2XZ6A

Mtset-modified y53c mutant of aplysia achbp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYCEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Cysteine-Modified Mutant in Loop D of Acetylcholine Binding Protein
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xz6A00
2X00D 5J5FA 5AFMB 3U8JA 4TNWA 2BG9B 2BG9C 4TNVA 2XQ9A 3TLSA 5CFBA 3WIPA 4ZK1A 3UU4A 4UXUA 2XZ5A 4ILCA 3WTJA 3U8LA 4UM3P 5J0ZA 4HQPA 2BYRA 5J5GA 4TWDA 4QH5A 4NZBA 4UY2A 5SYOA 5BW2A 3RHWA 2BYNA 4ZZCA 5HCJA 2XQ3A 3U8NA 4EZ1A 2W8FA 4BFQA 4ZJTA 4DBMA 2XQ6A 5HEGA 4UM3S 2X00A 4QH4A 2PGZA 2XYTA 2ZJUA 3C84A 3UU8A 4TWFA 2Y54A 2YMEA 5HEJA 2WN9A 4LMLA 2Y7YA 3PMZA 1UX2A 5LG3A 2BYSA 2W8GA 4HFDA 4UM3A 5TVCA 4XHEA 4B5DA 3UU6A 2QC1B 2XZ6A 5CO5A 3U8MA 2C9TA 4A97A 2YN6A 2YMDA 2ZJVA 4XK9A 4ZJSA 4ZR6A 3JAFA 4IL4A 4AFGA 2BR8A 3PEOA 3WTMA 5L4EA 4HFIA 3EAMA 3TLWA 3WTNA 5AINA 4QABA 2XNVA 3EHZA 4LMKA 4UM1A 2BG9E 2BJ0A 2XQ8A 3UU3A 2XNTA 2XQ7A 5AFKA 3WTLA 3TLUA 5J5IA 2YOEA 3UUBA 5BP0A 2XQ5A 3SH1A 3SQ6A 3ZKRA 3EI0A 5AFLA 4ZRUA 4HFHA 2Y57A 1UW6A 3T4MA 5AFJA 2Y58A 4A98A 4X5TA 2UZ6A 3RIAA 1UV6A 5HCMA 3TLTA 3WTKA 4QH1A 4TWHA 3RIFA 5AFHA 4AFHA 4COFA 3P4WA 3C79A 5HEOA 4F8HA 5AFMA 2WNCA 5AFNA 5KZUA 3UQ7A 2BG9A 2WNLA 4WV9A 4ZZBA 4PIRA 3SQ9A 5BRXA 5IUXA 5KE4A 5HEHA 3ZDGA 4ILBA 4ILAA 4ZK4A 4D01A 5JMEA 3WTIA 3UQ4A 2YKSA 4Z90A 5J5HA 2XQAA 3JAEA 3WTOA 3IGQA 3P50A 4BQTA 1I9BA 4Z91A 3UU5A 4ALXA 4NPPA 2XYSA 5L4HA 4HFBA 3RQWA 2Y56A 5LXBA 2WNJA 2XQ4A 5HEUA 3SIOA 2VL0A 3RI5A 3RQUA 2BYPA 3TLVA 4HFCA 2XNUA 2PH9A 3ZDHA 5FJVA 2BR7A 4IREA 4AFTA 5L47A 4IL9A 4QACA 3GUAA 4QAAA 3WTHA 3U8KA 4HFEA 2WZYA 2BYQA 4FRRA 3JADA 4LMJA 3LSVA
chains in the Genus database with same CATH superfamily
2X00D 5J5FA 5AFMB 3U8JA 4TNWA 2BG9B 2BG9C 4TNVA 2XQ9A 3TLSA 5CFBA 3WIPA 4ZK1A 3UU4A 4UXUA 2XZ5A 4ILCA 3WTJA 3U8LA 4UM3P 5J0ZA 4HQPA 2BYRA 5J5GA 4TWDA 4QH5A 4NZBA 4UY2A 5SYOA 5BW2A 3RHWA 2BYNA 4ZZCA 5HCJA 2XQ3A 3U8NA 4EZ1A 2W8FA 4BFQA 4ZJTA 4DBMA 2XQ6A 5HEGA 4UM3S 2X00A 4QH4A 2PGZA 2XYTA 2ZJUA 3C84A 3UU8A 4TWFA 2Y54A 2YMEA 5HEJA 2WN9A 4LMLA 2Y7YA 3PMZA 1UX2A 5LG3A 2BYSA 2W8GA 4HFDA 4UM3A 5TVCA 4XHEA 4B5DA 3UU6A 2QC1B 2XZ6A 