9B 4D6WA 2HAXA 2DX1A 1DJ7B 2KVQG 3V8JA 2G6FX 2CSQA 4NOYA 1YJNT 2E10A 3G6ET 3JSCA 1K9MC 1QWFA 3CXCP 2X9HA 1MNEA 2P0QA 2LRQA 2QGGA 2O9SA 2A0FB 3ME9A 5D6WA 2Y4XA 2E6ZA 1UJYA 2HZYA 2K57A 2JM9A 2I2LA 3I5RA 2DMOA 1NJIC 3V7RA 1F1BB 5GAN2 3KUFA 2EQMA 2QG9B 3CBMA 3E1SA 3H0FA 3FRNA 3C4SA 1AHJB 2KR3A 3TSZA 5GMKi 4X9DA 2DIQA 1LVKA 4IUUA 4JS5A 3CMET 2K7AA 2A08A 2RI2A 5DY9A 4DEYA 1UG1A 3CCVT 2GBQA 4J6YA 1GCPA 3CCST 1MV0B 1U5SA 4K11A 1R8OB 2JM8A 1IGUA 2MWPA 1SSHA 2YLCA 4IUVA 4JRQA 1UE9A 2FZCB 3JCMP 3QJYA 4M77B 4AT1B 4KH0B 4E7ZA 4C5EA 1C6VX 2ZPFB 1M90R 1M9SA 4A4KA 3GOXA 2YT6A 4OB3B 3CD6T 1VQ4Q 5CIUA 3CC7A 5CQYA 1Q86C 4OMFB 1X6OA 3JCMQ 2QTXA 4F7UA 1VYVA 2EGCA 4J7IA 2FZKB 3JB9J 1JJ2S 1HJDA 2KQWA 5CKEA 3M4GA 4EPCA 4R56A 2R5AA 1VUBA 3A8HB 4KH1B 2D6FA 3M0TA 4NL2A 1ZBJA 1NE8A 2O31A 2F5KA 5C0MA 2J6FA 1K0SA 3OMGA 4RUGA 1QCFA 2XG8D 5FU7B 2DXTA 3MJXA 1YWPA 1PD1A 4PJOG 2K79A 3ZEHA 4RMOA 3DB4A 3M9QA 5GAOq 3OSSC 1FMVA 1WQ7A 4Z8AA 1Y57A 1VQLQ 5KE3A 2RN8A 3M0SA 1B7TA 1WHMA 1VQ9A 4WTOB 2BTTA 4M7DG 2K6DA 1K9AA 1V29B 2LX7A 4RTWA 2IPOB 2JS0A 3UF4A 4ZTFA 1Q86R 5KYNA 2CZ1B 3NTKA 2DTOA 3VS6A 1AZEA 1JO8A 5LJ3f 2RHUA 1U06A 1Q82R 3AT1B 1VQ6A 2R57A 2D9TA 2XD0A 2LCLA 2PNIA 2DRMA 1M90U 3REBB 5FRNA 2RH2A 4J83A 1RLPC 1PKSA 1W2BP 1YN8A 1UGVA 2DFUA 3RBBB 5GAMh 3CC4Q 3HRTA 1X27A 3KBGA 3HPWA 5FU6C 2EIFA 4PJOC 2M1HA 1VQKA 2QYZA 5A2QE 1FMWA 2H8HA 5LJ5e
chains in the Genus database with same CATH topology
5GAMg 2QDYB 1N27A 2E41A 4C92A 3X28B 1YJWA 4C92G 3UPUA 5CKHA 4RCCA 3FB9A 3JCMW 2FB7A 2PVGB 2VXEA 5LJ5g 4ZGEB 1O75A 4J6WA 4M75A 5FRMA 2XDDA 4M75G 5GAMj 4M77A 1N6AA 2K5FA 4M77G 4M78A 4Q5WA 3X26B 4C8QG 4VUBA 4M7DC 1KD1C 3OYLA 3CPWS 4M7AE 4E7IA 3G4ST 3DLLA 4C5HA 4EMKB 3OYIA 5LJ5j 4C0DB 3GNFB 2O4XB 3MP1A 1ZHIA 2EFIA 4B9XA 4N4IA 4ELYC 3OA6A 4J6XA 3CCEA 4XTYA 3MP8A 2EQKA 4J7FA 4UC4A 5GAN4 1VQ8A 2CGHA 4ZN1A 2CYZB 2DXBA 4FU6A 1UGQB 3L42A 2V8IA 4HCZA 4MMLA 1JJ2A 2FHDA 1UEBA 3OBYA 1G3WA 3QG1A 1Q82C 1MHNA 3VUBA 4XTUA 1VQMT 5CKDA 1BI0A 1I4K1 4L5GA 2EJGA 5CKFA 1TH7A 1W4SA 3CC2A 3QYGB 2HNIA 1OZ3A 2JN0A 5DLOA 3HSBA 4HKEA 3GP8A 2QI2A 4C92E 3BFMA 5C6SA 5CCAA 3CEYA 3SFMA 2RHYA 2VC8A 4TVRA 4F7UB 1MGQA 3GF5A 3X20B 4EMHA 4JRPA 4M7AC 4M75E 3CCJT 1VQPT 4M77E 4C8QE 3OYNA 1KQSS 4OP0A 1QVGA 1N8RC 5GAN8 1X75C 1KHCA 4FSXA 2CKKA 4LD6A 5LL6S 2MI6A 5GAOm 4OF1A 3OYGA 3OMCA 2VXFA 1WJSA 3JAME 2L5QA 1Q86U 4N0AC 1HK9A 1YBYA 3OYJA 2OAUA 4KUIA 4Z02A 3H6ZA 2QA4A 3MEUA 1I81A 1BIAA 4IKFA 2PQWA 3QIIA 3FJPA 2RI3A 3CMAT 1G3SA 1N9RA 3VUZA 2KMTA 1D3BA 3L2UA 4C92C 1YJ9T 3E9FA 3L2RA 2XDBA 4HT8A 4FL6A 3CXCA 2E12A 1M1FA 2DAQA 2QQAA 3JB9I 1YI2T 2OTJT 2OTLA 2VYTA 2K3XA 2WSEE 4IUPA 4M75C 4M77C 3UT1A 4C8QC 4II1A 3CCET 3SWNA 4JS4A 2PU9B 2RHZA 2ZPIB 3JCMJ 2K5LA 3N5BB 5DM7R 2DTHA 3L2QA 4BDYA 1N8RU 2XICA 3M55A 1UGPB 2RJCA 3HRSA 3RUXA 4M7DA 3I55T 1S72T 2JTFA 5IAYA 4BY6B 3JB9G 2LT4A 4KT0E 1ZQ1A 2G3RA 2ZGWA 4PLLA 3VV0A 2ZPBB 3G71A 4BE1A 2IVWA 4BB7A 4BE2A 4LDUA 2RA2A 1KQ1A 5GMKl 3L2WA 1VQOT 3DLMA 4LDWA 3O8VA 3G4SA 3GLXA 3JB9H 5LJ5d 2DTIA 4HCCA 4JRKA 4JDSA 3SD4A 2GF7A 1NPPA 5A0DA 1YITA 2DIGA 3S3NA 2HQEA 3LYIA 5GAOn 2F69A 4YTLA 3GPLA 4M78F 1QVPA 1G3YA 2QXFA 2WSFE 1VQLT 2L8DA 4M7AD 3DB3A 1BYMA 1Y7XA 1LJOA 3SB2A 3PMIA 4OB0B 4KUDK 1VQMA 1KQ2A 3QSUA 1U1SA 2XIDA 4XTWA 2LT1A 3A5ZB 3QYHB 2QQBA 5A0LA 3RMSA 1YHQT 5D6XA 3V7SA 5I2MA 2WACA 3MHXA 3C12A 4RG2A 3TEEA 1RL2A 4XK8E 5LJ3d 4A53A 4MZMA 3QHSA 1NPRA 1W2BS 4OB1B 1XOVA 2E65A 3LLRA 2X4YA 4XQ3A 5GAN7 2Y90A 2XK0A 3F70A 4MZPA 4RCBA 3CCJA 3HL8A 3T9NA 2C06A 3I56T 4A4HA 3OYFA 5FU7C 4E7HA 4RG8A 3X25B 3QDRB 1M4ZA 3OS5A 4CI0C 2HD0A 1VQ4A 2DK3A 2LVMA 3ASKA 1WQWA 2EQJA 4M75D 4XU0A 2VV5A 3UWNA 3OSVA 4M78D 2P0PA 3JCMh 2KDSA 4WF2A 3V7CA 3J81E 1O9SA 2FYKA 5I21A 3G71T 4DOVA 2RM4A 3SWNC 5A0GA 2JUFA 4B9WA 3CMAA 3LX7A 1OYXA 2IG0A 1BIBA 3M53A 3BDUA 3NFCA 5GMKh 3URGA 4C8QA 2X35A 1YJ9A 1YITT 3CPWA 5GMKe 2DZ9A 1UGRB 2DD5A 1WJRA 2K2VA 3MCAB 3WVEB 3KXTA 1UGSB 2O01E 5LJ3h 3OYKA 1FX7A 4A54A 2E5QA 4OGEA 2RD1A 3CC4T 1YI2A 3EFSA 1K73C 3AHUA 2OTJA 2JVVA 3R6OA 5LJ3e 3LGFA 4PJOF 3V8LA 1VIEA 5GANh 2DZCA 2MAMA 2NLUA 2DXUA 3TREA 3OS2A 2E6NA 3X24B 2O4XA 4M78B 1M8VA 2Y4YA 4MDWA 5LJ3g 3I55A 4XTVA 4XU3A 4DOWA 1S72A 2CZ7B 1M1GA 5KH6A 2EJ9A 2QQ9A 4L6V5 2CS7A 5GMKj 3S3MA 5CKBA 1VQ5T 4C0FA 5CK9A 4FT2A 3L2VA 3G6EA 2X4JA 2RB6A 4BE0A 1KG1A 4XAXB 1Y96B 3QXEB 4FM4B 2DJZA 2LQ8A 3A8MB 1RI0A 5LJ3j 1JBMA 5HKCA 4R55A 1VQOA 1VQ7T 4LDYA 1B34A 4M7DF 4JUVA 1Q7YC 2VGMA 3CBPA 4ZTJA 3OYEA 2LQKA 2GCXA 1KQSA 2LNVA 4JLIA 5GANj 3PTAA 4O6JA 1KD1U 4BI4A 1BI1A 2XI9A 5AYFA 3OB9A 4F7UG 3TU4K 3M59A 1VQLA 1K73U 2RO0A 3QZ9B 2DPPB 4Y91A 1XQHA 5KCHA 1VQ4T 2RHXA 5CO7A 4PJOD 3SDZA 4X34A 3NTHA 1X01A 4C5IA 3E9GA 3OYBA 3PMTA 