2Y00A

Turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist dobutamine (crystal dob92)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
298
structure length
286
Chain Sequence
AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Agonist and Partial Agonist Action on a Beta1-Adrenergic Receptor
pubmed doi rcsb
molecule keywords BETA-1 ADRENERGIC RECEPTOR
molecule tags Receptor
source organism Meleagris gallopavo
total genus 123
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2y00A00
3PBLA 1P8HA 3C9MA 2L6XA 2QPDB 1S53A 4BEYA 4IARA 3QBGA 2ZFEA 4JQ6A 2J4YA 1S52A 1X0K1 1Q5IA 1X0I1 5H2NA 3CODA 3MBVA 4KLYA 3EH5B 5TGZA 3AYMA 2RH1A 4MQTA 1PXRA 2I35A 5AZDA 5G28A 4EIYA 4GP5B 5B2NA 5A45A 4FBZA 3OE9A 1AP9A 2Y01A 3D4SA 5B6ZA 3QJTB 3UG9A 1IXFA 1C3WA 4DAJA 1JV6A 1O0AA 3OE0A 1TN0A 1QHJA 2KSYA 2BRDA 4QIDA 5AX0A 3VW7A 3AYNA 3NY9A 4GRVA 2R4SA 4PXFA 4GP4B 1FBKA 4X31A 1E0PA 5ITCA 1FBBA 3S3BB 2QPEB 3PDSA 5F8UA 3S3CB 2WJKA 4WW3A 3PWHA 2PEDA 4GP8B 5B6WA 5G36A 2YCYA 1TN5A 4HWLA 3VI0A 1M0MA 1DZEA 3HASA 2LNLA 1QKOA 3VGAA 3KJ6A 2KSBA 5B34A 4LDLA 4HYJA 4GPOA 4LDEA 4WAVA 1CWQA 3NY8A 3S8GB 2G87A 2I21A 4QRYA 5B6YA 1M0KA 3QBLA 3RFMA 1S8JA 2JAGA 5EN0A 4G7RB 3ZPQA 4IAQA 2Y00A 1IW6A 1M0LA 1UCQA 3ODUA 5FJGA 3VHZA 5H2HA 3SN6R 3HAQA 1PY6A 4DJHA 4J4QA 3ABWA 1E12A 4OV0A 3COCA 5G54A 4A4MA 2YCWA 1XIOA 5B6XA 1BM1A 5AWZA 5JJJA 3EMLA 5ETZA 1L9HA 3S3DB 3HAPA 3X3CA 1AT9A 4LDOA 5DHHA 1F50A 5H2MA 3EH4B 5BR2A 3UONA 5A8EA 4JR8A 2KS9A 5G53A 1JFPA 4HYXA 2YDVA 5H2LA 3EH3B 1BRRA 1BRDA 4G72B 1KG8A 5AHZA 3UTWA 3OE8A 3DQBA 4UG2A 3UZAA 3UTXA 3CAPA 4G71B 5A44A 3X3BA 1C8RA 5H2KA 1MGYA 1GZMA 5G2AA 5H2JA 3NSBA 4L35A 4MBSA 1VJMA 3DDLA 4BVNA 4Y9HA 2AT9A 5J7AA 1R84A 3ZPRA 5B6VA 3NS0A 1PXSA 5JJEA 3UZCA 3P0GA 2X72A 4XTLA 1IW9A 1QM8A 4XT1A 2NTWA 3VG9A 3QBIA 5ITEA 3C9LA 1S51A 3QJSB 3NYAA 1P8IA 5AX1A 1BRXA 5H2OA 5C1MA 3QBKA 3V2YA 3QAKA 2R4RA 4FA7B 4K5YA 2F95A 3QJRB 3QJVB 4XTNA 3V2WA 5B0WA 1UAZA 4AMJA 4BEZA 3WQJA 3HAOA 5DHGA 2YDOA 1EHKB 2NTUA 3T45A 1C8SA 4G7QB 4X1HA 2Z73A 3PQRA 3PXOA 5G2CA 1JV7A 4G70B 1R2NA 3BVDB 5G2DA 4NC3A 4PXKA 3ZEVA 5KKHA 1VGOA 4UHRA 3A7KA 3QJQB 2KSAA 4BV0A 