2XYSA

Crystal structure of aplysia californica achbp in complex with strychnine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural and Mutagenic Blueprint for Molecular Recognition of Strychnine and D-Tubocurarine by Different Cys-Loop Receptors.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xysA00
4F8HA 4QH1A 2WN9A 3PMZA 3UUBA 3JAFA 5FJVA 3WIPA 4ILBA 3PEOA 2XQ5A 4HFCA 3WTHA 2VL0A 2XYSA 5JMEA 2BR8A 4BFQA 4QAAA 2XYTA 3U8LA 2PGZA 4FRRA 4QACA 2Y7YA 3C79A 3RIAA 5AFKA 2XQ9A 2Y57A 3SH1A 2YKSA 4ILCA 4NZBA 3UQ4A 2X00D 2Y56A 4HFBA 3RI5A 4TWHA 2YMEA 2XQ4A 4QH4A 3TLUA 2BG9A 4DBMA 3TLWA 5HEUA 2YOEA 2PH9A 5CO5A 2C9TA 2XQ8A 4UM3P 2BG9C 5AINA 4ZZCA 5KZUA 4Z90A 4QABA 3U8NA 3C84A 3SQ6A 4LMJA 3WTLA 2W8GA 5BRXA 3UU8A 1UW6A 4Z91A 2W8FA 4ALXA 3UQ7A 4COFA 5BP0A 5BW2A 3UU4A 4X5TA 5L47A 4ZJTA 2XQ6A 3UU6A 4TNWA 2UZ6A 3WTIA 3U8MA 2BR7A 4LMKA 1UV6A 3TLTA 3ZDGA 4PIRA 3RQUA 2XQAA 5J0ZA 2XNVA 3TLVA 3EAMA 3T4MA 5AFMB 2BYQA 4A97A 4ILAA 3RHWA 4UY2A 5J5HA 2XQ3A 5KE4A 4BQTA 2XZ5A 5J5IA 5AFLA 5L4EA 4EZ1A 5LXBA 5L4HA 4ZK1A 5HEOA 2QC1B 5HEHA 3RQWA 5CFBA 1I9BA 3WTKA 2YMDA 4HFEA 2XNUA 2XZ6A 5HCJA 3TLSA 4ZJSA 5LG3A 3JAEA 4IL9A 2BYRA 3LSVA 4TNVA 2XNTA 4UXUA 5J5GA 2WZYA 2BG9E 4IL4A 3WTNA 3ZDHA 5J5FA 4D01A 3P4WA 1UX2A 4ZK4A 3U8KA 5AFNA 2WNJA 2BG9B 5HEJA 3UU3A 4IREA 3ZKRA 4XK9A 3EHZA 2Y54A 2XQ7A 3WTMA 4AFHA 5AFMA 4HFDA 2X00A 4HQPA 4HFIA 2BYPA 3JADA 3EI0A 2ZJUA 3SQ9A 5IUXA 3UU5A 2Y58A 2WNLA 4UM3S 4TWFA 5HEGA 5TVCA 2BJ0A 3SIOA 4WV9A 4ZR6A 4A98A 2ZJVA 4XHEA 4UM3A 5HCMA 3WTJA 3P50A 4LMLA 4UM1A 5AFJA 3GUAA 4HFHA 4NPPA 5AFHA 3RIFA 3WTOA 3IGQA 4ZRUA 4ZZBA 5SYOA 4QH5A 3U8JA 2BYNA 2YN6A 4TWDA 4AFGA 4AFTA 2BYSA 2WNCA 4B5DA
chains in the Genus database with same CATH superfamily
4F8HA 4QH1A 2WN9A 3PMZA 3UUBA 3JAFA 5FJVA 3WIPA 4ILBA 3PEOA 2XQ5A 4HFCA 3WTHA 2VL0A 2XYSA 5JMEA 2BR8A 4BFQA 4QAAA 2XYTA 3U8LA 2PGZA 4FRRA 4QACA 2Y7YA 3C79A 3RIAA 5AFKA 2XQ9A 2Y57A 3SH1A 2YKSA 4ILCA 4NZBA 3UQ4A 2X00D 2Y56A 4HFBA 3RI5A 4TWHA 2YMEA 2XQ4A 4QH4A 3TLUA 2BG9A 4DBMA 3TLWA 5HEUA 2YOEA 2PH9A 5CO5A 2C9TA 2XQ8A 4UM3P 2BG9C 5AINA 4ZZCA 5KZUA 4Z90A 4QABA 3U8NA 3C84A 3SQ6A 4LMJA 3WTLA 2W8GA 5BRXA 