2Y57A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 44
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y57A00
4ZK1A 5AFMB 3WTLA 2C9TA 2BJ0A 3TLVA 4HFIA 5HCMA 3U8JA 3RHWA 4QACA 3UUBA 3RIFA 2X00A 4F8HA 3C84A 3SH1A 2Y7YA 3GUAA 2X00D 4BFQA 3EAMA 2BG9C 3P4WA 2BG9A 4LMLA 3U8LA 4AFGA 4EZ1A 3UU6A 5HEGA 3TLUA 3EHZA 5KE4A 2ZJVA 5HEHA 2XNTA 2ZJUA 4QABA 2BR7A 3EI0A 2W8FA 3RI5A 3WTKA 5J5FA 1UW6A 5KZUA 5LXBA 4IL4A 3WTNA 5AFKA 2PGZA 4TWDA 4QAAA 5FJVA 4QH4A 3RIAA 2XQ6A 5IUXA 4XK9A 2XNUA 3TLWA 4FRRA 4UM3P 2XZ6A 3P50A 5HEUA 3LSVA 2WZYA 5SYOA 3WTJA 5CFBA 1UV6A 3UU5A 1I9BA 4LMJA 3T4MA 3UU8A 5LG3A 4TWHA 4IL9A 3UQ4A 2BYSA 4HFDA 5CO5A 4Z90A 2YOEA 3JADA 4HFCA 4ZRUA 4ILBA 4ZZCA 4DBMA 4HFHA 4X5TA 2WN9A 4TWFA 2UZ6A 2BYPA 4NZBA 2YKSA 3SIOA 3UU4A 4HFEA 2BYNA 3C79A 2BG9B 3U8NA 3RQWA 2BYRA 4ZZBA 3U8KA 2PH9A 5BRXA 4ZK4A 2QC1B 2XQ3A 2XQ5A 4Z91A 4AFHA 3JAFA 5L4EA 5AFLA 4UY2A 4UM3S 4NPPA 3TLSA 2Y56A 4B5DA 4HQPA 2BYQA 3PMZA 5HEOA 2XQAA 2VL0A 2BG9E 3SQ6A 2XQ8A 3JAEA 5AINA 5JMEA 5AFJA 4A97A 5AFMA 2YMDA 4QH1A 5TVCA 5HCJA 5HEJA 3ZDGA 2XNVA 5AFNA 4PIRA 2BR8A 2XYTA 3RQUA 5BW2A 5BP0A 4TNWA 3ZDHA 5J0ZA 3ZKRA 2XQ7A 3IGQA 3U8MA 3WTHA 4UM1A 4ILAA 4BQTA 4IREA 3TLTA 5L47A 4UM3A 4ZR6A 4ZJSA 4ZJTA 2WNCA 3SQ9A 4COFA 4XHEA 3WTOA 2XQ4A 3WTMA 2XZ5A 4UXUA 3WIPA 4WV9A 5L4HA 4TNVA 5AFHA 2XQ9A 1UX2A 2Y58A 2YMEA 2W8GA 4A98A 4AFTA 3UU3A 2XYSA 4HFBA 4ALXA 2WNLA 4LMKA 3UQ7A 5J5GA 2WNJA 4QH5A 4D01A 3PEOA 2Y57A 5J5IA 3WTIA 2YN6A 2Y54A 4ILCA 5J5HA
chains in the Genus database with same CATH superfamily
4ZK1A 5AFMB 3WTLA 2C9TA 2BJ0A 3TLVA 4HFIA 5HCMA 3U8JA 3RHWA 4QACA 3UUBA 3RIFA 2X00A 4F8HA 3C84A 3SH1A 2Y7YA 3GUAA 2X00D 4BFQA 3EAMA 2BG9C 3P4WA 2BG9A 4LMLA 3U8LA 4AFGA 4EZ1A 3UU6A 5HEGA 3TLUA 3EHZA 5KE4A 2ZJVA 5HEHA 2XNTA 2ZJUA 4QABA 2BR7A 3EI0A 2W8FA 3RI5A 3WTKA 5J5FA 1UW6A 5KZUA 5LXBA 4IL4A 3WTNA 5AFKA 2PGZA 4TWDA 4QAAA 5FJVA 4QH4A 3RIAA 2XQ6A 5IUXA 4XK9A 2XNUA 3TLWA 4FRRA 4UM3P 2XZ6A 3P50A 5HEUA 3LSVA 2WZYA 5SYOA 3WTJA 5CFBA 1UV6A 3UU5A 1I9BA 4LMJA 3T4MA 3UU8A 5LG3A 4TWHA 4IL9A 3UQ4A 2BYSA 4HFDA 5CO5A 4Z90A 2YOEA 3JADA 4HFCA 4ZRUA 4ILBA 4ZZCA 4DBMA 