5CO5A 3U8MA 2C9TA 4A97A 2YN6A 2YMDA 2ZJVA 4XK9A 4ZJSA 4ZR6A 3JAFA 4IL4A 4AFGA 2BR8A 3PEOA 3WTMA 5L4EA 4HFIA 3EAMA 3TLWA 3WTNA 5AINA 4QABA 2XNVA 3EHZA 4LMKA 4UM1A 2BG9E 2BJ0A 2XQ8A 3UU3A 2XNTA 2XQ7A 5AFKA 3WTLA 3TLUA 5J5IA 2YOEA 3UUBA 5BP0A 2XQ5A 3SH1A 3SQ6A 3ZKRA 3EI0A 5AFLA 4ZRUA 4HFHA 2Y57A 1UW6A 3T4MA 5AFJA 2Y58A 4A98A 4X5TA 2UZ6A 3RIAA 1UV6A 5HCMA 3TLTA 3WTKA 4QH1A 4TWHA 3RIFA 5AFHA 4AFHA 4COFA 3P4WA 3C79A 5HEOA 4F8HA 5AFMA 2WNCA 5AFNA 5KZUA 3UQ7A 2BG9A 2WNLA 4WV9A 4ZZBA 4PIRA 3SQ9A 5BRXA 5IUXA 5KE4A 5HEHA 3ZDGA 4ILBA 4ILAA 4ZK4A 4D01A 5JMEA 3WTIA 3UQ4A 2YKSA 4Z90A 5J5HA 2XQAA 3JAEA 3WTOA 3IGQA 3P50A 4BQTA 1I9BA 4Z91A 3UU5A 4ALXA 4NPPA 2XYSA 5L4HA 4HFBA 3RQWA 2Y56A 5LXBA 2WNJA 2XQ4A 5HEUA 3SIOA 2VL0A 3RI5A 3RQUA 2BYPA 3TLVA 4HFCA 2XNUA 2PH9A 3ZDHA 5FJVA 2BR7A 4IREA 4AFTA 5L47A 4IL9A 4QACA 3GUAA 4QAAA 3WTHA 3U8KA 4HFEA 2WZYA 2BYQA 4FRRA 3JADA 4LMJA 3LSVA
chains in the Genus database with same CATH topology
2X00D 5J5FA 5AFMB 3U8JA 4TNWA 2BG9B 2BG9C 4TNVA 2XQ9A 3TLSA 5CFBA 3WIPA 4ZK1A 3UU4A 4UXUA 2XZ5A 4ILCA 3WTJA 3U8LA 4UM3P 5J0ZA 4HQPA 2BYRA 5J5GA 4TWDA 4QH5A 4NZBA 4UY2A 5SYOA 5BW2A 3RHWA 2BYNA 4ZZCA 5HCJA 2XQ3A 3U8NA 4EZ1A 2W8FA 4BFQA 4ZJTA 4DBMA 2XQ6A 5HEGA 4UM3S 2X00A 4QH4A 2PGZA 2XYTA 2ZJUA 3C84A 3UU8A 4TWFA 2Y54A 2YMEA 5HEJA 2WN9A 4LMLA 2Y7YA 3PMZA 1UX2A 5LG3A 2BYSA 2W8GA 4HFDA 4UM3A 5TVCA 4XHEA 4B5DA 3UU6A 2QC1B 2XZ6A 5CO5A 3U8MA 2C9TA 4A97A 2YN6A 2YMDA 2ZJVA 4XK9A 4ZJSA 4ZR6A 3JAFA 4IL4A 4AFGA 2BR8A 3PEOA 3WTMA 5L4EA 4HFIA 3EAMA 3TLWA 3WTNA 5AINA 4QABA 2XNVA 3EHZA 4LMKA 4UM1A 2BG9E 2BJ0A 2XQ8A 3UU3A 2XNTA 2XQ7A 5AFKA 3WTLA 3TLUA 5J5IA 2YOEA 3UUBA 5BP0A 2XQ5A 3SH1A 3SQ6A 3ZKRA 3EI0A 5AFLA 4ZRUA 4HFHA 2Y57A 1UW6A 3T4MA 5AFJA 2Y58A 4A98A 4X5TA 2UZ6A 3RIAA 1UV6A 5HCMA 3TLTA 3WTKA 4QH1A 4TWHA 3RIFA 5AFHA 4AFHA 4COFA 3P4WA 3C79A 5HEOA 4F8HA 5AFMA 2WNCA 5AFNA 5KZUA 3UQ7A 2BG9A 2WNLA 4WV9A 4ZZBA 4PIRA 3SQ9A 5BRXA 5IUXA 5KE4A 5HEHA 3ZDGA 4ILBA 4ILAA 4ZK4A 4D01A 5JMEA 3WTIA 3UQ4A 2YKSA 4Z90A 5J5HA 2XQAA 3JAEA 3WTOA 3IGQA 3P50A 4BQTA 1I9BA 4Z91A 3UU5A 4ALXA 4NPPA 2XYSA 5L4HA 4HFBA 3RQWA 2Y56A 5LXBA 2WNJA 2XQ4A 5HEUA 3SIOA 2VL0A 