3UU8A 1UW6A 4Z91A 2W8FA 4ALXA 3UQ7A 4COFA 5BP0A 5BW2A 3UU4A 4X5TA 5L47A 4ZJTA 2XQ6A 3UU6A 4TNWA 2UZ6A 3WTIA 3U8MA 2BR7A 4LMKA 1UV6A 3TLTA 3ZDGA 4PIRA 3RQUA 2XQAA 5J0ZA 2XNVA 3TLVA 3EAMA 3T4MA 5AFMB 2BYQA 4A97A 4ILAA 3RHWA 4UY2A 5J5HA 2XQ3A 5KE4A 4BQTA 2XZ5A 5J5IA 5AFLA 5L4EA 4EZ1A 5LXBA 5L4HA 4ZK1A 5HEOA 2QC1B 5HEHA 3RQWA 5CFBA 1I9BA 3WTKA 2YMDA 4HFEA 2XNUA 2XZ6A 5HCJA 3TLSA 4ZJSA 5LG3A 3JAEA 4IL9A 2BYRA 3LSVA 4TNVA 2XNTA 4UXUA 5J5GA 2WZYA 2BG9E 4IL4A 3WTNA 3ZDHA 5J5FA 4D01A 3P4WA 1UX2A 4ZK4A 3U8KA 5AFNA 2WNJA 2BG9B 5HEJA 3UU3A 4IREA 3ZKRA 4XK9A 3EHZA 2Y54A 2XQ7A 3WTMA 4AFHA 5AFMA 4HFDA 2X00A 4HQPA 4HFIA 2BYPA 3JADA 3EI0A 2ZJUA 3SQ9A 5IUXA 3UU5A 2Y58A 2WNLA 4UM3S 4TWFA 5HEGA 5TVCA 2BJ0A 3SIOA 4WV9A 4ZR6A 4A98A 2ZJVA 4XHEA 4UM3A 5HCMA 3WTJA 3P50A 4LMLA 4UM1A 5AFJA 3GUAA 4HFHA 4NPPA 5AFHA 3RIFA 3WTOA 3IGQA 4ZRUA 4ZZBA 5SYOA 4QH5A 3U8JA 2BYNA 2YN6A 4TWDA 4AFGA 4AFTA 2BYSA 2WNCA 4B5DA
chains in the Genus database with same CATH topology
4F8HA 4QH1A 2WN9A 3PMZA 3UUBA 3JAFA 5FJVA 3WIPA 4ILBA 3PEOA 2XQ5A 4HFCA 3WTHA 2VL0A 2XYSA 5JMEA 2BR8A 4BFQA 4QAAA 2XYTA 3U8LA 2PGZA 4FRRA 4QACA 2Y7YA 3C79A 3RIAA 5AFKA 2XQ9A 2Y57A 3SH1A 2YKSA 4ILCA 4NZBA 3UQ4A 2X00D 2Y56A 4HFBA 3RI5A 4TWHA 2YMEA 2XQ4A 4QH4A 3TLUA 2BG9A 4DBMA 3TLWA 5HEUA 2YOEA 2PH9A 5CO5A 2C9TA 2XQ8A 4UM3P 2BG9C 5AINA 4ZZCA 5KZUA 4Z90A 4QABA 3U8NA 3C84A 3SQ6A 4LMJA 3WTLA 2W8GA 5BRXA 3UU8A 1UW6A 4Z91A 2W8FA 4ALXA 3UQ7A 4COFA 5BP0A 5BW2A 3UU4A 4X5TA 5L47A 4ZJTA 2XQ6A 3UU6A 4TNWA 2UZ6A 3WTIA 3U8MA 2BR7A 4LMKA 1UV6A 3TLTA 3ZDGA 4PIRA 3RQUA 2XQAA 5J0ZA 2XNVA 3TLVA 3EAMA 3T4MA 5AFMB 2BYQA 4A97A 4ILAA 3RHWA 4UY2A 5J5HA 2XQ3A 5KE4A 4BQTA 2XZ5A 5J5IA 5AFLA 5L4EA 4EZ1A 5LXBA 5L4HA 4ZK1A 5HEOA 2QC1B 5HEHA 3RQWA 5CFBA 1I9BA 3WTKA 2YMDA 4HFEA 2XNUA 2XZ6A 5HCJA 3TLSA 4ZJSA 5LG3A 3JAEA 4IL9A 2BYRA 3LSVA 4TNVA 2XNTA 4UXUA 5J5GA 2WZYA 2BG9E 4IL4A 3WTNA 3ZDHA 5J5FA 4D01A 3P4WA 1UX2A 4ZK4A 3U8KA 5AFNA 2WNJA 2BG9B 5HEJA 3UU3A 4IREA 3ZKRA 4XK9A 3EHZA 2Y54A 2XQ7A 3WTMA 4AFHA 5AFMA 4HFDA 2X00A 4HQPA 4HFIA 2BYPA 3JADA 3EI0A 2ZJUA 3SQ9A 5IUXA 3UU5A 2Y58A 2WNLA 4UM3S 4TWFA 5HEGA 5TVCA 2BJ0A 3SIOA 4WV9A 4ZR6A 4A98A 2ZJVA 