2YDVA

Thermostabilised human a2a receptor with neca bound
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
315
Chain Sequence
IMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAISTGFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Agonist-Bound Adenosine A(2A) Receptor Structures Reveal Common Features of Gpcr Activation.
pubmed doi rcsb
molecule keywords ADENOSINE RECEPTOR A2A
molecule tags Receptor
source organism Homo sapiens
total genus 121
structure length 315
sequence length 323
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2ydvA00
4L35A 5AWZA 3S3BB 4KLYA 1QM8A 4BWBA 3PWHA 2L6XA 4XXJA 2HPYA 2LNLA 2I35A 5H2MA 4LDOA 1R2NA 3CAPA 4BUOA 5H2JA 4BV0A 4DKLA 2ZFEA 5H2IA 5G2DA 4JQ6A 3T45A 3VVKA 5BR5A 2YDOA 3QJQB 1FBKA 5H2HA 4LDEA 1C3WA 2YCZA 3UTYA 3NY8A 3QBIA 3CODA 1XMEB 5B6YA 4UHRA 3UZAA 4G70B 4MQSA 1S52A 2KSYA 3RZEA 1BRDA 4Y9HA 4XT1A 3V2YA 3EMLA 3C9LA 3HAQA 4XTOA 5FJGA 3EH3B 2YCXA 3REYA 4K5YA 3PXOA 5H2LA 4J4QA 4A4MA 3DDLA 4IAQA 1IW6A 1F4ZA 1VGOA 2I20A 1IW9A 1L9HA 2X72A 4X1HA 4TL3A 3RFMA 3ZEVA 3HASA 2WJLA 1PXRA 4EA3A 4QI1A 3ZPQA 4WAVA 1GZMA 3A7KA 4XTLA 5AHZA 2M3GA 4AMIA 3VHZA 4LDLA 1HZXA 1S53A 4BVNA 1AP9A 3OAXA 1JV7A 3QJUB 4G71B 3QJRB 5G36A 1GUEA 2Y01A 1F88A 3QBGA 4FPDA 2KSBA 2AT9A 3HANA 2RH1A 4GYCA 2I1XA 1XIOA 5JJEA 5JJNA 4G7SB 2NTWA 1MGYA 3S8GB 1H68A 4QIDA 3UTWA 1X0K1 2Z55A 3UZCA 4JR8A 1TN0A 1QKOA 4KNFA 3ZPRA 5H2PA 5G2AA 3X3BA 4WW3A 3ABWA 4HWLA 1BRXA 5F8UA 3P0GA 5B6ZA 1LN6A 4DJHA 4GPOA 3UG9A 4NC3A 5B6WA 1E0PA 5DYSA 5ITEA 1KG9A 3D4SA 5G2CA 1X0SA 1DZEA 5AX1A 2R4RA 3EH4B 1XJIA 3SN6R 3UONA 5G53A 1S54A 1M0LA 1BRRA 5TGZA 3QBLA 4GRVA 4L6RA 2KS9A 4EIYA 3QJVB 5ITCA 1P8IA 5BR2A 2YCYA 4N4WA 4AMJA 3WQJA 3KJ6A 1Q5JA 2Y04A 4IARA 1UAZA 1JV6A 5A45A 3QDCA 1AT9A 4G72B 2QPEB 3PDSA 1EHKB 5B0WA 2QPDB 1M0MA 1X0I1 3C9MA 1O0AA 5A44A 1TN5A 1UCQA 4MBSA 4BEZA 4JKVA 3S3CB 1L0MA 1H2SA 2BRDA 4GP8B 4IB4A 3VI0A 1P8HA 2G87A 1VJMA 3PBLA 5AZDA 2F95A 5B35A 1R84A 3X3CA 5G54A 3OE8A 5B2NA 5DHHA 4MD1A 2Y02A 4N4YB 5B6XA 4MD2A 3VG9A 2J4YA 3QJSB 5H2OA 4X32A 3EH5B 1KG8A 1PXSA 