2I1XA 3QAPA 1S8LA 5B35A 1KGBA 5H2IA 1Q5JA 3HANA 1KG9A 4IB4A 4BWBA 1QKPA 4EJ4A 1H68A 1XMEB 1GU8A 3AM6A 2Y03A 1JGJA 4X32A 4DKLA 2Y02A 5JJNA 3OAXA 2EI4A 3QDCA 4N6HA 2WJLA 2M3GA 2ZIYA 3OE6A 4G7SB 3S8FB 4FAAB 1U19A 1F4ZA 4MD1A 1P8UA 2F93A 2YCZA 3HARA 4XTOA 5DYSA 2I20A 5AHYA 1KMEA 5H2PA 3UTVA 1GUEA 4GYCA 4GBRA 4KNFA 5BR5A 2YCXA 4XXJA 2Y04A 3VVKA 4FPDA 4JKVA 1HZXA 3RZEA 4MD2A 4QI1A 4AMIA 4L6RA 2HPYA 4XT3A 1XJIA 3REYA 1LN6A 4MQSA 2ZZLA 4N4YB 1H2SA 4TL3A 1F88A 1L0MA 2JAFA 3QJUB 5LWEA 3UTYA 2VT4A 2Z55A 4EA3A 4N4WA 1S54A 4BUOA 1X0SA
chains in the Genus database with same CATH superfamily
3PBLA 1P8HA 3C9MA 2L6XA 2QPDB 1S53A 4BEYA 4IARA 3QBGA 2ZFEA 4JQ6A 2J4YA 1S52A 1X0K1 1Q5IA 1X0I1 5H2NA 3CODA 3MBVA 4KLYA 3EH5B 5TGZA 3AYMA 2RH1A 4MQTA 1PXRA 2I35A 5AZDA 5G28A 4EIYA 4GP5B 5B2NA 5A45A 4FBZA 3OE9A 1AP9A 2Y01A 3D4SA 5B6ZA 3QJTB 3UG9A 1IXFA 1C3WA 4DAJA 1JV6A 1O0AA 3OE0A 1TN0A 1QHJA 2KSYA 2BRDA 4QIDA 5AX0A 3VW7A 3AYNA 3NY9A 4GRVA 2R4SA 4PXFA 4GP4B 1FBKA 4X31A 1E0PA 5ITCA 1FBBA 3S3BB 2QPEB 3PDSA 5F8UA 3S3CB 2WJKA 4WW3A 3PWHA 2PEDA 4GP8B 5B6WA 5G36A 2YCYA 1TN5A 4HWLA 3VI0A 1M0MA 1DZEA 3HASA 2LNLA 1QKOA 3VGAA 3KJ6A 2KSBA 5B34A 4LDLA 4HYJA 4GPOA 4LDEA 4WAVA 1CWQA 3NY8A 3S8GB 2G87A 2I21A 4QRYA 5B6YA 1M0KA 3QBLA 3RFMA 1S8JA 2JAGA 5EN0A 4G7RB 3ZPQA 4IAQA 2Y00A 1IW6A 1M0LA 1UCQA 3ODUA 5FJGA 3VHZA 5H2HA 3SN6R 3HAQA 1PY6A 4DJHA 4J4QA 3ABWA 1E12A 4OV0A 3COCA 5G54A 4A4MA 2YCWA 1XIOA 5B6XA 1BM1A 5AWZA 5JJJA 3EMLA 5ETZA 1L9HA 3S3DB 3HAPA 3X3CA 1AT9A 4LDOA 5DHHA 1F50A 5H2MA 3EH4B 5BR2A 3UONA 5A8EA 4JR8A 2KS9A 5G53A 1JFPA 4HYXA 2YDVA 5H2LA 3EH3B 1BRRA 1BRDA 4G72B 1KG8A 5AHZA 3UTWA 3OE8A 3DQBA 4UG2A 3UZAA 3UTXA 3CAPA 4G71B 5A44A 3X3BA 1C8RA 5H2KA 1MGYA 1GZMA 5G2AA 5H2JA 3NSBA 4L35A 4MBSA 1VJMA 3DDLA 4BVNA 4Y9HA 2AT9A 5J7AA 1R84A 3ZPRA 5B6VA 3NS0A 1PXSA 5JJEA 3UZCA 3P0GA 2X72A 4XTLA 1IW9A 1QM8A 4XT1A 2NTWA 3VG9A 3QBIA 5ITEA 3C9LA 1S51A 3QJSB 3NYAA 1P8IA 5AX1A 1BRXA 5H2OA 5C1MA 3QBKA 3V2YA 3QAKA 2R4RA 4FA7B 4K5YA 2F95A 3QJRB 3QJVB 4XTNA 3V2WA 5B0WA 1UAZA 4AMJA 4BEZA 3WQJA 3HAOA 5DHGA 2YDOA 1EHKB 2NTUA 3T45A 1C8SA 4G7QB 4X1HA 2Z73A 3PQRA 3PXOA 5G2CA 1JV7A 4G70B 