3RI5A 3RQUA 2BYPA 3TLVA 4HFCA 2XNUA 2PH9A 3ZDHA 5FJVA 2BR7A 4IREA 4AFTA 5L47A 4IL9A 4QACA 3GUAA 4QAAA 3WTHA 3U8KA 4HFEA 2WZYA 2BYQA 4FRRA 3JADA 4LMJA 3LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 D;  5J5F A;  5AFM B;  3U8J A;  4TNW A;  2BG9 B;  2BG9 C;  4TNV A;  2XQ9 A;  3TLS A;  5CFB A;  3WIP A;  4ZK1 A;  3UU4 A;  4UXU A;  2XZ5 A;  4ILC A;  3WTJ A;  3U8L A;  4UM3 P;  5J0Z A;  4HQP A;  2BYR A;  5J5G A;  4TWD A;  4QH5 A;  4NZB A;  4UY2 A;  5SYO A;  5BW2 A;  3RHW A;  2BYN A;  4ZZC A;  5HCJ A;  2XQ3 A;  3U8N A;  4EZ1 A;  2W8F A;  4BFQ A;  4ZJT A;  4DBM A;  2XQ6 A;  5HEG A;  4UM3 S;  2X00 A;  4QH4 A;  2PGZ A;  2XYT A;  2ZJU A;  3C84 A;  3UU8 A;  4TWF A;  2Y54 A;  2YME A;  5HEJ A;  2WN9 A;  4LML A;  2Y7Y A;  3PMZ A;  1UX2 A;  5LG3 A;  2BYS A;  2W8G A;  4HFD A;  4UM3 A;  5TVC A;  4XHE A;  4B5D A;  3UU6 A;  2QC1 B;  2XZ6 A;  5CO5 A;  3U8M A;  2C9T A;  4A97 A;  2YN6 A;  2YMD A;  2ZJV A;  4XK9 A;  4ZJS A;  4ZR6 A;  3JAF A;  4IL4 A;  4AFG A;  2BR8 A;  3PEO A;  3WTM A;  5L4E A;  4HFI A;  3EAM A;  3TLW A;  3WTN A;  5AIN A;  4QAB A;  2XNV A;  3EHZ A;  4LMK A;  4UM1 A;  2BG9 E;  2BJ0 A;  2XQ8 A;  3UU3 A;  2XNT A;  2XQ7 A;  5AFK A;  3WTL A;  3TLU A;  5J5I A;  2YOE A;  3UUB A;  5BP0 A;  2XQ5 A;  3SH1 A;  3SQ6 A;  3ZKR A;  3EI0 A;  5AFL A;  4ZRU A;  4HFH A;  2Y57 A;  1UW6 A;  3T4M A;  5AFJ A;  2Y58 A;  4A98 A;  4X5T A;  2UZ6 A;  3RIA A;  1UV6 A;  5HCM A;  3TLT A;  3WTK A;  4QH1 A;  4TWH A;  3RIF A;  5AFH A;  4AFH A;  4COF A;  3P4W A;  3C79 A;  5HEO A;  4F8H A;  5AFM A;  2WNC A;  5AFN A;  5KZU A;  3UQ7 A;  2BG9 A;  2WNL A;  4WV9 A;  4ZZB A;  4PIR A;  3SQ9 A;  5BRX A;  5IUX A;  5KE4 A;  5HEH A;  3ZDG A;  4ILB A;  4ILA A;  4ZK4 A;  4D01 A;  5JME A;  3WTI A;  3UQ4 A;  2YKS A;  4Z90 A;  5J5H A;  2XQA A;  3JAE A;  3WTO A;  3IGQ A;  3P50 A;  4BQT A;  1I9B A;  4Z91 A;  3UU5 A;  4ALX A;  4NPP A;  2XYS A;  5L4H A;  4HFB A;  3RQW A;  2Y56 A;  5LXB A;  2WNJ A;  2XQ4 A;  5HEU A;  3SIO A;  2VL0 A;  3RI5 A;  3RQU A;  2BYP A;  3TLV A;  4HFC A;  2XNU A;  2PH9 A;  3ZDH A;  5FJV A;  2BR7 A;  4IRE A;  4AFT A;  5L47 A;  4IL9 A;  4QAC A;  3GUA A;  4QAA A;  3WTH A;  3U8K A;  4HFE A;  2WZY A;  2BYQ A;  4FRR A;  3JAD A;  4LMJ A;  3LSV A; 