5GAOr 1PSEA 2L89A 1H641 1YHQA 4JRIA 4QQDA 3LH0A 1Q82U 3A8OB 2PVOB 3QO3A 1IZ6A 4ZGDB 2KY9A 3H8ZA 1KC8C 5L8RE 2LDMA 1JB0E 1YIJA 2ZCFB 3FIFA 1EIFA 1U8RA 3J7AF 3PFSA 3L1AA 4QVZA 3I56A 4QVDA 4M7AF 2K4YA 5FROA 1FXXA 2MMPA 5J3BA 3CMEA 4M7DD 1P92A 4PLIA 1WJQA 2HBPA 5FU6B 4E47A 3JB9D 3QKJA 3C94A 4PJOB 2M9UA 4KBMB 5GMKm 3ER0A 1D3BB 3NTIA 5KE2A 4D6WA 2HAXA 4J5YA 1BKBA 1K8AC 4LD9K 2BKDN 1Y71A 2EAYA 4F7UE 3FLGA 1DJ7B 2KVQG 3HFOA 3V8JA 5GAMf 3ZFJA 3CCVA 3OYYA 3PIPA 1H3ZA 4EMKC 4NOYA 3RIRA 1YJNT 2E10A 2B8AA 2LTOA 2MF2A 2LC4A 4C0DC 3G6ET 3JSCA 3QPHA 1K9MC 5D6YA 3PGGA 3L2ZA 3CCLT 5LJ5f 2YHTA 4IUQA 4C92F 2JOYA 4QQ6A 3CC7T 2BUDA 3CC4A 4GLKA 2P0QA 3QJ6A 5IN1A 1Q81C 4J8OA 2JZ2A 4M7DB 2LRQA 3OS0A 1I8FA 2F5TX 3ME9A 4KULA 4M75F 5D6WA 2Y4XA 2E6ZA 4M77F 4C8QF 5J39A 3JCMd 3J80E 2K57A 3OY9A 2DD4A 4C5GA 2ZZDA 2H3JA 1KHIA 1NZ9A 3LW5E 3LWHA 1OI1A 2I2LA 3M4YA 4A4EA 4L59A 3VU3C 5CQXA 3JRZA 1IREB 3WXMB 1NJIC 1QVFS 2A7YA 4MZTA 5I2SA 3V7RA 1VQ5A 4DA4A 1WNLA 1K8AU 5GAN2 3KUFA 2EQMA 3DKMA 1W2BA 2DO3A 3CD6A 2RI5A 1ZBXA 3CBMA 3VKIA 3FC3A 1VQ7A 3E1SA 4OVAA 2K3YA 3FRNA 3C4SA 1AHJB 5GANd 5GMKi 3JCMc 3HHTB 1K9MU 3A8LB 4JJNK 2DXCA 3BY7A 2DIQA 4X9DA 4C92D 2X4WA 2PVDB 4IUUA 4JS5A 2EYQA 3CMET 4M7AB 5EG2A 1JRIA 3HRUA 3RERA 4HA8A 2RJFA 4V2SA 3GNGA 2RI2A 4XU2A 5DY9A 4ME7A 2RHIA 1SSFA 2EWNA 4M77D 4C8QD 2E70A 3BW1A 2WSCE 2QQRA 3JCMe 5CVIA 4DQ2A 5GAOp 1BI3A 4C0ZA 3OYHA 3CCVT 3QZ5B 4LDXA 1M5Q1 4J6YA 2EJFA 2XKOC 1NJIU 4QQGA 3CCST 2R5MA 4P5NA 2XDPA 1Y07A 3JCMb 1M1KC 4QW2A 3JCMg 3OW2S 3WVDB 4GY5A 2GFAA 1XNIA 4C92B 1R8OB 2ZPEB 1VQ9T 2MWPA 4RKUE 5CR2A 3CCQT 4XTZA 2YLCA 1XTDA 4IUVA 4BY6C 2L3RA 4JRQA 3INZA 4EMKA 3JCMP 4M75B 2E1HA 5GANe 3QJYA 4E7JA 4M77B 4C8QB 5M9OA 4A4FA 3MEAA 5HY6A 3MP6A 4LDVA 3CCUA 3OQ5A 4C5EA 3FEOA 4C0GA 2DVEA 2XU8A 2EKOA 2ZPFB 3OBWA 3S3OA 1M9SA 3M54A 4M78G 3PNWC 4A4KA 5GANg 3GOXA 1YJNA 4IURA 4OB3B 1I5LA 3CCLA 1YIJT 3CD6T 3RKWA 2YRVA 4PKCC 3MEWA 3CCRT 1G3TA 2YLBA 1VIFA 2GQVA 3EAEA 1VQ6T 5CIUA 3CC7A 5CQYA 3OYAA 1Q86C 3JB9F 1Y96A 4OMFB 2KSSA 1X6OA 3JCMQ 1M1KU 2QTXA 4F7UA 2LX9A 3RESA 4BD3A 5FLXE 4FIBA 4J7IA 3RMQA 3OYCA 3JB9J 1JJ2S 3OYDA 4XTXA 4E7LA 2KQWA 3QUIA 5CKEA 3RKXA 2BIVA 2E64A 3FDRA 3CCMT 4OGCA 2DKGA 3VYGA 3C95A 3M4GA 3CPFA 3EFRA 2GFUA 3V8KA 4EPCA 2QEXT 4R56A 1B34B 2R5AA 4BUGA 4ATOA 2RJDA 4ZGJB 4BI8B 1VUBA 3A8HB 3M5AA 3LGLA 1N9SA 2D6FA 1U1TA 1VQNA 4NL2A 5HK0A 3M57A 1NE8A 4M78E 5CAIA 1VQKT 3MEVA 2JTMA 5GAN5 5J26A 2F5KA 5C0MA 1QVGS 4EMGA 1WGSA 3OMGA 3CBOA 4A4GA 3ZBDA 1Q7YU 3RKYA 1OZ2A 3META 2XHCA 3OYMA 1YJWT 2XG8D 3P8BB 5FU7B 2DXTA 2PUKB 3A8GB 4N4GA 4CRIA 4ELZC 5GAOl 2FVUA 2QQSA 4PJOA 3CCUT 4PJOG 3ZEHA 4RMOA 4QVCA 3LWIA 3UDCA 2CZ0B 4IUTA 3DB4A 3M9QA 5GAOq 2V8KA 3HP9A 1BI2A 3CCSA 4HCBA 2VUBA 1PSFA 2JNGA 3OSSC 1HXDA 1QP2A 4BACA 2RJEA 3QBYA 3SWNB 3TCJA 1WQ7A 1UB4A 3CXCS 5KE3A 3Q1JA 3HFNA 4EDUA 1FWZA 4M78C 5HK3A 1VQ8T 1VQ9A 3GIBA 3BDLA 2KK4A 3CCQA 1M90C 4NL3A 3JCMf 2M0OA 4ZN3A 4M7DG 1QP3A 2FL7A 1V29B 2A3LA 4ZTFA 4OB2B 3MO8A 1QVFA 4PL6A 3CC2T 2CZ6B 5GAMd 2CZ1B 2DEQA 2P4TA 3NTKA 2DTOA 2AHJB 5LJ3f 3JCMV 2RHUA 3HKSA 3E19A 4N4HA 4X9CA 4MMKA 5GAN6 4HT9A 3P8DA 4E7KA 4PJOE 3CCRA 2D0QB 2HQXA 2KAFA 4JLGA 5GANf 4BDZA 1VQ6A 2R57A 2P0KA 1VQNT 1G5VA 2D9TA 2XD0A 2M16A 2LCLA 5KCOA 2V8JA 1LOJA 3OS1A 2EQUA 4NS5A 3PT9A 2VGNA 4Y28E 3PIOA 5IT9E 1Q81U 2LCCA 3VJPA 3CCMA 1M90U 2PUOB 3JCMX 2QEXA 3M56A 5FRNA 2QA4T 1KC8U 2RH2A 4M7AA 4J83A 4BI3A 3VYHB 4M7AG 2MWOA 4FT4A 4MDXA 2R58A 3G7ZA 3P8HA 4PNOA 4M7DE 4F7UF 2RK1A 4O5VA 5GAMh 5GAN3 3HRTA 2RK2A 5DLQE 5GAMe 3KBGA 1QW1A 3HPWA 3S6WA 3OW2A 1VQPA 4N0AA 2EIFA 5FU6C 4PJOC 1LNXA 2M1HA 2ZPGB 4XU1A 1VQKA 2K5IA 2OTLT 3M58A 1WPYA 5LJ5h 2ZPHB 5A2QE 2X4XA 1GXIE 1YCYA 5LJ5e
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLK A;  2XD0 A;  2XDB A;  4RMO A;  4ATO A;  2XDD A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  2MK5 A;  2E41 A;  2RQT A;  3X28 B;  1YJW A;  4C92 G;  5CKH A;  3SHW A;  5I22 A;  2FB7 A;  2VXE A;  3EHQ A;  4ZGE B;  1O75 A;  2F1L A;  4M75 G;  2DL3 A;  4M77 A;  4Q5W A;  4C8Q G;  3X26 B;  4Y92 A;  4M7D C;  3G4S T;  3DLL A;  1VA7 A;  4EMK B;  3OYI A;  4C0D B;  5IHN A;  4ELY C;  4J6X A;  4J7F A;  2F2V A;  2CGH A;  3NPF A;  4HCZ A;  1ZX6 A;  1ZA2 B;  2V8I A;  2DJQ A;  4F17 A;  1R0C B;  1I4K 1;  1OV3 A;  2M0Y A;  1OZ3 A;  4HKE A;  2QI2 A;  3BFM A;  5C6S A;  5IXB A;  1D1B A;  4EMH A;  1I5O B;  1VQP T;  2KEA A;  1QVG A;  5GAN 8;  1X75 C;  4FSX A;  1UEC A;  4OF1 A;  1MMD A;  3CCU Q;  1Q86 U;  2KRS A;  4N0A C;  3OYJ A;  1OOT A;  3H6Z A;  3CCL Q;  2QK0 A;  3CMA T;  1HYO A;  4C92 C;  3E9F A;  3NHN A;  3CXC A;  1NYG A;  3JB9 I;  2P84 A;  2VYT A;  4IUP A;  4M75 C;  1WI7 A;  3UT1 A;  4C8Q C;  5I11 