3QAKA 2KSAA 4EJ4A 1E12A 2EI4A 5H2NA 4FBZA 1C8SA 4G7QB 3HAPA 1CWQA 3AYNA 3PQRA 2Z73A 1Q5IA 5C1MA 4BEYA 4FAAB 3QJTB 5B6VA 2JAFA 2PEDA 2NTUA 1GU8A 2ZIYA 3NSBA 5DHGA 1S8JA 1IXFA 5H2KA 3AM6A 3QAPA 5KKHA 2F93A 3VW7A 1F50A 4XT3A 1PY6A 3QBKA 2Y00A 3VGAA 4GP4B 3NS0A 4QRYA 1U19A 3HARA 4UG2A 2ZZLA 4G7RB 4PXFA 4HYJA 3NYAA 3UTXA 5EN0A 4XTNA 5AX0A 3OE9A 5JJJA 1M0KA 1KMEA 1JGJA 3AYMA 3V2WA 2I21A 4MQTA 3NY9A 1FBBA 2JAGA 1S8LA 2VT4A 2Y03A 4FA7B 1BM1A 3COCA 1P8UA 3S3DB 5B34A 3OE6A 1QHJA 4DAJA 3OE0A 5J7AA 2R4SA 3MBVA 2YDVA 4GP5B 4HYXA 3DQBA 1QKPA 1C8RA 3S8FB 4GBRA 4OV0A 3ODUA 1KGBA 1S51A 2WJKA 2YCWA 3UTVA 5ETZA 3HAOA 1JFPA 4N6HA 5G28A 4PXKA 5LWEA 4X31A 3BVDB 5AHYA 5A8EA
chains in the Genus database with same CATH superfamily
4L35A 5AWZA 3S3BB 4KLYA 1QM8A 4BWBA 3PWHA 2L6XA 4XXJA 2HPYA 2LNLA 2I35A 5H2MA 4LDOA 1R2NA 3CAPA 4BUOA 5H2JA 4BV0A 4DKLA 2ZFEA 5H2IA 5G2DA 4JQ6A 3T45A 3VVKA 5BR5A 2YDOA 3QJQB 1FBKA 5H2HA 4LDEA 1C3WA 2YCZA 3UTYA 3NY8A 3QBIA 3CODA 1XMEB 5B6YA 4UHRA 3UZAA 4G70B 4MQSA 1S52A 2KSYA 3RZEA 1BRDA 4Y9HA 4XT1A 3V2YA 3EMLA 3C9LA 3HAQA 4XTOA 5FJGA 3EH3B 2YCXA 3REYA 4K5YA 3PXOA 5H2LA 4J4QA 4A4MA 3DDLA 4IAQA 1IW6A 1F4ZA 1VGOA 2I20A 1IW9A 1L9HA 2X72A 4X1HA 4TL3A 3RFMA 3ZEVA 3HASA 2WJLA 1PXRA 4EA3A 4QI1A 3ZPQA 4WAVA 1GZMA 3A7KA 4XTLA 5AHZA 2M3GA 4AMIA 3VHZA 4LDLA 1HZXA 1S53A 4BVNA 1AP9A 3OAXA 1JV7A 3QJUB 4G71B 3QJRB 5G36A 1GUEA 2Y01A 1F88A 3QBGA 4FPDA 2KSBA 2AT9A 3HANA 2RH1A 4GYCA 2I1XA 1XIOA 5JJEA 5JJNA 4G7SB 2NTWA 1MGYA 3S8GB 1H68A 4QIDA 3UTWA 1X0K1 2Z55A 3UZCA 4JR8A 1TN0A 1QKOA 4KNFA 3ZPRA 5H2PA 5G2AA 3X3BA 4WW3A 4DS7E 3ABWA 4HWLA 1BRXA 5F8UA 3P0GA 5B6ZA 1LN6A 4DJHA 4GPOA 3UG9A 4NC3A 5B6WA 1E0PA 5DYSA 5ITEA 1KG9A 3D4SA 5G2CA 1X0SA 1DZEA 5AX1A 2R4RA 3EH4B 1XJIA 3SN6R 3UONA 5G53A 1S54A 1M0LA 1BRRA 5TGZA 3QBLA 4GRVA 4L6RA 2KS9A 4EIYA 3QJVB 5ITCA 1P8IA 5BR2A 2YCYA 4N4WA 4AMJA 3WQJA 3KJ6A 1Q5JA 2Y04A 4IARA 1UAZA 1JV6A 5A45A 3QDCA 1AT9A 4G72B 2QPEB 3PDSA 1EHKB 5B0WA 2QPDB 1M0MA 1X0I1 3C9MA 1O0AA 5A44A 1TN5A 1UCQA 4MBSA 4BEZA 4JKVA 3S3CB 1L0MA 1H2SA 2BRDA 4GP8B 4IB4A 3VI0A 