2Y54A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (fragment 1)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 43
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y54A00
3UQ4A 5AFKA 3RQWA 2BYRA 2WNLA 3JAFA 5AFMB 3U8NA 4PIRA 2Y56A 3JAEA 5LXBA 4IL9A 4QH5A 4BFQA 5FJVA 2W8FA 4D01A 4HFIA 5TVCA 5BP0A 3RHWA 2Y54A 2BJ0A 4XHEA 3U8JA 2PGZA 3U8MA 4ZRUA 2VL0A 2BR8A 3LSVA 4QABA 4ZR6A 4TNVA 3RIAA 3WTIA 3WTNA 2X00D 4ZZBA 4B5DA 4ZJSA 3TLSA 5J5IA 5J0ZA 2PH9A 3T4MA 4DBMA 4NPPA 2BYSA 2BG9C 2XQ4A 5AFMA 4TWDA 2WNJA 2UZ6A 2XZ5A 3C84A 4A98A 2QC1B 2XQ8A 4TWFA 2BR7A 2Y7YA 2BYQA 3RIFA 3PMZA 4HFBA 4HFEA 3JADA 4NZBA 2XQ6A 3GUAA 4IL4A 4Z90A 5J5FA 2BYNA 3EI0A 1I9BA 2YOEA 4F8HA 3WTLA 4A97A 2YMEA 2XYSA 3UU5A 2W8GA 4UXUA 3WTHA 4HFCA 5AINA 5J5GA 1UV6A 4IREA 3RQUA 3TLUA 4AFHA 5HEUA 3WTMA 4ALXA 4XK9A 4Z91A 5CFBA 4UY2A 5SYOA 2X00A 3WTJA 2Y57A 3U8KA 4BQTA 5L4EA 4EZ1A 4FRRA 2YKSA 5IUXA 2XQ9A 1UW6A 3ZDHA 4WV9A 5AFJA 4ZK4A 3WTOA 5AFHA 3PEOA 2XQ7A 3P4WA 5HCMA 5AFLA 3ZDGA 4UM3P 4LMLA 3P50A 4COFA 3C79A 3UQ7A 5BW2A 4X5TA 4QH4A 5KZUA 2BG9B 5BRXA 5L4HA 4TNWA 3UU8A 5HCJA 4HQPA 3WIPA 5JMEA 3WTKA 4HFHA 3ZKRA 3RI5A 5HEHA 5J5HA 2XNUA 4ILBA 4QACA 5LG3A 2BG9A 3TLWA 2XZ6A 5CO5A 5L47A 5AFNA 4LMKA 2C9TA 3TLTA 2XQ5A 2WZYA 3IGQA 3SH1A 3SIOA 3UU6A 4AFGA 3SQ9A 4ILCA 3TLVA 4HFDA 2XQ3A 4AFTA 3UU3A 2XQAA 4UM1A 2ZJUA 2XNVA 2YMDA 4ZZCA 2WNCA 4UM3S 2XYTA 2XNTA 4UM3A 2Y58A 3UU4A 2WN9A 3EAMA 5KE4A 4ZK1A 3U8LA 3SQ6A 3EHZA 1UX2A 4LMJA 2BYPA 5HEGA 5HEJA 3UUBA 4QH1A 4QAAA 4ZJTA 4TWHA 4ILAA 2YN6A 2ZJVA 5HEOA 2BG9E
chains in the Genus database with same CATH superfamily
3UQ4A 5AFKA 3RQWA 2BYRA 2WNLA 3JAFA 5AFMB 3U8NA 4PIRA 2Y56A 3JAEA 5LXBA 4IL9A 4QH5A 4BFQA 5FJVA 2W8FA 4D01A 4HFIA 5TVCA 5BP0A 3RHWA 2Y54A 2BJ0A 4XHEA 3U8JA 2PGZA 3U8MA 4ZRUA 2VL0A 2BR8A 3LSVA 4QABA 4ZR6A 4TNVA 3RIAA 3WTIA 3WTNA 2X00D 4ZZBA 4B5DA 4ZJSA 3TLSA 5J5IA 5J0ZA 2PH9A 3T4MA 4DBMA 4NPPA 2BYSA 2BG9C 2XQ4A 5AFMA 4TWDA 2WNJA 2UZ6A 2XZ5A 3C84A 4A98A 2QC1B 2XQ8A 4TWFA 2BR7A 2Y7YA 2BYQA 3RIFA 3PMZA 4HFBA 4HFEA 3JADA 4NZBA 2XQ6A 3GUAA 4IL4A 4Z90A 5J5FA 2BYNA 3EI0A 1I9BA 2YOEA 4F8HA 3WTLA 4A97A 2YMEA 