A;  3CCE T;  1YCS B;  2LJ3 A;  4JS4 A;  2RHZ A;  4J9C A;  4CC2 A;  2K5L A;  3JCM J;  5DM7 R;  2XIC A;  1KK7 A;  3RUX A;  2MYS A;  5IAY A;  4BY6 B;  3D7S B;  3VV0 A;  4B6M A;  1BB9 A;  2IVW A;  5IXF A;  2K3B A;  3JB9 H;  2DTI A;  1PCX A;  2CP7 A;  5A0D A;  5GAO n;  2RMO A;  2F69 A;  4YTL A;  3GPL A;  2QA4 Q;  4M78 F;  1QVP A;  4M7A D;  2SEM A;  1IHW A;  3PMI A;  1KQ2 A;  4KGZ B;  3QSU A;  4XTW A;  1X43 A;  2KT1 A;  2KRM A;  1RAH B;  1SRM A;  2KYM A;  3RMS A;  5A0L A;  1YHQ T;  3V7S A;  1SG5 A;  2WAC A;  1G83 A;  1AOJ A;  2X3W D;  4XK8 E;  2OTL Q;  5LJ3 d;  3QHS A;  4OB1 B;  3CCQ Q;  1YIJ T;  4RCB A;  3HL8 A;  2KGT A;  2E3H A;  2HD0 A;  1VQ4 A;  2BE7 D;  1WQW A;  2EGE A;  1IHV A;  4KGX B;  2KDS A;  3V7C A;  1EZZ B;  2FYK A;  5I21 A;  4DOV A;  1QKX A;  2DL7 A;  4B9W A;  1BIB A;  3URG A;  2D8H A;  5GMK e;  2AIR B;  1UGR B;  1QQJ A;  3MCA B;  3OW2 P;  3QDF A;  3OYK A;  1ACM B;  1VIE A;  3CCM Q;  2DZC A;  2QEX Q;  2DXU A;  2DL5 A;  1A0N B;  1IXD A;  1WDX A;  1MV3 A;  1X69 A;  1ZUK A;  1Q81 R;  1KC8 R;  3CPW P;  3UA6 A;  3L2V A;  4BE0 A;  1ZLM A;  4XAX B;  4FM4 B;  3A8M B;  1JBM A;  4R55 A;  4JUV A;  1Q7Y C;  4DBQ A;  5IH2 A;  1M3C A;  2V1R A;  3PTA A;  3CQT A;  3H41 A;  2HL5 C;  4F7U G;  1VQL A;  3QZ9 B;  2F2X A;  2RHX A;  1YNZ A;  5CO7 A;  4PJO D;  2DVJ A;  1KSW A;  3E9G A;  5EC7 A;  3PMT A;  1PSE A;  2GGR A;  3FJ5 A;  3QO3 A;  4ZGD B;  2KY9 A;  2ZCF B;  3PFS A;  4QVZ A;  1FXX A;  4M7D D;  1P92 A;  2HBP A;  2J05 A;  2OI3 A;  3EG1 A;  5GMK m;  4QT7 A;  1M1K R;  1D3B B;  2DE0 X;  2EAY A;  3FLG A;  3HFO A;  3OYY A;  3PIP A;  2MF2 A;  5LJ5 f;  1M2V A;  3CC7 T;  2BUD A;  3CC4 A;  4GLK A;  3QJ6 A;  1AVZ C;  2JZ2 A;  2DL4 A;  3OS0 A;  1KJW A;  4M77 F;  2DL8 A;  1PRM C;  2DD4 A;  1NZ9 A;  1BBZ A;  1Q7Y R;  1OI1 A;  3M4Y A;  1E6H A;  3EG2 A;  3VU3 C;  5CQX A;  4MZT A;  4QKU A;  2CP3 A;  1RLQ C;  4DA4 A;  3DKM A;  1W2B A;  2DO3 A;  1D1A A;  1ZBX A;  3VKI A;  2O88 A;  2K3Y A;  1C0M A;  1G2B A;  2DXC A;  5IHI A;  3BY7 A;  4AFZ C;  4C92 D;  3M0R A;  4IIO A;  2PVD B;  2EYQ A;  5EG2 A;  1JRI A;  2J7I A;  3G1J A;  3GNG A;  4XU2 A;  4HVU A;  2RHI A;  1SSF A;  2EWN A;  4C8Q D;  2EYY A;  2E70 A;  2QDL A;  3BW1 A;  2QQR A;  4HXJ A;  3BE3 A;  1WX6 A;  1BI3 A;  4JZ4 A;  4C0Z A;  4DQ2 A;  5GAO p;  2CUB A;  2K2M A;  2XKO C;  4QQG A;  3EG9 B;  3JCM g;  1R77 A;  2ZPE B;  1VQ9 T;  1VQM Q;  1K76 A;  1B07 A;  3INZ A;  1V76 A;  2E4H A;  3CCU A;  2DVE A;  2XU8 A;  2LCS A;  3S3O A;  3M54 A;  5GAN g;  3PNW C;  3M0P A;  4IUR A;  3CCL A;  2YRV A;  3MEW A;  1G3T A;  1VIF A;  1T0J A;  1VQ6 T;  3KFV A;  1PM3 A;  2RQU A;  2KSS A;  1M1K U;  3RES A;  5FLX E;  3OYD A;  4LNP A;  3QUI A;  3RKX A;  2E64 A;  3FDR A;  2DKG A;  3CPF A;  2GTJ A;  1YJ9 Q;  4BUG A;  4PJJ A;  4Z88 A;  1GCQ A;  2RJD A;  4AFQ C;  2VWF A;  2RF0 A;  2VB6 A;  3M5A A;  4E2F B;  5HK0 A;  5CAI A;  1VQK T;  2HMA A;  5GAN 5;  2RQW A;  1QVG S;  5KYY B;  1OQK A;  4A4G A;  3ZL7 C;  1NEB A;  1Q7Y U;  3MET A;  3OYM A;  1YJW T;  2HBW A;  2EPD A;  3G6E Q;  1H8K A;  5AT1 B;  1VQO Q;  1B3Q A;  1ZA1 B;  1MMA A;  3C0C A;  1BI2 A;  2NWM A;  2AKL A;  4LUD A;  4AG2 C;  3SWN B;  2D8J A;  3CXC S;  1WZO A;  3A1P A;  5HK3 A;  3GIB A;  2KK4 A;  1SRL A;  3CCQ A;  1M90 C;  3JCM f;  1KD1 R;  4ZN3 A;  2D1X A;  2A3L A;  3MO8 A;  1NM7 A;  2CZ6 B;  1GFD A;  2DEQ A;  1NEG A;  1MND A;  2L0A A;  2AHJ B;  2YSQ A;  3I56 Q;  3CME Q;  4PJO E;  4PFZ A;  5GAN f;  1K4U S;  2E5K A;  2P0K A;  1VQN T;  3EH1 A;  5GJV B;  5KCO A;  3PT9 A;  1SEM A;  2L3S A;  4Y28 E;  3CCV Q;  2HSE B;  3CCM A;  2QEX A;  4M7A G;  2EVR A;  3VYH B;  4FT4 A;  4MDX A;  1TUD A;  2QAZ A;  3G7Z A;  3P8H A;  4M7D E;  2RK1 A;  4FYW B;  5DLQ E;  4GBQ A;  2KT8 A;  4DBF A;  1QW1 A;  3OW2 A;  1LNX A;  2ZPG B;  4XU1 A;  2K5I A;  2X4X A;  1YCY A;  5GAM g;  1MMN A;  4J9D A;  3PVQ A;  1VQ5 Q;  3FB9 A;  1OPK A;  2PVG B;  3CD6 Q;  4AFS C;  2XDD A;  5FRM A;  5GAM j;  1N6A A;  4M78 A;  1OU9 A;  4VUB A;  2MCN A;  1UHC A;  3GNF B;  4B9X A;  4N4I A;  4XTY A;  2CYZ B;  2KXC A;  4MML A;  3L42 A;  4FU6 A;  1Z9Q A;  3OBY A;  1G3W A;  1Q82 C;  3VUB A;  4RTU A;  3GBQ A;  5CKF A;  2HNI A;  2JN0 A;  5DLO A;  2JT4 A;  4C92 E;  2MOX A;  3CEY A;  3SFM A;  2RHY A;  1JXO A;  2VC8 A;  1MUZ A;  1AZG B;  1VYU A;  4TVR A;  3X20 B;  4JRP A;  4F14 A;  4M7A C;  4M75 E;  4C8Q E;  4J9F A;  4OMM A;  5GAO m;  1HSQ A;  3OMC A;  1WJS A;  2B86 A;  3JAM E;  2BZ8 A;  2QAS A;  1WHL A;  5KYY A;  2OAU A;  3MEU A;  1NBE B;  1BIA A;  4IKF A;  2PQW A;  3QII A;  2DYI A;  3FJP A;  1G3S A;  1N9R A;  2EKH A;  2M51 A;  4OMO A;  3L2R A;  2F2W A;  4HT8 A;  2XDB A;  5GJW B;  4FYY B;  