4XHEA 4UM3A 5HCMA 3WTJA 3P50A 4LMLA 4UM1A 5AFJA 3GUAA 4HFHA 4NPPA 5AFHA 3RIFA 3WTOA 3IGQA 4ZRUA 4ZZBA 5SYOA 4QH5A 3U8JA 2BYNA 2YN6A 4TWDA 4AFGA 4AFTA 2BYSA 2WNCA 4B5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8H A;  4QH1 A;  2WN9 A;  3PMZ A;  3UUB A;  3JAF A;  5FJV A;  3WIP A;  4ILB A;  3PEO A;  2XQ5 A;  4HFC A;  3WTH A;  2VL0 A;  2XYS A;  5JME A;  2BR8 A;  4BFQ A;  4QAA A;  2XYT A;  3U8L A;  2PGZ A;  4FRR A;  4QAC A;  2Y7Y A;  3C79 A;  3RIA A;  5AFK A;  2XQ9 A;  2Y57 A;  3SH1 A;  2YKS A;  4ILC A;  4NZB A;  3UQ4 A;  2X00 D;  2Y56 A;  4HFB A;  3RI5 A;  4TWH A;  2YME A;  2XQ4 A;  4QH4 A;  3TLU A;  2BG9 A;  4DBM A;  3TLW A;  5HEU A;  2YOE A;  2PH9 A;  5CO5 A;  2C9T A;  2XQ8 A;  4UM3 P;  2BG9 C;  5AIN A;  4ZZC A;  5KZU A;  4Z90 A;  4QAB A;  3U8N A;  3C84 A;  3SQ6 A;  4LMJ A;  3WTL A;  2W8G A;  5BRX A;  3UU8 A;  1UW6 A;  4Z91 A;  2W8F A;  4ALX A;  3UQ7 A;  4COF A;  5BP0 A;  5BW2 A;  3UU4 A;  4X5T A;  5L47 A;  4ZJT A;  2XQ6 A;  3UU6 A;  4TNW A;  2UZ6 A;  3WTI A;  3U8M A;  2BR7 A;  4LMK A;  1UV6 A;  3TLT A;  3ZDG A;  4PIR A;  3RQU A;  2XQA A;  5J0Z A;  2XNV A;  3TLV A;  3EAM A;  3T4M A;  5AFM B;  2BYQ A;  4A97 A;  4ILA A;  3RHW A;  4UY2 A;  5J5H A;  2XQ3 A;  5KE4 A;  4BQT A;  2XZ5 A;  5J5I A;  5AFL A;  5L4E A;  4EZ1 A;  5LXB A;  5L4H A;  4ZK1 A;  5HEO A;  2QC1 B;  5HEH A;  3RQW A;  5CFB A;  1I9B A;  3WTK A;  2YMD A;  4HFE A;  2XNU A;  2XZ6 A;  5HCJ A;  3TLS A;  4ZJS A;  5LG3 A;  3JAE A;  4IL9 A;  2BYR A;  3LSV A;  4TNV A;  2XNT A;  4UXU A;  5J5G A;  2WZY A;  2BG9 E;  4IL4 A;  3WTN A;  3ZDH A;  5J5F A;  4D01 A;  3P4W A;  1UX2 A;  4ZK4 A;  3U8K A;  5AFN A;  2WNJ A;  2BG9 B;  5HEJ A;  3UU3 A;  4IRE A;  3ZKR A;  4XK9 A;  3EHZ A;  2Y54 A;  2XQ7 A;  3WTM A;  4AFH A;  5AFM A;  4HFD A;  2X00 A;  4HQP A;  4HFI A;  2BYP A;  3JAD A;  3EI0 A;  2ZJU A;  3SQ9 A;  5IUX A;  3UU5 A;  2Y58 A;  2WNL A;  4UM3 S;  4TWF A;  5HEG A;  5TVC A;  2BJ0 A;  3SIO A;  4WV9 A;  4ZR6 A;  4A98 A;  2ZJV A;  4XHE A;  4UM3 A;  5HCM A;  3WTJ A;  3P50 A;  4LML A;  4UM1 A;  5AFJ A;  3GUA A;  4HFH A;  4NPP A;  5AFH A;  3RIF A;  3WTO A;  3IGQ A;  4ZRU A;  4ZZB A;  5SYO A;  4QH5 A;  3U8J A;  2BYN A;  2YN6 A;  4TWD A;  4AFG A;  4AFT A;  2BYS A;  2WNC A;  4B5D A; 