1R2NA 3BVDB 5G2DA 4NC3A 4PXKA 3ZEVA 5KKHA 1VGOA 4UHRA 3A7KA 3QJQB 2KSAA 4BV0A 2I1XA 3QAPA 1S8LA 5B35A 1KGBA 5H2IA 1Q5JA 3HANA 1KG9A 4IB4A 4BWBA 1QKPA 4EJ4A 1H68A 1XMEB 1GU8A 3AM6A 2Y03A 1JGJA 4X32A 4DKLA 2Y02A 5JJNA 3OAXA 2EI4A 3QDCA 4N6HA 2WJLA 2M3GA 2ZIYA 3OE6A 4G7SB 3S8FB 4FAAB 1U19A 1F4ZA 4MD1A 1P8UA 2F93A 2YCZA 3HARA 4XTOA 5DYSA 2I20A 5AHYA 1KMEA 5H2PA 3UTVA 1GUEA 4GYCA 4GBRA 4DS7E 4KNFA 5BR5A 2YCXA 4XXJA 2Y04A 3VVKA 4FPDA 4JKVA 1HZXA 3RZEA 4MD2A 4QI1A 4AMIA 4L6RA 2HPYA 4XT3A 1XJIA 3REYA 1LN6A 4MQSA 2ZZLA 4N4YB 1H2SA 4TL3A 1F88A 1L0MA 2JAFA 3QJUB 5LWEA 3UTYA 2VT4A 2Z55A 4EA3A 4N4WA 1S54A 4BUOA 1X0SA
chains in the Genus database with same CATH topology
3PBLA 1P8HA 3C9MA 2L6XA 2QPDB 1S53A 4BEYA 4IARA 3QBGA 2ZFEA 4JQ6A 2J4YA 1S52A 1X0K1 1Q5IA 1X0I1 5H2NA 3CODA 3MBVA 4KLYA 3EH5B 5TGZA 3AYMA 2RH1A 4MQTA 1PXRA 2I35A 5AZDA 5G28A 4EIYA 4GP5B 5B2NA 5A45A 4FBZA 3OE9A 1AP9A 2Y01A 3D4SA 5B6ZA 3QJTB 3UG9A 1IXFA 1C3WA 4DAJA 1JV6A 1O0AA 3OE0A 1TN0A 1QHJA 2KSYA 2BRDA 4QIDA 5AX0A 3VW7A 3AYNA 3NY9A 4GRVA 2R4SA 4PXFA 4GP4B 1FBKA 4X31A 1E0PA 5ITCA 1FBBA 3S3BB 2QPEB 3PDSA 5F8UA 3S3CB 2WJKA 4WW3A 3PWHA 2PEDA 4GP8B 5B6WA 5G36A 2YCYA 1TN5A 4HWLA 3VI0A 1M0MA 1DZEA 3HASA 2LNLA 1QKOA 3VGAA 3KJ6A 2KSBA 5B34A 4LDLA 4HYJA 4GPOA 4LDEA 4WAVA 1CWQA 3NY8A 3S8GB 2G87A 2I21A 4QRYA 5B6YA 1M0KA 3QBLA 3RFMA 1S8JA 2JAGA 5EN0A 4G7RB 3ZPQA 4IAQA 2Y00A 1IW6A 1M0LA 1UCQA 3ODUA 5FJGA 3VHZA 5H2HA 3SN6R 3HAQA 1PY6A 4DJHA 4J4QA 3ABWA 1E12A 4OV0A 3COCA 5G54A 4A4MA 2YCWA 1XIOA 5B6XA 1BM1A 5AWZA 5JJJA 3EMLA 5ETZA 1L9HA 3S3DB 3HAPA 3X3CA 1AT9A 4LDOA 5DHHA 1F50A 5H2MA 3EH4B 5BR2A 3UONA 5A8EA 4JR8A 2KS9A 5G53A 1JFPA 4HYXA 2YDVA 5H2LA 3EH3B 1BRRA 1BRDA 4G72B 1KG8A 5AHZA 3UTWA 3OE8A 3DQBA 4UG2A 3UZAA 3UTXA 3CAPA 4G71B 5A44A 3X3BA 1C8RA 5H2KA 1MGYA 1GZMA 5G2AA 5H2JA 3NSBA 4L35A 4MBSA 1VJMA 3DDLA 4BVNA 4Y9HA 2AT9A 5J7AA 1R84A 3ZPRA 5B6VA 3NS0A 1PXSA 5JJEA 3UZCA 3P0GA 2X72A 4XTLA 1IW9A 1QM8A 4XT1A 2NTWA 3VG9A 3QBIA 5ITEA 3C9LA 1S51A 3QJSB 3NYAA 1P8IA 5AX1A 1BRXA 5H2OA 5C1MA 3QBKA 3V2YA 3QAKA 2R4RA 4FA7B 4K5YA 2F95A 3QJRB 3QJVB 4XTNA 3V2WA 5B0WA 1UAZA 4AMJA 4BEZA 3WQJA 3HAOA 