1P8HA 2G87A 1VJMA 3PBLA 5AZDA 2F95A 5B35A 1R84A 3X3CA 5G54A 3OE8A 5B2NA 5DHHA 4MD1A 2Y02A 4N4YB 5B6XA 4MD2A 3VG9A 2J4YA 3QJSB 5H2OA 4X32A 3EH5B 1KG8A 1PXSA 3QAKA 2KSAA 4EJ4A 1E12A 2EI4A 5H2NA 4FBZA 1C8SA 4G7QB 3HAPA 1CWQA 3AYNA 3PQRA 2Z73A 1Q5IA 5C1MA 4BEYA 4FAAB 3QJTB 5B6VA 2JAFA 2PEDA 2NTUA 1GU8A 2ZIYA 3NSBA 5DHGA 1S8JA 1IXFA 5H2KA 3AM6A 3QAPA 5KKHA 2F93A 3VW7A 1F50A 4XT3A 1PY6A 3QBKA 2Y00A 3VGAA 4GP4B 3NS0A 4QRYA 1U19A 3HARA 4UG2A 2ZZLA 4G7RB 4PXFA 4HYJA 3NYAA 3UTXA 5EN0A 4XTNA 5AX0A 3OE9A 5JJJA 1M0KA 1KMEA 1JGJA 3AYMA 3V2WA 2I21A 4MQTA 3NY9A 1FBBA 2JAGA 1S8LA 2VT4A 2Y03A 4FA7B 1BM1A 3COCA 1P8UA 3S3DB 5B34A 3OE6A 1QHJA 4DAJA 3OE0A 5J7AA 2R4SA 3MBVA 2YDVA 4GP5B 4HYXA 3DQBA 1QKPA 1C8RA 3S8FB 4GBRA 4OV0A 3ODUA 1KGBA 1S51A 2WJKA 2YCWA 3UTVA 5ETZA 3HAOA 1JFPA 4N6HA 5G28A 4PXKA 5LWEA 4X31A 3BVDB 5AHYA 5A8EA
chains in the Genus database with same CATH topology
4L35A 5AWZA 3S3BB 4KLYA 1QM8A 4BWBA 3PWHA 2L6XA 4XXJA 2HPYA 2LNLA 2I35A 5H2MA 4LDOA 1R2NA 3CAPA 4BUOA 5H2JA 4BV0A 4DKLA 2ZFEA 5H2IA 5G2DA 4JQ6A 3T45A 3VVKA 5BR5A 2YDOA 3QJQB 1FBKA 5H2HA 4LDEA 1C3WA 2YCZA 3UTYA 3NY8A 3QBIA 3CODA 1XMEB 5B6YA 4UHRA 3UZAA 4G70B 4MQSA 1S52A 2KSYA 3RZEA 1BRDA 4Y9HA 4XT1A 3V2YA 3EMLA 3C9LA 3HAQA 4XTOA 5FJGA 3EH3B 2YCXA 3REYA 4K5YA 3PXOA 5H2LA 4J4QA 4A4MA 3DDLA 4IAQA 1IW6A 1F4ZA 1VGOA 2I20A 1IW9A 1L9HA 2X72A 4X1HA 4TL3A 3RFMA 3ZEVA 3HASA 2WJLA 1PXRA 4EA3A 4QI1A 3ZPQA 4WAVA 1GZMA 3A7KA 4XTLA 5AHZA 2M3GA 4AMIA 3VHZA 4LDLA 1HZXA 1S53A 4BVNA 1AP9A 3OAXA 1JV7A 3QJUB 4G71B 3QJRB 5G36A 1GUEA 2Y01A 1F88A 3QBGA 4FPDA 2KSBA 2AT9A 3HANA 2RH1A 4GYCA 2I1XA 1XIOA 5JJEA 5JJNA 4G7SB 2NTWA 1MGYA 3S8GB 1H68A 4QIDA 3UTWA 1X0K1 2Z55A 3UZCA 4JR8A 1TN0A 1QKOA 4KNFA 3ZPRA 5H2PA 5G2AA 3X3BA 4WW3A 4DS7E 3ABWA 4HWLA 1BRXA 5F8UA 3P0GA 5B6ZA 1LN6A 4DJHA 4GPOA 3UG9A 4NC3A 5B6WA 1E0PA 5DYSA 5ITEA 1KG9A 3D4SA 5G2CA 1X0SA 1DZEA 5AX1A 2R4RA 3EH4B 1XJIA 3SN6R 3UONA 5G53A 1S54A 1M0LA 1BRRA 5TGZA 3QBLA 4GRVA 4L6RA 2KS9A 4EIYA 3QJVB 5ITCA 1P8IA 5BR2A 2YCYA 4N4WA 4AMJA 3WQJA 3KJ6A 1Q5JA 2Y04A 4IARA 1UAZA 1JV6A 