#chains in the Genus database with same CATH topology
 4F8H A;  4QH1 A;  2WN9 A;  3PMZ A;  3UUB A;  3JAF A;  5FJV A;  3WIP A;  4ILB A;  3PEO A;  2XQ5 A;  4HFC A;  3WTH A;  2VL0 A;  2XYS A;  5JME A;  2BR8 A;  4BFQ A;  4QAA A;  2XYT A;  3U8L A;  2PGZ A;  4FRR A;  4QAC A;  2Y7Y A;  3C79 A;  3RIA A;  5AFK A;  2XQ9 A;  2Y57 A;  3SH1 A;  2YKS A;  4ILC A;  4NZB A;  3UQ4 A;  2X00 D;  2Y56 A;  4HFB A;  3RI5 A;  4TWH A;  2YME A;  2XQ4 A;  4QH4 A;  3TLU A;  2BG9 A;  4DBM A;  3TLW A;  5HEU A;  2YOE A;  2PH9 A;  5CO5 A;  2C9T A;  2XQ8 A;  4UM3 P;  2BG9 C;  5AIN A;  4ZZC A;  5KZU A;  4Z90 A;  4QAB A;  3U8N A;  3C84 A;  3SQ6 A;  4LMJ A;  3WTL A;  2W8G A;  5BRX A;  3UU8 A;  1UW6 A;  4Z91 A;  2W8F A;  4ALX A;  3UQ7 A;  4COF A;  5BP0 A;  5BW2 A;  3UU4 A;  4X5T A;  5L47 A;  4ZJT A;  2XQ6 A;  3UU6 A;  4TNW A;  2UZ6 A;  3WTI A;  3U8M A;  2BR7 A;  4LMK A;  1UV6 A;  3TLT A;  3ZDG A;  4PIR A;  3RQU A;  2XQA A;  5J0Z A;  2XNV A;  3TLV A;  3EAM A;  3T4M A;  5AFM B;  2BYQ A;  4A97 A;  4ILA A;  3RHW A;  4UY2 A;  5J5H A;  2XQ3 A;  5KE4 A;  4BQT A;  2XZ5 A;  5J5I A;  5AFL A;  5L4E A;  4EZ1 A;  5LXB A;  5L4H A;  4ZK1 A;  5HEO A;  2QC1 B;  5HEH A;  3RQW A;  5CFB A;  1I9B A;  3WTK A;  2YMD A;  4HFE A;  2XNU A;  2XZ6 A;  5HCJ A;  3TLS A;  4ZJS A;  5LG3 A;  3JAE A;  4IL9 A;  2BYR A;  3LSV A;  4TNV A;  2XNT A;  4UXU A;  5J5G A;  2WZY A;  2BG9 E;  4IL4 A;  3WTN A;  3ZDH A;  5J5F A;  4D01 A;  3P4W A;  1UX2 A;  4ZK4 A;  3U8K A;  5AFN A;  2WNJ A;  2BG9 B;  5HEJ A;  3UU3 A;  4IRE A;  3ZKR A;  4XK9 A;  3EHZ A;  2Y54 A;  2XQ7 A;  3WTM A;  4AFH A;  5AFM A;  4HFD A;  2X00 A;  4HQP A;  4HFI A;  2BYP A;  3JAD A;  3EI0 A;  2ZJU A;  3SQ9 A;  5IUX A;  3UU5 A;  2Y58 A;  2WNL A;  4UM3 S;  4TWF A;  5HEG A;  5TVC A;  2BJ0 A;  3SIO A;  4WV9 A;  4ZR6 A;  4A98 A;  2ZJV A;  4XHE A;  4UM3 A;  5HCM A;  3WTJ A;  3P50 A;  4LML A;  4UM1 A;  5AFJ A;  3GUA A;  4HFH A;  4NPP A;  5AFH A;  3RIF A;  3WTO A;  3IGQ A;  4ZRU A;  4ZZB A;  5SYO A;  4QH5 A;  3U8J A;  2BYN A;  2YN6 A;  4TWD A;  4AFG A;  4AFT A;  2BYS A;  2WNC A;  4B5D A; 