2XYSA 3UU5A 2W8GA 4UXUA 3WTHA 4HFCA 5AINA 5J5GA 1UV6A 4IREA 3RQUA 3TLUA 4AFHA 5HEUA 3WTMA 4ALXA 4XK9A 4Z91A 5CFBA 4UY2A 5SYOA 2X00A 3WTJA 2Y57A 3U8KA 4BQTA 5L4EA 4EZ1A 4FRRA 2YKSA 5IUXA 2XQ9A 1UW6A 3ZDHA 4WV9A 5AFJA 4ZK4A 3WTOA 5AFHA 3PEOA 2XQ7A 3P4WA 5HCMA 5AFLA 3ZDGA 4UM3P 4LMLA 3P50A 4COFA 3C79A 3UQ7A 5BW2A 4X5TA 4QH4A 5KZUA 2BG9B 5BRXA 5L4HA 4TNWA 3UU8A 5HCJA 4HQPA 3WIPA 5JMEA 3WTKA 4HFHA 3ZKRA 3RI5A 5HEHA 5J5HA 2XNUA 4ILBA 4QACA 5LG3A 2BG9A 3TLWA 2XZ6A 5CO5A 5L47A 5AFNA 4LMKA 2C9TA 3TLTA 2XQ5A 2WZYA 3IGQA 3SH1A 3SIOA 3UU6A 4AFGA 3SQ9A 4ILCA 3TLVA 4HFDA 2XQ3A 4AFTA 3UU3A 2XQAA 4UM1A 2ZJUA 2XNVA 2YMDA 4ZZCA 2WNCA 4UM3S 2XYTA 2XNTA 4UM3A 2Y58A 3UU4A 2WN9A 3EAMA 5KE4A 4ZK1A 3U8LA 3SQ6A 3EHZA 1UX2A 4LMJA 2BYPA 5HEGA 5HEJA 3UUBA 4QH1A 4QAAA 4ZJTA 4TWHA 4ILAA 2YN6A 2ZJVA 5HEOA 2BG9E
chains in the Genus database with same CATH topology
3UQ4A 5AFKA 3RQWA 2BYRA 2WNLA 3JAFA 5AFMB 3U8NA 4PIRA 2Y56A 3JAEA 5LXBA 4IL9A 4QH5A 4BFQA 5FJVA 2W8FA 4D01A 4HFIA 5TVCA 5BP0A 3RHWA 2Y54A 2BJ0A 4XHEA 3U8JA 2PGZA 3U8MA 4ZRUA 2VL0A 2BR8A 3LSVA 4QABA 4ZR6A 4TNVA 3RIAA 3WTIA 3WTNA 2X00D 4ZZBA 4B5DA 4ZJSA 3TLSA 5J5IA 5J0ZA 2PH9A 3T4MA 4DBMA 4NPPA 2BYSA 2BG9C 2XQ4A 5AFMA 4TWDA 2WNJA 2UZ6A 2XZ5A 3C84A 4A98A 2QC1B 2XQ8A 4TWFA 2BR7A 2Y7YA 2BYQA 3RIFA 3PMZA 4HFBA 4HFEA 3JADA 4NZBA 2XQ6A 3GUAA 4IL4A 4Z90A 5J5FA 2BYNA 3EI0A 1I9BA 2YOEA 4F8HA 3WTLA 4A97A 2YMEA 2XYSA 3UU5A 2W8GA 4UXUA 3WTHA 4HFCA 5AINA 5J5GA 1UV6A 4IREA 3RQUA 3TLUA 4AFHA 5HEUA 3WTMA 4ALXA 4XK9A 4Z91A 5CFBA 4UY2A 5SYOA 2X00A 3WTJA 2Y57A 3U8KA 4BQTA 5L4EA 4EZ1A 4FRRA 2YKSA 5IUXA 2XQ9A 1UW6A 3ZDHA 4WV9A 5AFJA 4ZK4A 3WTOA 5AFHA 3PEOA 2XQ7A 3P4WA 5HCMA 5AFLA 3ZDGA 4UM3P 4LMLA 3P50A 4COFA 3C79A 3UQ7A 5BW2A 4X5TA 4QH4A 5KZUA 2BG9B 5BRXA 5L4HA 4TNWA 3UU8A 5HCJA 4HQPA 3WIPA 5JMEA 3WTKA 4HFHA 3ZKRA 3RI5A 5HEHA 5J5HA 2XNUA 4ILBA 4QACA 5LG3A 2BG9A 3TLWA 2XZ6A 5CO5A 5L47A 5AFNA 4LMKA 2C9TA 3TLTA 2XQ5A 2WZYA 3IGQA 3SH1A 3SIOA 3UU6A 4AFGA 3SQ9A 4ILCA 3TLVA 4HFDA 2XQ3A 4AFTA 3UU3A 2XQAA 4UM1A 2ZJUA 2XNVA 2YMDA 4ZZCA 2WNCA 4UM3S 2XYTA 2XNTA 4UM3A 2Y58A 3UU4A 2WN9A 3EAMA 5KE4A 4ZK1A 3U8LA 