5DHGA 2YDOA 1EHKB 2NTUA 3T45A 1C8SA 4G7QB 4X1HA 2Z73A 3PQRA 3PXOA 5G2CA 1JV7A 4G70B 1R2NA 3BVDB 5G2DA 4NC3A 4PXKA 3ZEVA 5KKHA 1VGOA 4UHRA 3A7KA 3QJQB 2KSAA 4BV0A 2I1XA 3QAPA 1S8LA 5B35A 1KGBA 5H2IA 1Q5JA 3HANA 1KG9A 4IB4A 4BWBA 1QKPA 4EJ4A 1H68A 1XMEB 1GU8A 3AM6A 2Y03A 1JGJA 4X32A 4DKLA 2Y02A 5JJNA 3OAXA 2EI4A 3QDCA 4N6HA 2WJLA 2M3GA 2ZIYA 3OE6A 4G7SB 3S8FB 4FAAB 1U19A 1F4ZA 4MD1A 1P8UA 2F93A 2YCZA 3HARA 4XTOA 5DYSA 2I20A 5AHYA 1KMEA 5H2PA 3UTVA 1GUEA 4GYCA 4GBRA 4DS7E 4KNFA 5BR5A 2YCXA 4XXJA 2Y04A 3VVKA 4FPDA 4JKVA 1HZXA 3RZEA 4MD2A 4QI1A 4AMIA 4L6RA 2HPYA 4XT3A 1XJIA 3REYA 1LN6A 4MQSA 2ZZLA 4N4YB 1H2SA 4TL3A 1F88A 1L0MA 2JAFA 3QJUB 5LWEA 3UTYA 2VT4A 2Z55A 4EA3A 4N4WA 1S54A 4BUOA 1X0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBL A;  1P8H A;  3C9M A;  2L6X A;  2QPD B;  1S53 A;  4BEY A;  4IAR A;  3QBG A;  2ZFE A;  4JQ6 A;  2J4Y A;  1S52 A;  1X0K 1;  1Q5I A;  1X0I 1;  5H2N A;  3COD A;  3MBV A;  4KLY A;  3EH5 B;  5TGZ A;  3AYM A;  2RH1 A;  4MQT A;  1PXR A;  2I35 A;  5AZD A;  5G28 A;  4EIY A;  4GP5 B;  5B2N A;  5A45 A;  4FBZ A;  3OE9 A;  1AP9 A;  2Y01 A;  3D4S A;  5B6Z A;  3QJT B;  3UG9 A;  1IXF A;  1C3W A;  4DAJ A;  1JV6 A;  1O0A A;  3OE0 A;  1TN0 A;  1QHJ A;  2KSY A;  2BRD A;  4QID A;  5AX0 A;  3VW7 A;  3AYN A;  3NY9 A;  4GRV A;  2R4S A;  4PXF A;  4GP4 B;  1FBK A;  4X31 A;  1E0P A;  5ITC A;  1FBB A;  3S3B B;  2QPE B;  3PDS A;  5F8U A;  3S3C B;  2WJK A;  4WW3 A;  3PWH A;  2PED A;  4GP8 B;  5B6W A;  5G36 A;  2YCY A;  1TN5 A;  4HWL A;  3VI0 A;  1M0M A;  1DZE A;  3HAS A;  2LNL A;  1QKO A;  3VGA A;  3KJ6 A;  2KSB A;  5B34 A;  4LDL A;  4HYJ A;  4GPO A;  4LDE A;  4WAV A;  1CWQ A;  3NY8 A;  3S8G B;  2G87 A;  2I21 A;  4QRY A;  5B6Y A;  1M0K A;  3QBL A;  3RFM A;  1S8J A;  2JAG A;  5EN0 A;  4G7R B;  3ZPQ A;  4IAQ A;  2Y00 A;  1IW6 A;  1M0L A;  1UCQ A;  3ODU A;  5FJG A;  3VHZ A;  5H2H A;  3SN6 R;  3HAQ A;  1PY6 A;  4DJH A;  4J4Q A;  3ABW A;  1E12 A;  4OV0 A;  3COC A;  5G54 A;  4A4M A;  2YCW A;  1XIO A;  5B6X A;  1BM1 A;  5AWZ A;  5JJJ A;  3EML A;  5ETZ A;  1L9H A;  3S3D B;  3HAP A;  3X3C A;  1AT9 A;  4LDO A;  5DHH A;  1F50 A;  