5A45A 3QDCA 1AT9A 4G72B 2QPEB 3PDSA 1EHKB 5B0WA 2QPDB 1M0MA 1X0I1 3C9MA 1O0AA 5A44A 1TN5A 1UCQA 4MBSA 4BEZA 4JKVA 3S3CB 1L0MA 1H2SA 2BRDA 4GP8B 4IB4A 3VI0A 1P8HA 2G87A 1VJMA 3PBLA 5AZDA 2F95A 5B35A 1R84A 3X3CA 5G54A 3OE8A 5B2NA 5DHHA 4MD1A 2Y02A 4N4YB 5B6XA 4MD2A 3VG9A 2J4YA 3QJSB 5H2OA 4X32A 3EH5B 1KG8A 1PXSA 3QAKA 2KSAA 4EJ4A 1E12A 2EI4A 5H2NA 4FBZA 1C8SA 4G7QB 3HAPA 1CWQA 3AYNA 3PQRA 2Z73A 1Q5IA 5C1MA 4BEYA 4FAAB 3QJTB 5B6VA 2JAFA 2PEDA 2NTUA 1GU8A 2ZIYA 3NSBA 5DHGA 1S8JA 1IXFA 5H2KA 3AM6A 3QAPA 5KKHA 2F93A 3VW7A 1F50A 4XT3A 1PY6A 3QBKA 2Y00A 3VGAA 4GP4B 3NS0A 4QRYA 1U19A 3HARA 4UG2A 2ZZLA 4G7RB 4PXFA 4HYJA 3NYAA 3UTXA 5EN0A 4XTNA 5AX0A 3OE9A 5JJJA 1M0KA 1KMEA 1JGJA 3AYMA 3V2WA 2I21A 4MQTA 3NY9A 1FBBA 2JAGA 1S8LA 2VT4A 2Y03A 4FA7B 1BM1A 3COCA 1P8UA 3S3DB 5B34A 3OE6A 1QHJA 4DAJA 3OE0A 5J7AA 2R4SA 3MBVA 2YDVA 4GP5B 4HYXA 3DQBA 1QKPA 1C8RA 3S8FB 4GBRA 4OV0A 3ODUA 1KGBA 1S51A 2WJKA 2YCWA 3UTVA 5ETZA 3HAOA 1JFPA 4N6HA 5G28A 4PXKA 5LWEA 4X31A 3BVDB 5AHYA 5A8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L35 A;  5AWZ A;  3S3B B;  4KLY A;  1QM8 A;  4BWB A;  3PWH A;  2L6X A;  4XXJ A;  2HPY A;  2LNL A;  2I35 A;  5H2M A;  4LDO A;  1R2N A;  3CAP A;  4BUO A;  5H2J A;  4BV0 A;  4DKL A;  2ZFE A;  5H2I A;  5G2D A;  4JQ6 A;  3T45 A;  3VVK A;  5BR5 A;  2YDO A;  3QJQ B;  1FBK A;  5H2H A;  4LDE A;  1C3W A;  2YCZ A;  3UTY A;  3NY8 A;  3QBI A;  3COD A;  1XME B;  5B6Y A;  4UHR A;  3UZA A;  4G70 B;  4MQS A;  1S52 A;  2KSY A;  3RZE A;  1BRD A;  4Y9H A;  4XT1 A;  3V2Y A;  3EML A;  3C9L A;  3HAQ A;  4XTO A;  5FJG A;  3EH3 B;  2YCX A;  3REY A;  4K5Y A;  3PXO A;  5H2L A;  4J4Q A;  4A4M A;  3DDL A;  4IAQ A;  1IW6 A;  1F4Z A;  1VGO A;  2I20 A;  1IW9 A;  1L9H A;  2X72 A;  4X1H A;  4TL3 A;  3RFM A;  3ZEV A;  3HAS A;  2WJL A;  1PXR A;  4EA3 A;  4QI1 A;  3ZPQ A;  4WAV A;  1GZM A;  3A7K A;  4XTL A;  5AHZ A;  2M3G A;  4AMI A;  3VHZ A;  4LDL A;  1HZX A;  1S53 A;  4BVN A;  1AP9 A;  3OAX A;  1JV7 A;  3QJU B;  4G71 B;  3QJR B;  5G36 A;  1GUE A;  2Y01 A;  1F88 A;  3QBG A;  4FPD A;  2KSB