3SQ6A 3EHZA 1UX2A 4LMJA 2BYPA 5HEGA 5HEJA 3UUBA 4QH1A 4QAAA 4ZJTA 4TWHA 4ILAA 2YN6A 2ZJVA 5HEOA 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ4 A;  5AFK A;  3RQW A;  2BYR A;  2WNL A;  3JAF A;  5AFM B;  3U8N A;  4PIR A;  2Y56 A;  3JAE A;  5LXB A;  4IL9 A;  4QH5 A;  4BFQ A;  5FJV A;  2W8F A;  4D01 A;  4HFI A;  5TVC A;  5BP0 A;  3RHW A;  2Y54 A;  2BJ0 A;  4XHE A;  3U8J A;  2PGZ A;  3U8M A;  4ZRU A;  2VL0 A;  2BR8 A;  3LSV A;  4QAB A;  4ZR6 A;  4TNV A;  3RIA A;  3WTI A;  3WTN A;  2X00 D;  4ZZB A;  4B5D A;  4ZJS A;  3TLS A;  5J5I A;  5J0Z A;  2PH9 A;  3T4M A;  4DBM A;  4NPP A;  2BYS A;  2BG9 C;  2XQ4 A;  5AFM A;  4TWD A;  2WNJ A;  2UZ6 A;  2XZ5 A;  3C84 A;  4A98 A;  2QC1 B;  2XQ8 A;  4TWF A;  2BR7 A;  2Y7Y A;  2BYQ A;  3RIF A;  3PMZ A;  4HFB A;  4HFE A;  3JAD A;  4NZB A;  2XQ6 A;  3GUA A;  4IL4 A;  4Z90 A;  5J5F A;  2BYN A;  3EI0 A;  1I9B A;  2YOE A;  4F8H A;  3WTL A;  4A97 A;  2YME A;  2XYS A;  3UU5 A;  2W8G A;  4UXU A;  3WTH A;  4HFC A;  5AIN A;  5J5G A;  1UV6 A;  4IRE A;  3RQU A;  3TLU A;  4AFH A;  5HEU A;  3WTM A;  4ALX A;  4XK9 A;  4Z91 A;  5CFB A;  4UY2 A;  5SYO A;  2X00 A;  3WTJ A;  2Y57 A;  3U8K A;  4BQT A;  5L4E A;  4EZ1 A;  4FRR A;  2YKS A;  5IUX A;  2XQ9 A;  1UW6 A;  3ZDH A;  4WV9 A;  5AFJ A;  4ZK4 A;  3WTO A;  5AFH A;  3PEO A;  2XQ7 A;  3P4W A;  5HCM A;  5AFL A;  3ZDG A;  4UM3 P;  4LML A;  3P50 A;  4COF A;  3C79 A;  3UQ7 A;  5BW2 A;  4X5T A;  4QH4 A;  5KZU A;  2BG9 B;  5BRX A;  5L4H A;  4TNW A;  3UU8 A;  5HCJ A;  4HQP A;  3WIP A;  5JME A;  3WTK A;  4HFH A;  3ZKR A;  3RI5 A;  5HEH A;  5J5H A;  2XNU A;  4ILB A;  4QAC A;  5LG3 A;  2BG9 A;  3TLW A;  2XZ6 A;  5CO5 A;  5L47 A;  5AFN A;  4LMK A;  2C9T A;  3TLT A;  2XQ5 A;  2WZY A;  3IGQ A;  3SH1 A;  3SIO A;  3UU6 A;  4AFG A;  3SQ9 A;  4ILC A;  3TLV A;  4HFD A;  2XQ3 A;  4AFT A;  3UU3 A;  2XQA A;  4UM1 A;  2ZJU A;  2XNV A;  2YMD A;  4ZZC A;  2WNC A;  4UM3 S;  2XYT A;  2XNT A;  4UM3 A;  2Y58 A;  3UU4 A;  2WN9 A;  3EAM A;  5KE4 A;  4ZK1 A;  3U8L A;  3SQ6 A;  3EHZ A;  1UX2 A;  4LMJ A;  2BYP A;  5HEG A;  5HEJ A;  3UUB A;  4QH1 A;  4QAA A;  4ZJT A;  4TWH