#chains in the Genus database with same CATH homology
 4F8H A;  4QH1 A;  2WN9 A;  3PMZ A;  3UUB A;  3JAF A;  5FJV A;  3WIP A;  4ILB A;  3PEO A;  2XQ5 A;  4HFC A;  3WTH A;  2VL0 A;  2XYS A;  5JME A;  2BR8 A;  4BFQ A;  4QAA A;  2XYT A;  3U8L A;  2PGZ A;  4FRR A;  4QAC A;  2Y7Y A;  3C79 A;  3RIA A;  5AFK A;  2XQ9 A;  2Y57 A;  3SH1 A;  2YKS A;  4ILC A;  4NZB A;  3UQ4 A;  2X00 D;  2Y56 A;  4HFB A;  3RI5 A;  4TWH A;  2YME A;  2XQ4 A;  4QH4 A;  3TLU A;  2BG9 A;  4DBM A;  3TLW A;  5HEU A;  2YOE A;  2PH9 A;  5CO5 A;  2C9T A;  2XQ8 A;  4UM3 P;  2BG9 C;  5AIN A;  4ZZC A;  5KZU A;  4Z90 A;  4QAB A;  3U8N A;  3C84 A;  3SQ6 A;  4LMJ A;  3WTL A;  2W8G A;  5BRX A;  3UU8 A;  1UW6 A;  4Z91 A;  2W8F A;  4ALX A;  3UQ7 A;  4COF A;  5BP0 A;  5BW2 A;  3UU4 A;  4X5T A;  5L47 A;  4ZJT A;  2XQ6 A;  3UU6 A;  4TNW A;  2UZ6 A;  3WTI A;  3U8M A;  2BR7 A;  4LMK A;  1UV6 A;  3TLT A;  3ZDG A;  4PIR A;  3RQU A;  2XQA A;  5J0Z A;  2XNV A;  3TLV A;  3EAM A;  3T4M A;  5AFM B;  2BYQ A;  4A97 A;  4ILA A;  3RHW A;  4UY2 A;  5J5H A;  2XQ3 A;  5KE4 A;  4BQT A;  2XZ5 A;  5J5I A;  5AFL A;  5L4E A;  4EZ1 A;  5LXB A;  5L4H A;  4ZK1 A;  5HEO A;  2QC1 B;  5HEH A;  3RQW A;  5CFB A;  1I9B A;  3WTK A;  2YMD A;  4HFE A;  2XNU A;  2XZ6 A;  5HCJ A;  3TLS A;  4ZJS A;  5LG3 A;  3JAE A;  4IL9 A;  2BYR A;  3LSV A;  4TNV A;  2XNT A;  4UXU A;  5J5G A;  2WZY A;  2BG9 E;  4IL4 A;  3WTN A;  3ZDH A;  5J5F A;  4D01 A;  3P4W A;  1UX2 A;  4ZK4 A;  3U8K A;  5AFN A;  2WNJ A;  2BG9 B;  5HEJ A;  3UU3 A;  4IRE A;  3ZKR A;  4XK9 A;  3EHZ A;  2Y54 A;  2XQ7 A;  3WTM A;  4AFH A;  5AFM A;  4HFD A;  2X00 A;  4HQP A;  4HFI A;  2BYP A;  3JAD A;  3EI0 A;  2ZJU A;  3SQ9 A;  5IUX A;  3UU5 A;  2Y58 A;  2WNL A;  4UM3 S;  4TWF A;  5HEG A;  5TVC A;  2BJ0 A;  3SIO A;  4WV9 A;  4ZR6 A;  4A98 A;  2ZJV A;  4XHE A;  4UM3 A;  5HCM A;  3WTJ A;  3P50 A;  4LML A;  4UM1 A;  5AFJ A;  3GUA A;  4HFH A;  4NPP A;  5AFH A;  3RIF A;  3WTO A;  3IGQ A;  4ZRU A;  4ZZB A;  5SYO A;  4QH5 A;  3U8J A;  2BYN A;  2YN6 A;  4TWD A;  4AFG A;  4AFT A;  2BYS A;  2WNC A;  4B5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...