5H2M A;  3EH4 B;  5BR2 A;  3UON A;  5A8E A;  4JR8 A;  2KS9 A;  5G53 A;  1JFP A;  4HYX A;  2YDV A;  5H2L A;  3EH3 B;  1BRR A;  1BRD A;  4G72 B;  1KG8 A;  5AHZ A;  3UTW A;  3OE8 A;  3DQB A;  4UG2 A;  3UZA A;  3UTX A;  3CAP A;  4G71 B;  5A44 A;  3X3B A;  1C8R A;  5H2K A;  1MGY A;  1GZM A;  5G2A A;  5H2J A;  3NSB A;  4L35 A;  4MBS A;  1VJM A;  3DDL A;  4BVN A;  4Y9H A;  2AT9 A;  5J7A A;  1R84 A;  3ZPR A;  5B6V A;  3NS0 A;  1PXS A;  5JJE A;  3UZC A;  3P0G A;  2X72 A;  4XTL A;  1IW9 A;  1QM8 A;  4XT1 A;  2NTW A;  3VG9 A;  3QBI A;  5ITE A;  3C9L A;  1S51 A;  3QJS B;  3NYA A;  1P8I A;  5AX1 A;  1BRX A;  5H2O A;  5C1M A;  3QBK A;  3V2Y A;  3QAK A;  2R4R A;  4FA7 B;  4K5Y A;  2F95 A;  3QJR B;  3QJV B;  4XTN A;  3V2W A;  5B0W A;  1UAZ A;  4AMJ A;  4BEZ A;  3WQJ A;  3HAO A;  5DHG A;  2YDO A;  1EHK B;  2NTU A;  3T45 A;  1C8S A;  4G7Q B;  4X1H A;  2Z73 A;  3PQR A;  3PXO A;  5G2C A;  1JV7 A;  4G70 B;  1R2N A;  3BVD B;  5G2D A;  4NC3 A;  4PXK A;  3ZEV A;  5KKH A;  1VGO A;  4UHR A;  3A7K A;  3QJQ B;  2KSA A;  4BV0 A;  2I1X A;  3QAP A;  1S8L A;  5B35 A;  1KGB A;  5H2I A;  1Q5J A;  3HAN A;  1KG9 A;  4IB4 A;  4BWB A;  1QKP A;  4EJ4 A;  1H68 A;  1XME B;  1GU8 A;  3AM6 A;  2Y03 A;  1JGJ A;  4X32 A;  4DKL A;  2Y02 A;  5JJN A;  3OAX A;  2EI4 A;  3QDC A;  4N6H A;  2WJL A;  2M3G A;  2ZIY A;  3OE6 A;  4G7S B;  3S8F B;  4FAA B;  1U19 A;  1F4Z A;  4MD1 A;  1P8U A;  2F93 A;  2YCZ A;  3HAR A;  4XTO A;  5DYS A;  2I20 A;  5AHY A;  1KME A;  5H2P A;  3UTV A;  1GUE A;  4GYC A;  4GBR A;  4KNF A;  5BR5 A;  2YCX A;  4XXJ A;  2Y04 A;  3VVK A;  4FPD A;  4JKV A;  1HZX A;  3RZE A;  4MD2 A;  4QI1 A;  4AMI A;  4L6R A;  2HPY A;  4XT3 A;  1XJI A;  3REY A;  1LN6 A;  4MQS A;  2ZZL A;  4N4Y B;  1H2S A;  4TL3 A;  1F88 A;  1L0M A;  2JAF A;  3QJU B;  5LWE A;  3UTY A;  2VT4 A;  2Z55 A;  4EA3 A;  4N4W A;  1S54 A;  4BUO A;  1X0S A; 
#chains in the Genus database with same CATH topology
