2XN6B

Crystal structure of thyroxine-binding globulin complexed with thyroxine-fluoresein
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
34
structure length
34
Chain Sequence
HPIIQIDRSFMLLILERSTRSILFLGKVVNPTEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport
molecule keywords THYROXINE-BINDING GLOBULIN
publication title Allosteric Modulation of Hormone Release from Thyroxine and Corticosteroid Binding-Globulins.
pubmed doi rcsb
source organism Homo sapiens
total genus 1
structure length 34
sequence length 34
ec nomenclature
pdb deposition date 2010-07-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...