A;  4ILA A;  2YN6 A;  2ZJV A;  5HEO A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 3UQ4 A;  5AFK A;  3RQW A;  2BYR A;  2WNL A;  3JAF A;  5AFM B;  3U8N A;  4PIR A;  2Y56 A;  3JAE A;  5LXB A;  4IL9 A;  4QH5 A;  4BFQ A;  5FJV A;  2W8F A;  4D01 A;  4HFI A;  5TVC A;  5BP0 A;  3RHW A;  2Y54 A;  2BJ0 A;  4XHE A;  3U8J A;  2PGZ A;  3U8M A;  4ZRU A;  2VL0 A;  2BR8 A;  3LSV A;  4QAB A;  4ZR6 A;  4TNV A;  3RIA A;  3WTI A;  3WTN A;  2X00 D;  4ZZB A;  4B5D A;  4ZJS A;  3TLS A;  5J5I A;  5J0Z A;  2PH9 A;  3T4M A;  4DBM A;  4NPP A;  2BYS A;  2BG9 C;  2XQ4 A;  5AFM A;  4TWD A;  2WNJ A;  2UZ6 A;  2XZ5 A;  3C84 A;  4A98 A;  2QC1 B;  2XQ8 A;  4TWF A;  2BR7 A;  2Y7Y A;  2BYQ A;  3RIF A;  3PMZ A;  4HFB A;  4HFE A;  3JAD A;  4NZB A;  2XQ6 A;  3GUA A;  4IL4 A;  4Z90 A;  5J5F A;  2BYN A;  3EI0 A;  1I9B A;  2YOE A;  4F8H A;  3WTL A;  4A97 A;  2YME A;  2XYS A;  3UU5 A;  2W8G A;  4UXU A;  3WTH A;  4HFC A;  5AIN A;  5J5G A;  1UV6 A;  4IRE A;  3RQU A;  3TLU A;  4AFH A;  5HEU A;  3WTM A;  4ALX A;  4XK9 A;  4Z91 A;  5CFB A;  4UY2 A;  5SYO A;  2X00 A;  3WTJ A;  2Y57 A;  3U8K A;  4BQT A;  5L4E A;  4EZ1 A;  4FRR A;  2YKS A;  5IUX A;  2XQ9 A;  1UW6 A;  3ZDH A;  4WV9 A;  5AFJ A;  4ZK4 A;  3WTO A;  5AFH A;  3PEO A;  2XQ7 A;  3P4W A;  5HCM A;  5AFL A;  3ZDG A;  4UM3 P;  4LML A;  3P50 A;  4COF A;  3C79 A;  3UQ7 A;  5BW2 A;  4X5T A;  4QH4 A;  5KZU A;  2BG9 B;  5BRX A;  5L4H A;  4TNW A;  3UU8 A;  5HCJ A;  4HQP A;  3WIP A;  5JME A;  3WTK A;  4HFH A;  3ZKR A;  3RI5 A;  5HEH A;  5J5H A;  2XNU A;  4ILB A;  4QAC A;  5LG3 A;  2BG9 A;  3TLW A;  2XZ6 A;  5CO5 A;  5L47 A;  5AFN A;  4LMK A;  2C9T A;  3TLT A;  2XQ5 A;  2WZY A;  3IGQ A;  3SH1 A;  3SIO A;  3UU6 A;  4AFG A;  3SQ9 A;  4ILC A;  3TLV A;  4HFD A;  2XQ3 A;  4AFT A;  3UU3 A;  2XQA A;  4UM1 A;  2ZJU A;  2XNV A;  2YMD A;  4ZZC A;  2WNC A;  4UM3 S;  2XYT A;  2XNT A;  4UM3 A;  2Y58 A;  3UU4 A;  2WN9 A;  3EAM A;  5KE4 A;  4ZK1 A;  3U8L A;  3SQ6 A;  3EHZ A;  1UX2 A;  4LMJ A;  2BYP A;  5HEG A;  5HEJ A;  3UUB A;  4QH1 A;  4QAA A;  4ZJT A;  4TWH A;  4ILA A;  2YN6 A;  2ZJV A;  5HEO A;  2BG9 E; 