4HFHA 4X5TA 2WN9A 4TWFA 2UZ6A 2BYPA 4NZBA 2YKSA 3SIOA 3UU4A 4HFEA 2BYNA 3C79A 2BG9B 3U8NA 3RQWA 2BYRA 4ZZBA 3U8KA 2PH9A 5BRXA 4ZK4A 2QC1B 2XQ3A 2XQ5A 4Z91A 4AFHA 3JAFA 5L4EA 5AFLA 4UY2A 4UM3S 4NPPA 3TLSA 2Y56A 4B5DA 4HQPA 2BYQA 3PMZA 5HEOA 2XQAA 2VL0A 2BG9E 3SQ6A 2XQ8A 3JAEA 5AINA 5JMEA 5AFJA 4A97A 5AFMA 2YMDA 4QH1A 5TVCA 5HCJA 5HEJA 3ZDGA 2XNVA 5AFNA 4PIRA 2BR8A 2XYTA 3RQUA 5BW2A 5BP0A 4TNWA 3ZDHA 5J0ZA 3ZKRA 2XQ7A 3IGQA 3U8MA 3WTHA 4UM1A 4ILAA 4BQTA 4IREA 3TLTA 5L47A 4UM3A 4ZR6A 4ZJSA 4ZJTA 2WNCA 3SQ9A 4COFA 4XHEA 3WTOA 2XQ4A 3WTMA 2XZ5A 4UXUA 3WIPA 4WV9A 5L4HA 4TNVA 5AFHA 2XQ9A 1UX2A 2Y58A 2YMEA 2W8GA 4A98A 4AFTA 3UU3A 2XYSA 4HFBA 4ALXA 2WNLA 4LMKA 3UQ7A 5J5GA 2WNJA 4QH5A 4D01A 3PEOA 2Y57A 5J5IA 3WTIA 2YN6A 2Y54A 4ILCA 5J5HA
chains in the Genus database with same CATH topology
4ZK1A 5AFMB 3WTLA 2C9TA 2BJ0A 3TLVA 4HFIA 5HCMA 3U8JA 3RHWA 4QACA 3UUBA 3RIFA 2X00A 4F8HA 3C84A 3SH1A 2Y7YA 3GUAA 2X00D 4BFQA 3EAMA 2BG9C 3P4WA 2BG9A 4LMLA 3U8LA 4AFGA 4EZ1A 3UU6A 5HEGA 3TLUA 3EHZA 5KE4A 2ZJVA 5HEHA 2XNTA 2ZJUA 4QABA 2BR7A 3EI0A 2W8FA 3RI5A 3WTKA 5J5FA 1UW6A 5KZUA 5LXBA 4IL4A 3WTNA 5AFKA 2PGZA 4TWDA 4QAAA 5FJVA 4QH4A 3RIAA 2XQ6A 5IUXA 4XK9A 2XNUA 3TLWA 4FRRA 4UM3P 2XZ6A 3P50A 5HEUA 3LSVA 2WZYA 5SYOA 3WTJA 5CFBA 1UV6A 3UU5A 1I9BA 4LMJA 3T4MA 3UU8A 5LG3A 4TWHA 4IL9A 3UQ4A 2BYSA 4HFDA 5CO5A 4Z90A 2YOEA 3JADA 4HFCA 4ZRUA 4ILBA 4ZZCA 4DBMA 4HFHA 4X5TA 2WN9A 4TWFA 2UZ6A 2BYPA 4NZBA 2YKSA 3SIOA 3UU4A 4HFEA 2BYNA 3C79A 2BG9B 3U8NA 3RQWA 2BYRA 4ZZBA 3U8KA 2PH9A 5BRXA 4ZK4A 2QC1B 2XQ3A 2XQ5A 4Z91A 4AFHA 3JAFA 5L4EA 5AFLA 4UY2A 4UM3S 4NPPA 3TLSA 2Y56A 4B5DA 4HQPA 2BYQA 3PMZA 5HEOA 2XQAA 2VL0A 2BG9E 3SQ6A 2XQ8A 3JAEA 5AINA 5JMEA 5AFJA 4A97A 5AFMA 2YMDA 4QH1A 5TVCA 5HCJA 5HEJA 3ZDGA 2XNVA 5AFNA 4PIRA 2BR8A 2XYTA 3RQUA 5BW2A 5BP0A 4TNWA 3ZDHA 5J0ZA 3ZKRA 2XQ7A 3IGQA 3U8MA 3WTHA 4UM1A 4ILAA 4BQTA 4IREA 3TLTA 5L47A 4UM3A 4ZR6A 4ZJSA 4ZJTA 2WNCA 3SQ9A 4COFA 4XHEA 3WTOA 2XQ4A 3WTMA 2XZ5A 4UXUA 3WIPA 4WV9A 5L4HA 4TNVA 5AFHA 2XQ9A 1UX2A 2Y58A 2YMEA 2W8GA 4A98A 4AFTA 3UU3A 2XYSA 4HFBA 4ALXA 2WNLA 4LMKA 3UQ7A 5J5GA 2WNJA 4QH5A 