2QQA A;  2A37 A;  2BZY A;  2EYX A;  3SWN A;  3MKD A;  3L2Q A;  1UGP B;  1K73 R;  1R0B G;  4CC4 B;  4X1V A;  4BE2 A;  2JXB A;  2GQI A;  2RA2 A;  1FYN A;  2RQR A;  5GMK l;  3REA B;  2OAW A;  3DLM A;  3JV3 A;  4LDW A;  2FG0 A;  8AT1 B;  3PE0 A;  3SD4 A;  2HQE A;  2KRO A;  3LYI A;  2WSF E;  1VQL T;  1BCO A;  2L8D A;  2RNA A;  1BYM A;  4OB0 B;  2FPE A;  1VQM A;  4JJC A;  1QVF P;  2AKK A;  4FSS A;  4OML A;  2LT1 A;  4RG2 A;  3MHX A;  3C12 A;  3TEE A;  8ATC B;  1W2B S;  1OX9 A;  1XOV A;  2X4Y A;  4J9G A;  4MZP A;  3T9N A;  2M02 A;  2LMJ A;  3LH5 A;  1M4Z A;  4CI0 C;  3SEM A;  2LVM A;  4XU0 A;  2VV5 A;  2O9V A;  4WF2 A;  3J81 E;  3G71 T;  2LZ6 B;  5A0G A;  2JUF A;  4KRT A;  2ZAE A;  1OYX A;  4AFU C;  3CCR Q;  2VKN A;  3BDU A;  2X35 A;  1YJ9 A;  2JMA A;  3H9N A;  1WJR A;  1K8A R;  1YWO A;  2ATC B;  2DBK A;  5LJ3 h;  4PJN A;  4OGE A;  3CC4 T;  5HCK A;  3EFS A;  3R6O A;  2EYW A;  2HKN A;  1ZSZ C;  2MAM A;  2C0O A;  3TRE A;  1KFZ A;  4DEX A;  2CZ7 B;  1M1G A;  5KH6 A;  2CS7 A;  1RAC B;  4RTT A;  1VQP Q;  3G6E A;  4FT2 A;  4DBH A;  1Y96 B;  3QXE B;  1I1J A;  2C0I A;  2DJZ A;  1VQO A;  3VRY A;  3MPU B;  4R0K A;  3ULR B;  2LQK A;  5FW9 A;  2CP0 A;  4BI4 A;  2ED0 A;  3OB9 A;  1AWJ A;  3M59 A;  1UJ0 A;  1K73 U;  2HEQ A;  3VS7 A;  4AG1 C;  3SDZ A;  3NTH A;  1X01 A;  1PWT A;  3TVT A;  1H92 A;  3EFO B;  2L89 A;  4JRI A;  4QQD A;  1Q82 U;  3A8O B;  2PVO B;  1IZ6 A;  3H8Z A;  3CCE Q;  5KYX B;  1VQ8 Q;  2EW3 A;  2LDM A;  2KNB B;  3FIF A;  1QMC A;  3I56 A;  5FRO A;  1X6B A;  5J3B A;  3CME A;  1WJQ A;  5FU6 B;  4FCY A;  4PJO B;  2DA9 A;  2M9U A;  3CC2 Q;  4KBM B;  3ER0 A;  4J5Y A;  1BKB A;  4LD9 K;  2BKD N;  1Y71 A;  4F7U E;  3CCV A;  1ZUY A;  2AT1 B;  2CP2 A;  2W10 A;  3RIR A;  2LTO A;  2LC4 A;  3PGG A;  3L2Z A;  3CCL T;  4IUQ A;  1JU5 C;  1Q81 C;  4M7D B;  4J8O A;  4KUL A;  1KC8 C;  5J39 A;  2CT4 A;  3VS2 A;  4D8K A;  3LW5 E;  1KHI A;  2DM1 A;  4A4E A;  2DRK A;  3WXM B;  2A7Y A;  5I2S A;  1VQ5 A;  1WNL A;  1K8A U;  3CD6 A;  2RI5 A;  1EFN A;  4OVA A;  4E7S A;  3HHT B;  4JJN K;  1JQQ A;  2COY A;  1NG2 A;  2LJ0 A;  1KIK A;  3RER A;  2RJF A;  4V2S A;  4ME7 A;  4Z89 A;  2J6O A;  4OMP A;  3A98 A;  3JCM e;  5CVI A;  1M5Q 1;  2EJF A;  1RUW A;  1YIT Q;  1WHG A;  4P5N A;  4ORZ A;  3EG3 A;  3JCM b;  1M1K C;  4QW2 A;  1TG0 A;  3OW2 S;  3WVD B;  4GY5 A;  4C92 B;  5CR2 A;  3CCQ T;  1XTD A;  2L3R A;  4EMK A;  2X51 A;  4M75 B;  2E1H A;  5GAN e;  4E7J A;  4C8Q B;  4A4F A;  2J06 A;  3MEA A;  4ESR A;  3MP6 A;  4LDV A;  2JMC A;  1T3S A;  3OBW A;  2EKO A;  4M78 G;  1C1A A;  3CCJ Q;  4PKC C;  1W6X A;  2YLB A;  2GQV A;  3JB9 F;  1Y96 A;  1Q95 G;  1TUG B;  1W70 A;  4E7L A;  4XTX A;  2OJ2 A;  2BIV A;  3CCM T;  2DYB A;  2QEX T;  3VYG A;  3V8K A;  1UTI A;  2DET A;  2GFU A;  1B34 B;  1U3O A;  4ZGJ B;  1YI2 Q;  2OTJ Q;  4BI8 B;  1M30 A;  2DEU A;  3LGL A;  3EFO A;  2MIO A;  1HD3 A;  1U1T A;  1KQS P;  2W0Z A;  3VS3 A;  5J26 A;  1ZUU A;  4GLM A;  4EMG A;  5KYX A;  3I55 Q;  1S72 Q;  1IGQ A;  3P8B B;  4ZNX A;  4CRI A;  5GAO l;  2FVU A;  2KXD A;  2QQS A;  4PJO A;  3LWI A;  4QVC A;  1OEB A;  2DF6 A;  1AT1 B;  1PNJ A;  9ATC B;  4BAC A;  1D0X A;  1UB4 A;  3NMZ C;  5ECA A;  2PZ1 A;  1FWZ A;  4M78 C;  1I0C A;  2FPD A;  2YXY A;  5FWB A;  1QP3 A;  1NLP C;  1QVF A;  4PL6 A;  5D7U A;  3HKS A;  5GAN 6;  2JJ9 A;  4E7K A;  3CCR A;  2KAF A;  2HKQ B;  2HQX A;  4JLG A;  4BDZ A;  3EH2 A;  4RTX A;  4RTZ A;  1G5V A;  2L3P A;  3OS1 A;  2EQU A;  2VGN A;  2ROL A;  1Q81 U;  2LCC A;  3VJP A;  3JCM X;  4WCI A;  1N8R R;  1KC8 U;  2R58 A;  4PNO A;  4O5V A;  3EGX B;  3VS1 A;  4CC3 A;  5GAM e;  1VQP A;  4N0A A;  2A28 A;  1WPY A;  5LJ5 h;  2ZPH B;  4HCK A;  2QDY B;  1N27 A;  1JEG A;  4C92 A;  1D0Y A;  5IHK A;  4PFP A;  4RCC A;  4J6W A;  4M75 A;  1VQ7 Q;  1IRX A;  2OX7 A;  4M77 G;  3I5S A;  1KD1 C;  1QCN A;  4M7A E;  3OA6 A;  2O4X B;  3MP1 A;  3CCE A;  5IT9 E;  1VQ8 A;  2EQK A;  4PJM A;  4UC4 A;  5GAN 4;  1VOM A;  2DXB A;  1UFF A;  2FHD A;  1UEB A;  3QG1 A;  1VQM T;  1V1C A;  4LE9 A;  1OUL A;  1SHG A;  1TH7 A;  1W4S A;  3QYG B;  1UDL A;  3CC2 A;  2DNU A;  5CCA A;  3VS4 A;  4F7U B;  1GBR A;  1MGQ A;  2YUQ A;  3GF5 A;  4OP0 A;  4LD6 A;  2DLP A;  2CP6 A;  1G8X A;  5LL6 S;  3OYG A;  4JJB A;  2VXF A;  1RAG B;  3I9Q A;  2KE9 A;  1YBY A;  1YJN Q;  4J9B A;  2QA4 A;  2GTO A;  1CKB A;  2CDT A;  2RI3 A;  4FW1 A;  1D3B A;  1WFW A;  1YJ9 T;  2ED1 A;  1SF9 A;  1M1F A;  2COW A;  4EIK A;  2OTL A;  2WSE E;  1NYF A;  4M77 C;  4ANJ A;  4II1 A;  2PU9 B;  2ZPI B;  2DTH A;  1N8R U;  2RJC A;  3HRS A;  1WHK A;  4KT0 E;  1TU0 B;  4PLL A;  2G3R A;  2ZGW A;  2RPN A;  2ZPB B;  2MPX C;  