 3PBL A;  1P8H A;  3C9M A;  2L6X A;  2QPD B;  1S53 A;  4BEY A;  4IAR A;  3QBG A;  2ZFE A;  4JQ6 A;  2J4Y A;  1S52 A;  1X0K 1;  1Q5I A;  1X0I 1;  5H2N A;  3COD A;  3MBV A;  4KLY A;  3EH5 B;  5TGZ A;  3AYM A;  2RH1 A;  4MQT A;  1PXR A;  2I35 A;  5AZD A;  5G28 A;  4EIY A;  4GP5 B;  5B2N A;  5A45 A;  4FBZ A;  3OE9 A;  1AP9 A;  2Y01 A;  3D4S A;  5B6Z A;  3QJT B;  3UG9 A;  1IXF A;  1C3W A;  4DAJ A;  1JV6 A;  1O0A A;  3OE0 A;  1TN0 A;  1QHJ A;  2KSY A;  2BRD A;  4QID A;  5AX0 A;  3VW7 A;  3AYN A;  3NY9 A;  4GRV A;  2R4S A;  4PXF A;  4GP4 B;  1FBK A;  4X31 A;  1E0P A;  5ITC A;  1FBB A;  3S3B B;  2QPE B;  3PDS A;  5F8U A;  3S3C B;  2WJK A;  4WW3 A;  3PWH A;  2PED A;  4GP8 B;  5B6W A;  5G36 A;  2YCY A;  1TN5 A;  4HWL A;  3VI0 A;  1M0M A;  1DZE A;  3HAS A;  2LNL A;  1QKO A;  3VGA A;  3KJ6 A;  2KSB A;  5B34 A;  4LDL A;  4HYJ A;  4GPO A;  4LDE A;  4WAV A;  1CWQ A;  3NY8 A;  3S8G B;  2G87 A;  2I21 A;  4QRY A;  5B6Y A;  1M0K A;  3QBL A;  3RFM A;  1S8J A;  2JAG A;  5EN0 A;  4G7R B;  3ZPQ A;  4IAQ A;  2Y00 A;  1IW6 A;  1M0L A;  1UCQ A;  3ODU A;  5FJG A;  3VHZ A;  5H2H A;  3SN6 R;  3HAQ A;  1PY6 A;  4DJH A;  4J4Q A;  3ABW A;  1E12 A;  4OV0 A;  3COC A;  5G54 A;  4A4M A;  2YCW A;  1XIO A;  5B6X A;  1BM1 A;  5AWZ A;  5JJJ A;  3EML A;  5ETZ A;  1L9H A;  3S3D B;  3HAP A;  3X3C A;  1AT9 A;  4LDO A;  5DHH A;  1F50 A;  5H2M A;  3EH4 B;  5BR2 A;  3UON A;  5A8E A;  4JR8 A;  2KS9 A;  5G53 A;  1JFP A;  4HYX A;  2YDV A;  5H2L A;  3EH3 B;  1BRR A;  1BRD A;  4G72 B;  1KG8 A;  5AHZ A;  3UTW A;  3OE8 A;  3DQB A;  4UG2 A;  3UZA A;  3UTX A;  3CAP A;  4G71 B;  5A44 A;  3X3B A;  1C8R A;  5H2K A;  1MGY A;  1GZM A;  5G2A A;  5H2J A;  3NSB A;  4L35 A;  4MBS A;  1VJM A;  3DDL A;  4BVN A;  4Y9H A;  2AT9 A;  5J7A A;  1R84 A;  3ZPR A;  5B6V A;  3NS0 A;  1PXS A;  5JJE A;  3UZC A;  3P0G A;  2X72 A;  4XTL A;  1IW9 A;  1QM8 A;  4XT1 A;  2NTW A;  3VG9 A;  3QBI A;  5ITE A;  3C9L A;  1S51 A;  3QJS B;  3NYA A;  1P8I A;  5AX1 A;  1BRX A;  5H2O A;  5C1M A;  3QBK A;  3V2Y A;  3QAK A;  2R4R A;  4FA7 B;  4K5Y A;  2F95 A;  3QJR B;  3QJV B;  4XTN A;  3V2W A;  5B0W A;  1UAZ A;  4AMJ A;  4BEZ A;  3WQJ A;  3HAO A;  5DHG A;  2YDO A;  1EHK B;  2NTU A;  3T45 A;  1C8S A;  4G7Q B;  4X1H A;  2Z73 A;  3PQR A;  3PXO A;  5G2C A;  1JV7 A;  4G70 B;  1R2N A;  3BVD B;  5G2D A;  4NC3 A;  