4D01A 3PEOA 2Y57A 5J5IA 3WTIA 2YN6A 2Y54A 4ILCA 5J5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK1 A;  5AFM B;  3WTL A;  2C9T A;  2BJ0 A;  3TLV A;  4HFI A;  5HCM A;  3U8J A;  3RHW A;  4QAC A;  3UUB A;  3RIF A;  2X00 A;  4F8H A;  3C84 A;  3SH1 A;  2Y7Y A;  3GUA A;  2X00 D;  4BFQ A;  3EAM A;  2BG9 C;  3P4W A;  2BG9 A;  4LML A;  3U8L A;  4AFG A;  4EZ1 A;  3UU6 A;  5HEG A;  3TLU A;  3EHZ A;  5KE4 A;  2ZJV A;  5HEH A;  2XNT A;  2ZJU A;  4QAB A;  2BR7 A;  3EI0 A;  2W8F A;  3RI5 A;  3WTK A;  5J5F A;  1UW6 A;  5KZU A;  5LXB A;  4IL4 A;  3WTN A;  5AFK A;  2PGZ A;  4TWD A;  4QAA A;  5FJV A;  4QH4 A;  3RIA A;  2XQ6 A;  5IUX A;  4XK9 A;  2XNU A;  3TLW A;  4FRR A;  4UM3 P;  2XZ6 A;  3P50 A;  5HEU A;  3LSV A;  2WZY A;  5SYO A;  3WTJ A;  5CFB A;  1UV6 A;  3UU5 A;  1I9B A;  4LMJ A;  3T4M A;  3UU8 A;  5LG3 A;  4TWH A;  4IL9 A;  3UQ4 A;  2BYS A;  4HFD A;  5CO5 A;  4Z90 A;  2YOE A;  3JAD A;  4HFC A;  4ZRU A;  4ILB A;  4ZZC A;  4DBM A;  4HFH A;  4X5T A;  2WN9 A;  4TWF A;  2UZ6 A;  2BYP A;  4NZB A;  2YKS A;  3SIO A;  3UU4 A;  4HFE A;  2BYN A;  3C79 A;  2BG9 B;  3U8N A;  3RQW A;  2BYR A;  4ZZB A;  3U8K A;  2PH9 A;  5BRX A;  4ZK4 A;  2QC1 B;  2XQ3 A;  2XQ5 A;  4Z91 A;  4AFH A;  3JAF A;  5L4E A;  5AFL A;  4UY2 A;  4UM3 S;  4NPP A;  3TLS A;  2Y56 A;  4B5D A;  4HQP A;  2BYQ A;  3PMZ A;  5HEO A;  2XQA A;  2VL0 A;  2BG9 E;  3SQ6 A;  2XQ8 A;  3JAE A;  5AIN A;  5JME A;  5AFJ A;  4A97 A;  5AFM A;  2YMD A;  4QH1 A;  5TVC A;  5HCJ A;  5HEJ A;  3ZDG A;  2XNV A;  5AFN A;  4PIR A;  2BR8 A;  2XYT A;  3RQU A;  5BW2 A;  5BP0 A;  4TNW A;  3ZDH A;  5J0Z A;  3ZKR A;  2XQ7 A;  3IGQ A;  3U8M A;  3WTH A;  4UM1 A;  4ILA A;  4BQT A;  4IRE A;  3TLT A;  5L47 A;  4UM3 A;  4ZR6 A;  4ZJS A;  4ZJT A;  2WNC A;  3SQ9 A;  4COF A;  4XHE A;  3WTO A;  2XQ4 A;  3WTM A;  2XZ5 A;  4UXU A;  3WIP A;  4WV9 A;  5L4H A;  4TNV A;  5AFH A;  2XQ9 A;  1UX2 A;  2Y58 A;  2YME A;  2W8G A;  4A98 A;  4AFT A;  3UU3 A;  2XYS A;  4HFB A;  4ALX A;  2WNL A;  4LMK A;  3UQ7 A;  5J5G A;  2WNJ A;  4QH5 A;  4D01 A;  3PEO A;  2Y57 A;  5J5I A;  3WTI A;  2YN6 A;  2Y54 A;  4ILC A;  5J5H A; 