4BB7 A;  2V26 A;  3M0U A;  4LDU A;  1VQN Q;  1VQO T;  3O8V A;  5LJ5 d;  4HCC A;  4JRK A;  3EGU A;  4JDS A;  1YIT A;  2CP5 A;  3S3N A;  4RTV A;  3TSW A;  1PRL C;  1G3Y A;  1LJO A;  3SB2 A;  4KUD K;  3CCS Q;  2QQB A;  1RAF B;  2IIM A;  2RQV A;  5D6X A;  5I2M A;  4IIM A;  3QWX X;  2YUO A;  1NPR A;  1UHF A;  3UAT A;  1YFN A;  2FZG B;  2Y90 A;  2XK0 A;  3CCJ A;  3I56 T;  4A4H A;  3OYF A;  3EGX A;  5FU7 C;  4RG8 A;  4E7H A;  3QDR B;  3OS5 A;  3EG9 A;  2JS2 A;  1D09 B;  1VYT A;  3UWN A;  4M78 D;  2P0P A;  3JCM h;  1X2K A;  1O9S A;  2IG0 A;  3NFC A;  5GMK h;  3CPW A;  2DZ9 A;  2DD5 A;  2K2V A;  5FWC A;  2EQI A;  3KXT A;  2O01 E;  1YI2 A;  4A54 A;  2OTJ A;  1K73 C;  2RD1 A;  1SHF A;  2JVV A;  2YUP A;  3LGF A;  4PJO F;  5GAN h;  1K9M R;  2E6N A;  3X24 B;  2O4X A;  3R6N A;  5LJ3 g;  3I55 A;  4XTV A;  1S72 A;  1TOV A;  1AD5 A;  1VQ5 T;  4C0F A;  5CK9 A;  2RB6 A;  1LPL A;  4DBR A;  4FYX B;  5LJ3 j;  3EHR A;  5HKC A;  2FRW A;  4LDY A;  4M7D F;  1PD0 A;  1NJI R;  3I35 A;  4ZTJ A;  3OYE A;  1KQS A;  2L3Q A;  1M8M A;  1KD1 U;  1BI1 A;  2XI9 A;  5AYF A;  1JJ2 P;  2RO0 A;  1VQ4 T;  4X34 A;  1ARK A;  1RI9 A;  3OYB A;  1PKT A;  2LQN A;  1H64 1;  3PVL A;  2GNC A;  2YDL A;  2ABL A;  1JB0 E;  1U8R A;  4PK4 A;  3J7A F;  1Y0M A;  1GFC A;  1GRI A;  2K4Y A;  2MMP A;  4PLI A;  1J3T A;  3JB9 D;  3C94 A;  2AK5 A;  2ENM A;  3U23 A;  1IB8 A;  2BZX A;  1K8A C;  2L2P A;  1D0Z A;  2CSI A;  5GAM f;  2E3I A;  3ZFJ A;  1XJW B;  1H3Z A;  4EMK C;  4C0D C;  2B8A A;  4A63 B;  3QPH A;  5D6Y A;  2FPF A;  2YHT A;  4C92 F;  2JOY A;  4QQ6 A;  2D0N A;  2FO0 A;  5IN1 A;  1I8F A;  2F5T X;  4JPB W;  4M75 F;  4C8Q F;  3J80 E;  3OY9 A;  3JCM d;  4C5G A;  2ZZD A;  2H3J A;  3LWH A;  1GBQ A;  4L59 A;  3JRZ A;  1IRE B;  1QVF S;  2NYS A;  1QKW A;  1FMK A;  4OMN A;  5KYW B;  3FC3 A;  1VQ7 A;  3QWY A;  5GAN d;  3JCM c;  1K9M U;  3A8L B;  2NUP B;  4F04 B;  2X4W A;  2CH4 A;  4M7A B;  2KRN A;  3HRU A;  4HA8 A;  3G71 Q;  1AEY A;  2DIL A;  2ESW A;  3TQ7 P;  4M77 D;  2QGF B;  2WSC E;  2YWW A;  3OYH A;  3G4S Q;  3QZ5 B;  1WYX A;  4LDX A;  1NJI U;  4HVV A;  2LP5 A;  2R5M A;  2XDP A;  1Y07 A;  1OX8 A;  2GFA A;  1N5Z A;  1XNI A;  1D1C A;  6AT1 B;  4RKU E;  1M2O A;  2I0N A;  4XTZ A;  4BY6 C;  1NLO C;  2LNH B;  1TWB A;  3M0Q A;  5M9O A;  5HY6 A;  4CC7 A;  3OQ5 A;  1TSF A;  3VRZ A;  3FEO A;  4C0G A;  1YJN A;  1I5L A;  3RKW A;  4HVW A;  3CCR T;  3EAE A;  1WHH A;  3OYA A;  7AT1 B;  3VS0 A;  2LX9 A;  4BD3 A;  4FIB A;  3RMQ A;  3OYC A;  1PHT A;  2Z0W A;  1CKA A;  2DBM A;  3CMA Q;  4OGC A;  3C95 A;  3EFR A;  4ATO A;  4M4Z A;  1H3H A;  3E2U A;  2C0T A;  1N9S A;  4FYV B;  5L23 A;  1QLY A;  1VQN A;  3M57 A;  4M78 E;  2O2O A;  3MEV A;  2JTM A;  1WGS A;  4D8D A;  3CBO A;  3ZBD A;  1TTH B;  3RKY A;  1OZ2 A;  1PC0 A;  2XHC A;  2FEI A;  2PUK B;  3A8G B;  2EGA A;  4N4G A;  4ELZ C;  3CCU T;  2CUD A;  3UDC A;  2CZ0 B;  2DER A;  4IUT A;  2V8K A;  3HP9 A;  3CCS A;  4HCB A;  4LUE A;  2VUB A;  1PSF A;  2JNG A;  1HXD A;  1QP2 A;  2RJE A;  3QBY A;  3TCJ A;  3IQL A;  3Q1J A;  3RNJ A;  3HFN A;  4EDU A;  3NGP A;  1VQ8 T;  3BDL A;  2NUZ A;  4NL3 A;  2M0O A;  1SKU B;  1YHQ Q;  2FL7 A;  1S1N A;  1WXT A;  1ZSZ B;  4OB2 B;  3CC2 T;  5GAM d;  2P4T A;  1M2V B;  1YIJ Q;  1T0H A;  2EYZ A;  3JCM V;  4N4H A;  3E19 A;  2YRD A;  4X9C A;  4MMK A;  4JZ3 A;  4HT9 A;  2CRE A;  3P8D A;  2D0Q B;  2HCK A;  5KYW A;  1GCQ C;  2LJ1 A;  2M16 A;  2VAS A;  2SRC A;  2V8J A;  1LOJ A;  1QCO A;  4NS5 A;  3PIO A;  2NUP A;  2PUO B;  3M56 A;  2QA4 T;  4M7A A;  4BI3 A;  2MWO A;  4F7U F;  5GAN 3;  2AZV A;  2RK2 A;  3S6W A;  1ABO A;  4J9E A;  1YP5 A;  1AWO A;  2OTL T;  3M58 A;  3VS5 A;  1GXI E;  3H0H A;  1WXB A;  3UPU A;  1CSK A;  3JCM W;  5LJ5 g;  2NUT B;  2X3X D;  2KBT A;  2K5F A;  1JXM A;  3UA7 A;  1RAB B;  3OYL A;  3CPW S;  4E7I A;  4C5H A;  5LJ5 j;  4RTY A;  1X2Q A;  1YIT T;  1ZHI A;  2EFI A;  3MP8 A;  3RDV A;  4ZN1 A;  1M27 C;  1UGQ B;  1JJ2 A;  2YUN A;  1MHN A;  4XTU A;  5CKD A;  1BI0 A;  4L5G A;  2EJG A;  1M3B A;  3HSB A;  3GP8 A;  1W1F A;  1PG5 B;  1ZSG A;  2QTV A;  4PFO A;  1EX4 A;  3CCJ T;  3EGD B;  1BU1 A;  4M77 E;  1KQS S;  3OYN A;  1N8R C;  1KHC A;  2CKK A;  1RAE B;  2MI6 A;  4AMC A;  2L5Q A;  1AWW A;  1HK9 A;  4KUI A;  4LXC A;  4Z02 A;  1I81 A;  1BK2 A;  1BCM A;  2YRC A;  3VUZ A;  2HL3 A;  2KMT A;  5KYU B;  3L2U A;  3CC7 Q;  1WXU A;  2LQW A;  4FL6 A;  2E12 A;  2DAQ A;  1YI2 T;  2OTJ T;  2K3X A;  1WIE A;  1RAA B;  2P4R A;  3N5B B;  4BDY A;  3M55 A;  4PJL A;  4M7D A;  3I55 T;  1WA7 A;  1S72 T;  2JTF A;  3JB9 G;  1K0X A;  2LT4 A;  4KGV B;  1ZQ1 A;  3G71 A;  1WHJ A;  1QWE A;  1Z9Z A;  4BE1 A;  1UUE