4PXK A;  3ZEV A;  5KKH A;  1VGO A;  4UHR A;  3A7K A;  3QJQ B;  2KSA A;  4BV0 A;  2I1X A;  3QAP A;  1S8L A;  5B35 A;  1KGB A;  5H2I A;  1Q5J A;  3HAN A;  1KG9 A;  4IB4 A;  4BWB A;  1QKP A;  4EJ4 A;  1H68 A;  1XME B;  1GU8 A;  3AM6 A;  2Y03 A;  1JGJ A;  4X32 A;  4DKL A;  2Y02 A;  5JJN A;  3OAX A;  2EI4 A;  3QDC A;  4N6H A;  2WJL A;  2M3G A;  2ZIY A;  3OE6 A;  4G7S B;  3S8F B;  4FAA B;  1U19 A;  1F4Z A;  4MD1 A;  1P8U A;  2F93 A;  2YCZ A;  3HAR A;  4XTO A;  5DYS A;  2I20 A;  5AHY A;  1KME A;  5H2P A;  3UTV A;  1GUE A;  4GYC A;  4GBR A;  4DS7 E;  4KNF A;  5BR5 A;  2YCX A;  4XXJ A;  2Y04 A;  3VVK A;  4FPD A;  4JKV A;  1HZX A;  3RZE A;  4MD2 A;  4QI1 A;  4AMI A;  4L6R A;  2HPY A;  4XT3 A;  1XJI A;  3REY A;  1LN6 A;  4MQS A;  2ZZL A;  4N4Y B;  1H2S A;  4TL3 A;  1F88 A;  1L0M A;  2JAF A;  3QJU B;  5LWE A;  3UTY A;  2VT4 A;  2Z55 A;  4EA3 A;  4N4W A;  1S54 A;  4BUO A;  1X0S A; 
#chains in the Genus database with same CATH homology
 3PBL A;  1P8H A;  3C9M A;  2L6X A;  2QPD B;  1S53 A;  4BEY A;  4IAR A;  3QBG A;  2ZFE A;  4JQ6 A;  2J4Y A;  1S52 A;  1X0K 1;  1Q5I A;  1X0I 1;  5H2N A;  3COD A;  3MBV A;  4KLY A;  3EH5 B;  5TGZ A;  3AYM A;  2RH1 A;  4MQT A;  1PXR A;  2I35 A;  5AZD A;  5G28 A;  4EIY A;  4GP5 B;  5B2N A;  5A45 A;  4FBZ A;  3OE9 A;  1AP9 A;  2Y01 A;  3D4S A;  5B6Z A;  3QJT B;  3UG9 A;  1IXF A;  1C3W A;  4DAJ A;  1JV6 A;  1O0A A;  3OE0 A;  1TN0 A;  1QHJ A;  2KSY A;  2BRD A;  4QID A;  5AX0 A;  3VW7 A;  3AYN A;  3NY9 A;  4GRV A;  2R4S A;  4PXF A;  4GP4 B;  1FBK A;  4X31 A;  1E0P A;  5ITC A;  1FBB A;  3S3B B;  2QPE B;  3PDS A;  5F8U A;  3S3C B;  2WJK A;  4WW3 A;  3PWH A;  2PED A;  4GP8 B;  5B6W A;  5G36 A;  2YCY A;  1TN5 A;  4HWL A;  3VI0 A;  1M0M A;  1DZE A;  3HAS A;  2LNL A;  1QKO A;  3VGA A;  3KJ6 A;  2KSB A;  5B34 A;  4LDL A;  4HYJ A;  4GPO A;  4LDE A;  4WAV A;  1CWQ A;  3NY8 A;  3S8G B;  2G87 A;  2I21 A;  4QRY A;  5B6Y A;  1M0K A;  3QBL A;  3RFM A;  1S8J A;  2JAG A;  5EN0 A;  4G7R B;  3ZPQ A;  4IAQ A;  2Y00 A;  1IW6 A;  1M0L A;  1UCQ A;  3ODU A;  5FJG A;  3VHZ A;  5H2H A;  3SN6 R;  3HAQ A;  1PY6 A;  4DJH A;  4J4Q A;  3ABW A;  