#chains in the Genus database with same CATH topology
 4ZK1 A;  5AFM B;  3WTL A;  2C9T A;  2BJ0 A;  3TLV A;  4HFI A;  5HCM A;  3U8J A;  3RHW A;  4QAC A;  3UUB A;  3RIF A;  2X00 A;  4F8H A;  3C84 A;  3SH1 A;  2Y7Y A;  3GUA A;  2X00 D;  4BFQ A;  3EAM A;  2BG9 C;  3P4W A;  2BG9 A;  4LML A;  3U8L A;  4AFG A;  4EZ1 A;  3UU6 A;  5HEG A;  3TLU A;  3EHZ A;  5KE4 A;  2ZJV A;  5HEH A;  2XNT A;  2ZJU A;  4QAB A;  2BR7 A;  3EI0 A;  2W8F A;  3RI5 A;  3WTK A;  5J5F A;  1UW6 A;  5KZU A;  5LXB A;  4IL4 A;  3WTN A;  5AFK A;  2PGZ A;  4TWD A;  4QAA A;  5FJV A;  4QH4 A;  3RIA A;  2XQ6 A;  5IUX A;  4XK9 A;  2XNU A;  3TLW A;  4FRR A;  4UM3 P;  2XZ6 A;  3P50 A;  5HEU A;  3LSV A;  2WZY A;  5SYO A;  3WTJ A;  5CFB A;  1UV6 A;  3UU5 A;  1I9B A;  4LMJ A;  3T4M A;  3UU8 A;  5LG3 A;  4TWH A;  4IL9 A;  3UQ4 A;  2BYS A;  4HFD A;  5CO5 A;  4Z90 A;  2YOE A;  3JAD A;  4HFC A;  4ZRU A;  4ILB A;  4ZZC A;  4DBM A;  4HFH A;  4X5T A;  2WN9 A;  4TWF A;  2UZ6 A;  2BYP A;  4NZB A;  2YKS A;  3SIO A;  3UU4 A;  4HFE A;  2BYN A;  3C79 A;  2BG9 B;  3U8N A;  3RQW A;  2BYR A;  4ZZB A;  3U8K A;  2PH9 A;  5BRX A;  4ZK4 A;  2QC1 B;  2XQ3 A;  2XQ5 A;  4Z91 A;  4AFH A;  3JAF A;  5L4E A;  5AFL A;  4UY2 A;  4UM3 S;  4NPP A;  3TLS A;  2Y56 A;  4B5D A;  4HQP A;  2BYQ A;  3PMZ A;  5HEO A;  2XQA A;  2VL0 A;  2BG9 E;  3SQ6 A;  2XQ8 A;  3JAE A;  5AIN A;  5JME A;  5AFJ A;  4A97 A;  5AFM A;  2YMD A;  4QH1 A;  5TVC A;  5HCJ A;  5HEJ A;  3ZDG A;  2XNV A;  5AFN A;  4PIR A;  2BR8 A;  2XYT A;  3RQU A;  5BW2 A;  5BP0 A;  4TNW A;  3ZDH A;  5J0Z A;  3ZKR A;  2XQ7 A;  3IGQ A;  3U8M A;  3WTH A;  4UM1 A;  4ILA A;  4BQT A;  4IRE A;  3TLT A;  5L47 A;  4UM3 A;  4ZR6 A;  4ZJS A;  4ZJT A;  2WNC A;  3SQ9 A;  4COF A;  4XHE A;  3WTO A;  2XQ4 A;  3WTM A;  2XZ5 A;  4UXU A;  3WIP A;  4WV9 A;  5L4H A;  4TNV A;  5AFH A;  2XQ9 A;  1UX2 A;  2Y58 A;  2YME A;  2W8G A;  4A98 A;  4AFT A;  3UU3 A;  2XYS A;  4HFB A;  4ALX A;  2WNL A;  4LMK A;  3UQ7 A;  5J5G A;  2WNJ A;  4QH5 A;  4D01 A;  3PEO A;  2Y57 A;  5J5I A;  3WTI A;  2YN6 A;  2Y54 A;  4ILC A;  5J5H A; 