A;  1KQ1 A;  1ZSZ A;  3L2W A;  4LN2 A;  3G4S A;  3GLX A;  3EG0 A;  2GF7 A;  1NPP A;  2DIG A;  1RAD B;  4OMQ A;  1TUC A;  1OPL A;  2QXF A;  1AWX A;  3DB3 A;  1Y7X A;  1ABQ A;  3O5Z A;  1T3L A;  2XMF A;  2HSP A;  1U1S A;  2XID A;  3A5Z B;  3QYH B;  3RR6 A;  2V1Q A;  1RL2 A;  2ROT A;  4A53 A;  4MZM A;  4J9I A;  1VQ9 Q;  2E65 A;  3LLR A;  4XQ3 A;  2JW4 A;  5GAN 7;  3F70 A;  1X6G A;  4E6R A;  1MMG A;  3X25 B;  2EBP A;  2DK3 A;  3ASK A;  2EQJ A;  4M75 D;  2J6K A;  3OSV A;  2VVK A;  2RM4 A;  2PTK A;  3SWN C;  3CMA A;  3LX7 A;  3M53 A;  4C8Q A;  1VQ6 Q;  2NUT A;  1E6G A;  3WVE B;  2HDA A;  1TXQ A;  1UGS B;  3H0I A;  1FX7 A;  2E5Q A;  3AHU A;  1GL5 A;  5LJ3 e;  2AZS A;  3V8L A;  1SPK A;  2NLU A;  3OS2 A;  3HTR A;  1LCK A;  3THK A;  4M78 B;  1M8V A;  2Y4Y A;  4MDW A;  4XU3 A;  2A36 A;  4DOW A;  2KI7 A;  1M3A A;  2HQH A;  2EJ9 A;  2QQ9 A;  4L6V 5;  5GMK j;  3S3M A;  5CKB A;  1OU8 A;  2X4J A;  2JTE A;  1KG1 A;  2ECZ A;  1VQK Q;  2LQ8 A;  1RI0 A;  1VQ7 T;  1B34 A;  2VGM A;  3CBP A;  1RAI B;  2GCX A;  2LNV A;  4JLI A;  5GAN j;  4O6J A;  1YJW Q;  3TU4 K;  2C06 A;  4JJD A;  2DPP B;  3EGD A;  1IO6 A;  1XQH A;  4Y91 A;  5KCH A;  4J9H A;  2FRY A;  4C5I A;  1K1Z A;  5GAO r;  2CT3 A;  1YHQ A;  3LH0 A;  1TS9 A;  5L8R E;  1I07 A;  1E7O A;  1YIJ A;  1QVG P;  1EIF A;  5KYU A;  4F16 A;  2K9G A;  2H3E B;  3L1A A;  4QVD A;  4M7A F;  2COZ A;  2KYB A;  4E47 A;  3QKJ A;  4FW2 A;  1WLP B;  3NTI A;  5KE2 A;  2BE9 B;  4D6W A;  2HAX A;  2DX1 A;  1DJ7 B;  2KVQ G;  3V8J A;  2G6F X;  2CSQ A;  4NOY A;  1YJN T;  2E10 A;  3G6E T;  3JSC A;  1K9M C;  1QWF A;  3CXC P;  2X9H A;  1MNE A;  2P0Q A;  2LRQ A;  2QGG A;  2O9S A;  2A0F B;  3ME9 A;  5D6W A;  2Y4X A;  2E6Z A;  1UJY A;  2HZY A;  2K57 A;  2JM9 A;  2I2L A;  3I5R A;  2DMO A;  1NJI C;  3V7R A;  1F1B B;  5GAN 2;  3KUF A;  2EQM A;  2QG9 B;  3CBM A;  3E1S A;  3H0F A;  3FRN A;  3C4S A;  1AHJ B;  2KR3 A;  3TSZ A;  5GMK i;  4X9D A;  2DIQ A;  1LVK A;  4IUU A;  4JS5 A;  3CME T;  2K7A A;  2A08 A;  2RI2 A;  5DY9 A;  4DEY A;  1UG1 A;  3CCV T;  2GBQ A;  4J6Y A;  1GCP A;  3CCS T;  1MV0 B;  1U5S A;  4K11 A;  1R8O B;  2JM8 A;  1IGU A;  2MWP A;  1SSH A;  2YLC A;  4IUV A;  4JRQ A;  1UE9 A;  2FZC B;  3JCM P;  3QJY A;  4M77 B;  4AT1 B;  4KH0 B;  4E7Z A;  4C5E A;  1C6V X;  2ZPF B;  1M90 R;  1M9S A;  4A4K A;  3GOX A;  2YT6 A;  4OB3 B;  3CD6 T;  1VQ4 Q;  5CIU A;  3CC7 A;  5CQY A;  1Q86 C;  4OMF B;  1X6O A;  3JCM Q;  2QTX A;  4F7U A;  1VYV A;  2EGC A;  4J7I A;  2FZK B;  3JB9 J;  1JJ2 S;  1HJD A;  2KQW A;  5CKE A;  3M4G A;  4EPC A;  4R56 A;  2R5A A;  1VUB A;  3A8H B;  4KH1 B;  2D6F A;  3M0T A;  4NL2 A;  1ZBJ A;  1NE8 A;  2O31 A;  2F5K A;  5C0M A;  2J6F A;  1K0S A;  3OMG A;  4RUG A;  1QCF A;  2XG8 D;  5FU7 B;  2DXT A;  3MJX A;  1YWP A;  1PD1 A;  4PJO G;  2K79 A;  3ZEH A;  4RMO A;  3DB4 A;  3M9Q A;  5GAO q;  3OSS C;  1FMV A;  1WQ7 A;  4Z8A A;  1Y57 A;  1VQL Q;  5KE3 A;  2RN8 A;  3M0S A;  1B7T A;  1WHM A;  1VQ9 A;  4WTO B;  2BTT A;  4M7D G;  2K6D A;  1K9A A;  1V29 B;  2LX7 A;  4RTW A;  2IPO B;  2JS0 A;  3UF4 A;  4ZTF A;  1Q86 R;  5KYN A;  2CZ1 B;  3NTK A;  2DTO A;  3VS6 A;  1AZE A;  1JO8 A;  5LJ3 f;  2RHU A;  1U06 A;  1Q82 R;  3AT1 B;  1VQ6 A;  2R57 A;  2D9T A;  2XD0 A;  2LCL A;  2PNI A;  2DRM A;  1M90 U;  3REB B;  5FRN A;  2RH2 A;  4J83 A;  1RLP C;  1PKS A;  1W2B P;  1YN8 A;  1UGV A;  2DFU A;  3RBB B;  5GAM h;  3CC4 Q;  3HRT A;  1X27 A;  3KBG A;  3HPW A;  5FU6 C;  2EIF A;  4PJO C;  2M1H A;  1VQK A;  2QYZ A;  5A2Q E;  1FMW A;  2H8H A;  5LJ5 e; 
#chains in the Genus database with same CATH homology
 5GAM g;  2QDY B;  1N27 A;  2E41 A;  4C92 A;  3X28 B;  1YJW A;  4C92 G;  3UPU A;  5CKH A;  4RCC A;  3FB9 A;  3JCM W;  2FB7 A;  2PVG B;  2VXE A;  5LJ5 g;  4ZGE B;  1O75 A;  4J6W A;  4M75 A;  5FRM A;  2XDD A;  4M75 G;  5GAM j;  4M77 A;  1N6A A;  2K5F A;  4M77 G;  4M78 A;  4Q5W A;  3X26 B;  4C8Q G;  4VUB A;  4M7D C;  1KD1 C;  3OYL A;  3CPW S;  4M7A E;  4E7I A;  3G4S T;  3DLL A;  4C5H A;  4EMK B;  3OYI A;  5LJ5 j;  4C0D B;  3GNF B;  2O4X B;  3MP1 A;  1ZHI A;  2EFI A;  4B9X A;  4N4I A;  4ELY C;  3OA6 A;  4J6X A;  3CCE A;  4XTY A;  3MP8 A;  2EQK A;  4J7F A;  4UC4 A;  5GAN 4;  1VQ8 A;  2CGH A;  4ZN1 A;  2CYZ B;  2DXB A;  4FU6 A;  1UGQ B;  3L42 A;  2V8I A;  4HCZ A;  4MML A;  1JJ2 A;  2FHD A;  1UEB A;  3OBY A;  1G3W A;  3QG1 A;  1Q82 C;  1MHN A;  3VUB A;  4XTU A;  1VQM T;  5CKD A;  1BI0 A;  1I4K 1;  4L5G A;  2EJG A;  5CKF A;  1TH7 A;  1W4S A;  3CC2 A;  3QYG B;  2HNI A;  1OZ3 A;  2JN0 A;  5DLO A;  3HSB A;  4HKE A;  3GP8 A;  2QI2 A;  4C92 E;  3BFM A;  5C6S A;  5CCA A;  3CEY A;  3SFM A;  2RHY A;  2VC8 A;  4TVR