#chains in the Genus database with same CATH homology
 3UQ4 A;  5AFK A;  3RQW A;  2BYR A;  2WNL A;  3JAF A;  5AFM B;  3U8N A;  4PIR A;  2Y56 A;  3JAE A;  5LXB A;  4IL9 A;  4QH5 A;  4BFQ A;  5FJV A;  2W8F A;  4D01 A;  4HFI A;  5TVC A;  5BP0 A;  3RHW A;  2Y54 A;  2BJ0 A;  4XHE A;  3U8J A;  2PGZ A;  3U8M A;  4ZRU A;  2VL0 A;  2BR8 A;  3LSV A;  4QAB A;  4ZR6 A;  4TNV A;  3RIA A;  3WTI A;  3WTN A;  2X00 D;  4ZZB A;  4B5D A;  4ZJS A;  3TLS A;  5J5I A;  5J0Z A;  2PH9 A;  3T4M A;  4DBM A;  4NPP A;  2BYS A;  2BG9 C;  2XQ4 A;  5AFM A;  4TWD A;  2WNJ A;  2UZ6 A;  2XZ5 A;  3C84 A;  4A98 A;  2QC1 B;  2XQ8 A;  4TWF A;  2BR7 A;  2Y7Y A;  2BYQ A;  3RIF A;  3PMZ A;  4HFB A;  4HFE A;  3JAD A;  4NZB A;  2XQ6 A;  3GUA A;  4IL4 A;  4Z90 A;  5J5F A;  2BYN A;  3EI0 A;  1I9B A;  2YOE A;  4F8H A;  3WTL A;  4A97 A;  2YME A;  2XYS A;  3UU5 A;  2W8G A;  4UXU A;  3WTH A;  4HFC A;  5AIN A;  5J5G A;  1UV6 A;  4IRE A;  3RQU A;  3TLU A;  4AFH A;  5HEU A;  3WTM A;  4ALX A;  4XK9 A;  4Z91 A;  5CFB A;  4UY2 A;  5SYO A;  2X00 A;  3WTJ A;  2Y57 A;  3U8K A;  4BQT A;  5L4E A;  4EZ1 A;  4FRR A;  2YKS A;  5IUX A;  2XQ9 A;  1UW6 A;  3ZDH A;  4WV9 A;  5AFJ A;  4ZK4 A;  3WTO A;  5AFH A;  3PEO A;  2XQ7 A;  3P4W A;  5HCM A;  5AFL A;  3ZDG A;  4UM3 P;  4LML A;  3P50 A;  4COF A;  3C79 A;  3UQ7 A;  5BW2 A;  4X5T A;  4QH4 A;  5KZU A;  2BG9 B;  5BRX A;  5L4H A;  4TNW A;  3UU8 A;  5HCJ A;  4HQP A;  3WIP A;  5JME A;  3WTK A;  4HFH A;  3ZKR A;  3RI5 A;  5HEH A;  5J5H A;  2XNU A;  4ILB A;  4QAC A;  5LG3 A;  2BG9 A;  3TLW A;  2XZ6 A;  5CO5 A;  5L47 A;  5AFN A;  4LMK A;  2C9T A;  3TLT A;  2XQ5 A;  2WZY A;  3IGQ A;  3SH1 A;  3SIO A;  3UU6 A;  4AFG A;  3SQ9 A;  4ILC A;  3TLV A;  4HFD A;  2XQ3 A;  4AFT A;  3UU3 A;  2XQA A;  4UM1 A;  2ZJU A;  2XNV A;  2YMD A;  4ZZC A;  2WNC A;  4UM3 S;  2XYT A;  2XNT A;  4UM3 A;  2Y58 A;  3UU4 A;  2WN9 A;  3EAM A;  5KE4 A;  4ZK1 A;  3U8L A;  3SQ6 A;  3EHZ A;  1UX2 A;  4LMJ A;  2BYP A;  5HEG A;  5HEJ A;  3UUB A;  4QH1 A;  4QAA A;  4ZJT A;  4TWH A;  4ILA A;  2YN6 A;  2ZJV A;  5HEO A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...