#chains in the Genus database with same CATH homology
 4ZK1 A;  5AFM B;  3WTL A;  2C9T A;  2BJ0 A;  3TLV A;  4HFI A;  5HCM A;  3U8J A;  3RHW A;  4QAC A;  3UUB A;  3RIF A;  2X00 A;  4F8H A;  3C84 A;  3SH1 A;  2Y7Y A;  3GUA A;  2X00 D;  4BFQ A;  3EAM A;  2BG9 C;  3P4W A;  2BG9 A;  4LML A;  3U8L A;  4AFG A;  4EZ1 A;  3UU6 A;  5HEG A;  3TLU A;  3EHZ A;  5KE4 A;  2ZJV A;  5HEH A;  2XNT A;  2ZJU A;  4QAB A;  2BR7 A;  3EI0 A;  2W8F A;  3RI5 A;  3WTK A;  5J5F A;  1UW6 A;  5KZU A;  5LXB A;  4IL4 A;  3WTN A;  5AFK A;  2PGZ A;  4TWD A;  4QAA A;  5FJV A;  4QH4 A;  3RIA A;  2XQ6 A;  5IUX A;  4XK9 A;  2XNU A;  3TLW A;  4FRR A;  4UM3 P;  2XZ6 A;  3P50 A;  5HEU A;  3LSV A;  2WZY A;  5SYO A;  3WTJ A;  5CFB A;  1UV6 A;  3UU5 A;  1I9B A;  4LMJ A;  3T4M A;  3UU8 A;  5LG3 A;  4TWH A;  4IL9 A;  3UQ4 A;  2BYS A;  4HFD A;  5CO5 A;  4Z90 A;  2YOE A;  3JAD A;  4HFC A;  4ZRU A;  4ILB A;  4ZZC A;  4DBM A;  4HFH A;  4X5T A;  2WN9 A;  4TWF A;  2UZ6 A;  2BYP A;  4NZB A;  2YKS A;  3SIO A;  3UU4 A;  4HFE A;  2BYN A;  3C79 A;  2BG9 B;  3U8N A;  3RQW A;  2BYR A;  4ZZB A;  3U8K A;  2PH9 A;  5BRX A;  4ZK4 A;  2QC1 B;  2XQ3 A;  2XQ5 A;  4Z91 A;  4AFH A;  3JAF A;  5L4E A;  5AFL A;  4UY2 A;  4UM3 S;  4NPP A;  3TLS A;  2Y56 A;  4B5D A;  4HQP A;  2BYQ A;  3PMZ A;  5HEO A;  2XQA A;  2VL0 A;  2BG9 E;  3SQ6 A;  2XQ8 A;  3JAE A;  5AIN A;  5JME A;  5AFJ A;  4A97 A;  5AFM A;  2YMD A;  4QH1 A;  5TVC A;  5HCJ A;  5HEJ A;  3ZDG A;  2XNV A;  5AFN A;  4PIR A;  2BR8 A;  2XYT A;  3RQU A;  5BW2 A;  5BP0 A;  4TNW A;  3ZDH A;  5J0Z A;  3ZKR A;  2XQ7 A;  3IGQ A;  3U8M A;  3WTH A;  4UM1 A;  4ILA A;  4BQT A;  4IRE A;  3TLT A;  5L47 A;  4UM3 A;  4ZR6 A;  4ZJS A;  4ZJT A;  2WNC A;  3SQ9 A;  4COF A;  4XHE A;  3WTO A;  2XQ4 A;  3WTM A;  2XZ5 A;  4UXU A;  3WIP A;  4WV9 A;  5L4H A;  4TNV A;  5AFH A;  2XQ9 A;  1UX2 A;  2Y58 A;  2YME A;  2W8G A;  4A98 A;  4AFT A;  3UU3 A;  2XYS A;  4HFB A;  4ALX A;  2WNL A;  4LMK A;  3UQ7 A;  5J5G A;  2WNJ A;  4QH5 A;  4D01 A;  3PEO A;  2Y57 A;  5J5I A;  3WTI A;  2YN6 A;  2Y54 A;  4ILC A;  5J5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...