A;  4F7U B;  1MGQ A;  3GF5 A;  3X20 B;  4EMH A;  4JRP A;  4M7A C;  4M75 E;  3CCJ T;  1VQP T;  4M77 E;  4C8Q E;  3OYN A;  1KQS S;  4OP0 A;  1QVG A;  1N8R C;  5GAN 8;  1X75 C;  1KHC A;  4FSX A;  2CKK A;  4LD6 A;  5LL6 S;  2MI6 A;  5GAO m;  4OF1 A;  3OYG A;  3OMC A;  2VXF A;  1WJS A;  3JAM E;  2L5Q A;  1Q86 U;  4N0A C;  1HK9 A;  1YBY A;  3OYJ A;  2OAU A;  4KUI A;  4Z02 A;  3H6Z A;  2QA4 A;  3MEU A;  1I81 A;  1BIA A;  4IKF A;  2PQW A;  3QII A;  3FJP A;  2RI3 A;  3CMA T;  1G3S A;  1N9R A;  3VUZ A;  2KMT A;  1D3B A;  3L2U A;  4C92 C;  1YJ9 T;  3E9F A;  3L2R A;  2XDB A;  4HT8 A;  4FL6 A;  3CXC A;  2E12 A;  1M1F A;  2DAQ A;  2QQA A;  3JB9 I;  1YI2 T;  2OTJ T;  2OTL A;  2VYT A;  2K3X A;  2WSE E;  4IUP A;  4M75 C;  4M77 C;  3UT1 A;  4C8Q C;  4II1 A;  3CCE T;  3SWN A;  4JS4 A;  2PU9 B;  2RHZ A;  2ZPI B;  3JCM J;  2K5L A;  3N5B B;  5DM7 R;  2DTH A;  3L2Q A;  4BDY A;  1N8R U;  2XIC A;  3M55 A;  1UGP B;  2RJC A;  3HRS A;  3RUX A;  4M7D A;  3I55 T;  1S72 T;  2JTF A;  5IAY A;  4BY6 B;  3JB9 G;  2LT4 A;  4KT0 E;  1ZQ1 A;  2G3R A;  2ZGW A;  4PLL A;  3VV0 A;  2ZPB B;  3G71 A;  4BE1 A;  2IVW A;  4BB7 A;  4BE2 A;  4LDU A;  2RA2 A;  1KQ1 A;  5GMK l;  3L2W A;  1VQO T;  3DLM A;  4LDW A;  3O8V A;  3G4S A;  3GLX A;  3JB9 H;  5LJ5 d;  2DTI A;  4HCC A;  4JRK A;  4JDS A;  3SD4 A;  2GF7 A;  1NPP A;  5A0D A;  1YIT A;  2DIG A;  3S3N A;  2HQE A;  3LYI A;  5GAO n;  2F69 A;  4YTL A;  3GPL A;  4M78 F;  1QVP A;  1G3Y A;  2QXF A;  2WSF E;  1VQL T;  2L8D A;  4M7A D;  3DB3 A;  1BYM A;  1Y7X A;  1LJO A;  3SB2 A;  3PMI A;  4OB0 B;  4KUD K;  1VQM A;  1KQ2 A;  3QSU A;  1U1S A;  2XID A;  4XTW A;  2LT1 A;  3A5Z B;  3QYH B;  2QQB A;  5A0L A;  3RMS A;  1YHQ T;  5D6X A;  3V7S A;  5I2M A;  2WAC A;  3MHX A;  3C12 A;  4RG2 A;  3TEE A;  1RL2 A;  4XK8 E;  5LJ3 d;  4A53 A;  4MZM A;  3QHS A;  1NPR A;  1W2B S;  4OB1 B;  1XOV A;  2E65 A;  3LLR A;  2X4Y A;  4XQ3 A;  5GAN 7;  2Y90 A;  2XK0 A;  3F70 A;  4MZP A;  4RCB A;  3CCJ A;  3HL8 A;  3T9N A;  2C06 A;  3I56 T;  4A4H A;  3OYF A;  5FU7 C;  4E7H A;  4RG8 A;  3X25 B;  3QDR B;  1M4Z A;  3OS5 A;  4CI0 C;  2HD0 A;  1VQ4 A;  2DK3 A;  2LVM A;  3ASK A;  1WQW A;  2EQJ A;  4M75 D;  4XU0 A;  2VV5 A;  3UWN A;  3OSV A;  4M78 D;  2P0P A;  3JCM h;  2KDS A;  4WF2 A;  3V7C A;  3J81 E;  1O9S A;  2FYK A;  5I21 A;  3G71 T;  4DOV A;  2RM4 A;  3SWN C;  5A0G A;  2JUF A;  4B9W A;  3CMA A;  3LX7 A;  1OYX A;  2IG0 A;  1BIB A;  3M53 A;  3BDU A;  3NFC A;  5GMK h;  3URG A;  4C8Q A;  2X35 A;  1YJ9 A;  1YIT T;  3CPW A;  5GMK e;  2DZ9 A;  1UGR B;  2DD5 A;  1WJR A;  2K2V A;  3MCA B;  3WVE B;  3KXT A;  1UGS B;  2O01 E;  5LJ3 h;  3OYK A;  1FX7 A;  4A54 A;  2E5Q A;  4OGE A;  2RD1 A;  3CC4 T;  1YI2 A;  3EFS A;  1K73 C;  3AHU A;  2OTJ A;  2JVV A;  3R6O A;  5LJ3 e;  3LGF A;  4PJO F;  3V8L A;  1VIE A;  5GAN h;  2DZC A;  2MAM A;  2NLU A;  2DXU A;  3TRE A;  3OS2 A;  2E6N A;  3X24 B;  2O4X A;  4M78 B;  1M8V A;  2Y4Y A;  4MDW A;  5LJ3 g;  3I55 A;  4XTV A;  4XU3 A;  4DOW A;  1S72 A;  2CZ7 B;  1M1G A;  5KH6 A;  2EJ9 A;  2QQ9 A;  4L6V 5;  2CS7 A;  5GMK j;  3S3M A;  5CKB A;  1VQ5 T;  4C0F A;  5CK9 A;  4FT2 A;  3L2V A;  3G6E A;  2X4J A;  2RB6 A;  4BE0 A;  1KG1 A;  4XAX B;  1Y96 B;  3QXE B;  4FM4 B;  2DJZ A;  2LQ8 A;  3A8M B;  1RI0 A;  5LJ3 j;  1JBM A;  5HKC A;  4R55 A;  1VQO A;  1VQ7 T;  4LDY A;  1B34 A;  4M7D F;  4JUV A;  1Q7Y C;  2VGM A;  3CBP A;  4ZTJ A;  3OYE A;  2LQK A;  2GCX A;  1KQS A;  2LNV A;  4JLI A;  5GAN j;  3PTA A;  4O6J A;  1KD1 U;  4BI4 A;  1BI1 A;  2XI9 A;  5AYF A;  3OB9 A;  4F7U G;  3TU4 K;  3M59 A;  1VQL A;  1K73 U;  2RO0 A;  3QZ9 B;  2DPP B;  4Y91 A;  1XQH A;  5KCH A;  1VQ4 T;  2RHX A;  5CO7 A;  4PJO D;  3SDZ A;  4X34 A;  3NTH A;  1X01 A;  4C5I A;  3E9G A;  3OYB A;  3PMT A;  5GAO r;  1PSE A;  2L89 A;  1H64 1;  1YHQ A;  4JRI A;  4QQD A;  3LH0 A;  1Q82 U;  3A8O B;  2PVO B;  3QO3 A;  1IZ6 A;  4ZGD B;  2KY9 A;  3H8Z A;  1KC8 C;  5L8R E;  2LDM A;  1JB0 E;  1YIJ A;  2ZCF B;  3FIF A;  1EIF A;  1U8R A;  3J7A F;  3PFS A;  3L1A A;  4QVZ A;  3I56 A;  4QVD A;  4M7A F;  2K4Y A;  5FRO A;  1FXX A;  2MMP A;  5J3B A;  3CME A;  4M7D D;  1P92 A;  4PLI A;  1WJQ A;  2HBP A;  5FU6 B;  4E47 A;  3JB9 D;  3QKJ A;  3C94 A;  4PJO B;  2M9U A;  4KBM B;  5GMK m;  3ER0 A;  1D3B B;  3NTI A;  5KE2 A;  4D6W A;  2HAX A;  4J5Y A;  1BKB A;  1K8A C;  4LD9 K;  2BKD N;  1Y71 A;  2EAY A;  4F7U E;  3FLG A;  1DJ7 B;  2KVQ G;  3HFO A;  3V8J A;  5GAM f;  3ZFJ A;  3CCV A;  3OYY A;  3PIP A;  1H3Z A;  4EMK C;  4NOY A;  3RIR A;  1YJN T;  2E10 A;  2B8A A;  2LTO A;  2MF2 A;  2LC4 A;  4C0D C;  3G6E T;  3JSC A;  3QPH A;  1K9M C;  5D6Y A;  3PGG A;  3L2Z A;  3CCL