#chains in the Genus database with same CATH topology
 2X00 D;  5J5F A;  5AFM B;  3U8J A;  4TNW A;  2BG9 B;  2BG9 C;  4TNV A;  2XQ9 A;  3TLS A;  5CFB A;  3WIP A;  4ZK1 A;  3UU4 A;  4UXU A;  2XZ5 A;  4ILC A;  3WTJ A;  3U8L A;  4UM3 P;  5J0Z A;  4HQP A;  2BYR A;  5J5G A;  4TWD A;  4QH5 A;  4NZB A;  4UY2 A;  5SYO A;  5BW2 A;  3RHW A;  2BYN A;  4ZZC A;  5HCJ A;  2XQ3 A;  3U8N A;  4EZ1 A;  2W8F A;  4BFQ A;  4ZJT A;  4DBM A;  2XQ6 A;  5HEG A;  4UM3 S;  2X00 A;  4QH4 A;  2PGZ A;  2XYT A;  2ZJU A;  3C84 A;  3UU8 A;  4TWF A;  2Y54 A;  2YME A;  5HEJ A;  2WN9 A;  4LML A;  2Y7Y A;  3PMZ A;  1UX2 A;  5LG3 A;  2BYS A;  2W8G A;  4HFD A;  4UM3 A;  5TVC A;  4XHE A;  4B5D A;  3UU6 A;  2QC1 B;  2XZ6 A;  5CO5 A;  3U8M A;  2C9T A;  4A97 A;  2YN6 A;  2YMD A;  2ZJV A;  4XK9 A;  4ZJS A;  4ZR6 A;  3JAF A;  4IL4 A;  4AFG A;  2BR8 A;  3PEO A;  3WTM A;  5L4E A;  4HFI A;  3EAM A;  3TLW A;  3WTN A;  5AIN A;  4QAB A;  2XNV A;  3EHZ A;  4LMK A;  4UM1 A;  2BG9 E;  2BJ0 A;  2XQ8 A;  3UU3 A;  2XNT A;  2XQ7 A;  5AFK A;  3WTL A;  3TLU A;  5J5I A;  2YOE A;  3UUB A;  5BP0 A;  2XQ5 A;  3SH1 A;  3SQ6 A;  3ZKR A;  3EI0 A;  5AFL A;  4ZRU A;  4HFH A;  2Y57 A;  1UW6 A;  3T4M A;  5AFJ A;  2Y58 A;  4A98 A;  4X5T A;  2UZ6 A;  3RIA A;  1UV6 A;  5HCM A;  3TLT A;  3WTK A;  4QH1 A;  4TWH A;  3RIF A;  5AFH A;  4AFH A;  4COF A;  3P4W A;  3C79 A;  5HEO A;  4F8H A;  5AFM A;  2WNC A;  5AFN A;  5KZU A;  3UQ7 A;  2BG9 A;  2WNL A;  4WV9 A;  4ZZB A;  4PIR A;  3SQ9 A;  5BRX A;  5IUX A;  5KE4 A;  5HEH A;  3ZDG A;  4ILB A;  4ILA A;  4ZK4 A;  4D01 A;  5JME A;  3WTI A;  3UQ4 A;  2YKS A;  4Z90 A;  5J5H A;  2XQA A;  3JAE A;  3WTO A;  3IGQ A;  3P50 A;  4BQT A;  1I9B A;  4Z91 A;  3UU5 A;  4ALX A;  4NPP A;  2XYS A;  5L4H A;  4HFB A;  3RQW A;  2Y56 A;  5LXB A;  2WNJ A;  2XQ4 A;  5HEU A;  3SIO A;  2VL0 A;  3RI5 A;  3RQU A;  2BYP A;  3TLV A;  4HFC A;  2XNU A;  2PH9 A;  3ZDH A;  5FJV A;  2BR7 A;  4IRE A;  4AFT A;  5L47 A;  4IL9 A;  4QAC A;  3GUA A;  4QAA A;  3WTH A;  3U8K A;  4HFE A;  2WZY A;  2BYQ A;  4FRR A;  3JAD A;  4LMJ A;  3LSV A; 