1E12 A;  4OV0 A;  3COC A;  5G54 A;  4A4M A;  2YCW A;  1XIO A;  5B6X A;  1BM1 A;  5AWZ A;  5JJJ A;  3EML A;  5ETZ A;  1L9H A;  3S3D B;  3HAP A;  3X3C A;  1AT9 A;  4LDO A;  5DHH A;  1F50 A;  5H2M A;  3EH4 B;  5BR2 A;  3UON A;  5A8E A;  4JR8 A;  2KS9 A;  5G53 A;  1JFP A;  4HYX A;  2YDV A;  5H2L A;  3EH3 B;  1BRR A;  1BRD A;  4G72 B;  1KG8 A;  5AHZ A;  3UTW A;  3OE8 A;  3DQB A;  4UG2 A;  3UZA A;  3UTX A;  3CAP A;  4G71 B;  5A44 A;  3X3B A;  1C8R A;  5H2K A;  1MGY A;  1GZM A;  5G2A A;  5H2J A;  3NSB A;  4L35 A;  4MBS A;  1VJM A;  3DDL A;  4BVN A;  4Y9H A;  2AT9 A;  5J7A A;  1R84 A;  3ZPR A;  5B6V A;  3NS0 A;  1PXS A;  5JJE A;  3UZC A;  3P0G A;  2X72 A;  4XTL A;  1IW9 A;  1QM8 A;  4XT1 A;  2NTW A;  3VG9 A;  3QBI A;  5ITE A;  3C9L A;  1S51 A;  3QJS B;  3NYA A;  1P8I A;  5AX1 A;  1BRX A;  5H2O A;  5C1M A;  3QBK A;  3V2Y A;  3QAK A;  2R4R A;  4FA7 B;  4K5Y A;  2F95 A;  3QJR B;  3QJV B;  4XTN A;  3V2W A;  5B0W A;  1UAZ A;  4AMJ A;  4BEZ A;  3WQJ A;  3HAO A;  5DHG A;  2YDO A;  1EHK B;  2NTU A;  3T45 A;  1C8S A;  4G7Q B;  4X1H A;  2Z73 A;  3PQR A;  3PXO A;  5G2C A;  1JV7 A;  4G70 B;  1R2N A;  3BVD B;  5G2D A;  4NC3 A;  4PXK A;  3ZEV A;  5KKH A;  1VGO A;  4UHR A;  3A7K A;  3QJQ B;  2KSA A;  4BV0 A;  2I1X A;  3QAP A;  1S8L A;  5B35 A;  1KGB A;  5H2I A;  1Q5J A;  3HAN A;  1KG9 A;  4IB4 A;  4BWB A;  1QKP A;  4EJ4 A;  1H68 A;  1XME B;  1GU8 A;  3AM6 A;  2Y03 A;  1JGJ A;  4X32 A;  4DKL A;  2Y02 A;  5JJN A;  3OAX A;  2EI4 A;  3QDC A;  4N6H A;  2WJL A;  2M3G A;  2ZIY A;  3OE6 A;  4G7S B;  3S8F B;  4FAA B;  1U19 A;  1F4Z A;  4MD1 A;  1P8U A;  2F93 A;  2YCZ A;  3HAR A;  4XTO A;  5DYS A;  2I20 A;  5AHY A;  1KME A;  5H2P A;  3UTV A;  1GUE A;  4GYC A;  4GBR A;  4DS7 E;  4KNF A;  5BR5 A;  2YCX A;  4XXJ A;  2Y04 A;  3VVK A;  4FPD A;  4JKV A;  1HZX A;  3RZE A;  4MD2 A;  4QI1 A;  4AMI A;  4L6R A;  2HPY A;  4XT3 A;  1XJI A;  3REY A;  1LN6 A;  4MQS A;  2ZZL A;  4N4Y B;  1H2S A;  4TL3 A;  1F88 A;  1L0M A;  2JAF A;  3QJU B;  5LWE A;  3UTY A;  2VT4 A;  2Z55 A;  4EA3 A;  4N4W A;  1S54 A;  4BUO A;  1X0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...