T;  5LJ5 f;  2YHT A;  4IUQ A;  4C92 F;  2JOY A;  4QQ6 A;  3CC7 T;  2BUD A;  3CC4 A;  4GLK A;  2P0Q A;  3QJ6 A;  5IN1 A;  1Q81 C;  4J8O A;  2JZ2 A;  4M7D B;  2LRQ A;  3OS0 A;  1I8F A;  2F5T X;  3ME9 A;  4KUL A;  4M75 F;  5D6W A;  2Y4X A;  2E6Z A;  4M77 F;  4C8Q F;  5J39 A;  3JCM d;  3J80 E;  2K57 A;  3OY9 A;  2DD4 A;  4C5G A;  2ZZD A;  2H3J A;  1KHI A;  1NZ9 A;  3LW5 E;  3LWH A;  1OI1 A;  2I2L A;  3M4Y A;  4A4E A;  4L59 A;  3VU3 C;  5CQX A;  3JRZ A;  1IRE B;  3WXM B;  1NJI C;  1QVF S;  2A7Y A;  4MZT A;  5I2S A;  3V7R A;  1VQ5 A;  4DA4 A;  1WNL A;  1K8A U;  5GAN 2;  3KUF A;  2EQM A;  3DKM A;  1W2B A;  2DO3 A;  3CD6 A;  2RI5 A;  1ZBX A;  3CBM A;  3VKI A;  3FC3 A;  1VQ7 A;  3E1S A;  4OVA A;  2K3Y A;  3FRN A;  3C4S A;  1AHJ B;  5GAN d;  5GMK i;  3JCM c;  3HHT B;  1K9M U;  3A8L B;  4JJN K;  2DXC A;  3BY7 A;  2DIQ A;  4X9D A;  4C92 D;  2X4W A;  2PVD B;  4IUU A;  4JS5 A;  2EYQ A;  3CME T;  4M7A B;  5EG2 A;  1JRI A;  3HRU A;  3RER A;  4HA8 A;  2RJF A;  4V2S A;  3GNG A;  2RI2 A;  4XU2 A;  5DY9 A;  4ME7 A;  2RHI A;  1SSF A;  2EWN A;  4M77 D;  4C8Q D;  2E70 A;  3BW1 A;  2WSC E;  2QQR A;  3JCM e;  5CVI A;  4DQ2 A;  5GAO p;  1BI3 A;  4C0Z A;  3OYH A;  3CCV T;  3QZ5 B;  4LDX A;  1M5Q 1;  4J6Y A;  2EJF A;  2XKO C;  1NJI U;  4QQG A;  3CCS T;  2R5M A;  4P5N A;  2XDP A;  1Y07 A;  3JCM b;  1M1K C;  4QW2 A;  3JCM g;  3OW2 S;  3WVD B;  4GY5 A;  2GFA A;  1XNI A;  4C92 B;  1R8O B;  2ZPE B;  1VQ9 T;  2MWP A;  4RKU E;  5CR2 A;  3CCQ T;  4XTZ A;  2YLC A;  1XTD A;  4IUV A;  4BY6 C;  2L3R A;  4JRQ A;  3INZ A;  4EMK A;  3JCM P;  4M75 B;  2E1H A;  5GAN e;  3QJY A;  4E7J A;  4M77 B;  4C8Q B;  5M9O A;  4A4F A;  3MEA A;  5HY6 A;  3MP6 A;  4LDV A;  3CCU A;  3OQ5 A;  4C5E A;  3FEO A;  4C0G A;  2DVE A;  2XU8 A;  2EKO A;  2ZPF B;  3OBW A;  3S3O A;  1M9S A;  3M54 A;  4M78 G;  3PNW C;  4A4K A;  5GAN g;  3GOX A;  1YJN A;  4IUR A;  4OB3 B;  1I5L A;  3CCL A;  1YIJ T;  3CD6 T;  3RKW A;  2YRV A;  4PKC C;  3MEW A;  3CCR T;  1G3T A;  2YLB A;  1VIF A;  2GQV A;  3EAE A;  1VQ6 T;  5CIU A;  3CC7 A;  5CQY A;  3OYA A;  1Q86 C;  3JB9 F;  1Y96 A;  4OMF B;  2KSS A;  1X6O A;  3JCM Q;  1M1K U;  2QTX A;  4F7U A;  2LX9 A;  3RES A;  4BD3 A;  5FLX E;  4FIB A;  4J7I A;  3RMQ A;  3OYC A;  3JB9 J;  1JJ2 S;  3OYD A;  4XTX A;  4E7L A;  2KQW A;  3QUI A;  5CKE A;  3RKX A;  2BIV A;  2E64 A;  3FDR A;  3CCM T;  4OGC A;  2DKG A;  3VYG A;  3C95 A;  3M4G A;  3CPF A;  3EFR A;  2GFU A;  3V8K A;  4EPC A;  2QEX T;  4R56 A;  1B34 B;  2R5A A;  4BUG A;  4ATO A;  2RJD A;  4ZGJ B;  4BI8 B;  1VUB A;  3A8H B;  3M5A A;  3LGL A;  1N9S A;  2D6F A;  1U1T A;  1VQN A;  4NL2 A;  5HK0 A;  3M57 A;  1NE8 A;  4M78 E;  5CAI A;  1VQK T;  3MEV A;  2JTM A;  5GAN 5;  5J26 A;  2F5K A;  5C0M A;  1QVG S;  4EMG A;  1WGS A;  3OMG A;  3CBO A;  4A4G A;  3ZBD A;  1Q7Y U;  3RKY A;  1OZ2 A;  3MET A;  2XHC A;  3OYM A;  1YJW T;  2XG8 D;  3P8B B;  5FU7 B;  2DXT A;  2PUK B;  3A8G B;  4N4G A;  4CRI A;  4ELZ C;  5GAO l;  2FVU A;  2QQS A;  4PJO A;  3CCU T;  4PJO G;  3ZEH A;  4RMO A;  4QVC A;  3LWI A;  3UDC A;  2CZ0 B;  4IUT A;  3DB4 A;  3M9Q A;  5GAO q;  2V8K A;  3HP9 A;  1BI2 A;  3CCS A;  4HCB A;  2VUB A;  1PSF A;  2JNG A;  3OSS C;  1HXD A;  1QP2 A;  4BAC A;  2RJE A;  3QBY A;  3SWN B;  3TCJ A;  1WQ7 A;  1UB4 A;  3CXC S;  5KE3 A;  3Q1J A;  3HFN A;  4EDU A;  1FWZ A;  4M78 C;  5HK3 A;  1VQ8 T;  1VQ9 A;  3GIB A;  3BDL A;  2KK4 A;  3CCQ A;  1M90 C;  4NL3 A;  3JCM f;  2M0O A;  4ZN3 A;  4M7D G;  1QP3 A;  2FL7 A;  1V29 B;  2A3L A;  4ZTF A;  4OB2 B;  3MO8 A;  1QVF A;  4PL6 A;  3CC2 T;  2CZ6 B;  5GAM d;  2CZ1 B;  2DEQ A;  2P4T A;  3NTK A;  2DTO A;  2AHJ B;  5LJ3 f;  3JCM V;  2RHU A;  3HKS A;  3E19 A;  4N4H A;  4X9C A;  4MMK A;  5GAN 6;  4HT9 A;  3P8D A;  4E7K A;  4PJO E;  3CCR A;  2D0Q B;  2HQX A;  2KAF A;  4JLG A;  5GAN f;  4BDZ A;  1VQ6 A;  2R57 A;  2P0K A;  1VQN T;  1G5V A;  2D9T A;  2XD0 A;  2M16 A;  2LCL A;  5KCO A;  2V8J A;  1LOJ A;  3OS1 A;  2EQU A;  4NS5 A;  3PT9 A;  2VGN A;  4Y28 E;  3PIO A;  5IT9 E;  1Q81 U;  2LCC A;  3VJP A;  3CCM A;  1M90 U;  2PUO B;  3JCM X;  2QEX A;  3M56 A;  5FRN A;  2QA4 T;  1KC8 U;  2RH2 A;  4M7A A;  4J83 A;  4BI3 A;  3VYH B;  4M7A G;  2MWO A;  4FT4 A;  4MDX A;  2R58 A;  3G7Z A;  3P8H A;  4PNO A;  4M7D E;  4F7U F;  2RK1 A;  4O5V A;  5GAM h;  5GAN 3;  3HRT A;  2RK2 A;  5DLQ E;  5GAM e;  3KBG A;  1QW1 A;  3HPW A;  3S6W A;  3OW2 A;  1VQP A;  4N0A A;  2EIF A;  5FU6 C;  4PJO C;  1LNX A;  2M1H A;  2ZPG B;  4XU1 A;  1VQK A;  2K5I A;  2OTL T;  3M58 A;  1WPY A;  5LJ5 h;  2ZPH B;  5A2Q E;  2X4X A;  1GXI E;  1YCY A;  5LJ5 e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...