#chains in the Genus database with same CATH homology
 2X00 D;  5J5F A;  5AFM B;  3U8J A;  4TNW A;  2BG9 B;  2BG9 C;  4TNV A;  2XQ9 A;  3TLS A;  5CFB A;  3WIP A;  4ZK1 A;  3UU4 A;  4UXU A;  2XZ5 A;  4ILC A;  3WTJ A;  3U8L A;  4UM3 P;  5J0Z A;  4HQP A;  2BYR A;  5J5G A;  4TWD A;  4QH5 A;  4NZB A;  4UY2 A;  5SYO A;  5BW2 A;  3RHW A;  2BYN A;  4ZZC A;  5HCJ A;  2XQ3 A;  3U8N A;  4EZ1 A;  2W8F A;  4BFQ A;  4ZJT A;  4DBM A;  2XQ6 A;  5HEG A;  4UM3 S;  2X00 A;  4QH4 A;  2PGZ A;  2XYT A;  2ZJU A;  3C84 A;  3UU8 A;  4TWF A;  2Y54 A;  2YME A;  5HEJ A;  2WN9 A;  4LML A;  2Y7Y A;  3PMZ A;  1UX2 A;  5LG3 A;  2BYS A;  2W8G A;  4HFD A;  4UM3 A;  5TVC A;  4XHE A;  4B5D A;  3UU6 A;  2QC1 B;  2XZ6 A;  5CO5 A;  3U8M A;  2C9T A;  4A97 A;  2YN6 A;  2YMD A;  2ZJV A;  4XK9 A;  4ZJS A;  4ZR6 A;  3JAF A;  4IL4 A;  4AFG A;  2BR8 A;  3PEO A;  3WTM A;  5L4E A;  4HFI A;  3EAM A;  3TLW A;  3WTN A;  5AIN A;  4QAB A;  2XNV A;  3EHZ A;  4LMK A;  4UM1 A;  2BG9 E;  2BJ0 A;  2XQ8 A;  3UU3 A;  2XNT A;  2XQ7 A;  5AFK A;  3WTL A;  3TLU A;  5J5I A;  2YOE A;  3UUB A;  5BP0 A;  2XQ5 A;  3SH1 A;  3SQ6 A;  3ZKR A;  3EI0 A;  5AFL A;  4ZRU A;  4HFH A;  2Y57 A;  1UW6 A;  3T4M A;  5AFJ A;  2Y58 A;  4A98 A;  4X5T A;  2UZ6 A;  3RIA A;  1UV6 A;  5HCM A;  3TLT A;  3WTK A;  4QH1 A;  4TWH A;  3RIF A;  5AFH A;  4AFH A;  4COF A;  3P4W A;  3C79 A;  5HEO A;  4F8H A;  5AFM A;  2WNC A;  5AFN A;  5KZU A;  3UQ7 A;  2BG9 A;  2WNL A;  4WV9 A;  4ZZB A;  4PIR A;  3SQ9 A;  5BRX A;  5IUX A;  5KE4 A;  5HEH A;  3ZDG A;  4ILB A;  4ILA A;  4ZK4 A;  4D01 A;  5JME A;  3WTI A;  3UQ4 A;  2YKS A;  4Z90 A;  5J5H A;  2XQA A;  3JAE A;  3WTO A;  3IGQ A;  3P50 A;  4BQT A;  1I9B A;  4Z91 A;  3UU5 A;  4ALX A;  4NPP A;  2XYS A;  5L4H A;  4HFB A;  3RQW A;  2Y56 A;  5LXB A;  2WNJ A;  2XQ4 A;  5HEU A;  3SIO A;  2VL0 A;  3RI5 A;  3RQU A;  2BYP A;  3TLV A;  4HFC A;  2XNU A;  2PH9 A;  3ZDH A;  5FJV A;  2BR7 A;  4IRE A;  4AFT A;  5L47 A;  4IL9 A;  4QAC A;  3GUA A;  4QAA A;  3WTH A;  3U8K A;  4HFE A;  2WZY A;  2BYQ A;  4FRR A;  3JAD A;  4LMJ A;  3LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...