A;  2AT9 A;  3HAN A;  2RH1 A;  4GYC A;  2I1X A;  1XIO A;  5JJE A;  5JJN A;  4G7S B;  2NTW A;  1MGY A;  3S8G B;  1H68 A;  4QID A;  3UTW A;  1X0K 1;  2Z55 A;  3UZC A;  4JR8 A;  1TN0 A;  1QKO A;  4KNF A;  3ZPR A;  5H2P A;  5G2A A;  3X3B A;  4WW3 A;  3ABW A;  4HWL A;  1BRX A;  5F8U A;  3P0G A;  5B6Z A;  1LN6 A;  4DJH A;  4GPO A;  3UG9 A;  4NC3 A;  5B6W A;  1E0P A;  5DYS A;  5ITE A;  1KG9 A;  3D4S A;  5G2C A;  1X0S A;  1DZE A;  5AX1 A;  2R4R A;  3EH4 B;  1XJI A;  3SN6 R;  3UON A;  5G53 A;  1S54 A;  1M0L A;  1BRR A;  5TGZ A;  3QBL A;  4GRV A;  4L6R A;  2KS9 A;  4EIY A;  3QJV B;  5ITC A;  1P8I A;  5BR2 A;  2YCY A;  4N4W A;  4AMJ A;  3WQJ A;  3KJ6 A;  1Q5J A;  2Y04 A;  4IAR A;  1UAZ A;  1JV6 A;  5A45 A;  3QDC A;  1AT9 A;  4G72 B;  2QPE B;  3PDS A;  1EHK B;  5B0W A;  2QPD B;  1M0M A;  1X0I 1;  3C9M A;  1O0A A;  5A44 A;  1TN5 A;  1UCQ A;  4MBS A;  4BEZ A;  4JKV A;  3S3C B;  1L0M A;  1H2S A;  2BRD A;  4GP8 B;  4IB4 A;  3VI0 A;  1P8H A;  2G87 A;  1VJM A;  3PBL A;  5AZD A;  2F95 A;  5B35 A;  1R84 A;  3X3C A;  5G54 A;  3OE8 A;  5B2N A;  5DHH A;  4MD1 A;  2Y02 A;  4N4Y B;  5B6X A;  4MD2 A;  3VG9 A;  2J4Y A;  3QJS B;  5H2O A;  4X32 A;  3EH5 B;  1KG8 A;  1PXS A;  3QAK A;  2KSA A;  4EJ4 A;  1E12 A;  2EI4 A;  5H2N A;  4FBZ A;  1C8S A;  4G7Q B;  3HAP A;  1CWQ A;  3AYN A;  3PQR A;  2Z73 A;  1Q5I A;  5C1M A;  4BEY A;  4FAA B;  3QJT B;  5B6V A;  2JAF A;  2PED A;  2NTU A;  1GU8 A;  2ZIY A;  3NSB A;  5DHG A;  1S8J A;  1IXF A;  5H2K A;  3AM6 A;  3QAP A;  5KKH A;  2F93 A;  3VW7 A;  1F50 A;  4XT3 A;  1PY6 A;  3QBK A;  2Y00 A;  3VGA A;  4GP4 B;  3NS0 A;  4QRY A;  1U19 A;  3HAR A;  4UG2 A;  2ZZL A;  4G7R B;  4PXF A;  4HYJ A;  3NYA A;  3UTX A;  5EN0 A;  4XTN A;  5AX0 A;  3OE9 A;  5JJJ A;  1M0K A;  1KME A;  1JGJ A;  3AYM A;  3V2W A;  2I21 A;  4MQT A;  3NY9 A;  1FBB A;  2JAG A;  1S8L A;  2VT4 A;  2Y03 A;  4FA7 B;  1BM1 A;  3COC A;  1P8U A;  3S3D B;  5B34 A;  3OE6 A;  1QHJ A;  4DAJ A;  3OE0 A;  5J7A A;  2R4S A;  3MBV A;  2YDV A;  4GP5 B;  4HYX A;  3DQB A;  1QKP A;  1C8R A;  3S8F B;  4GBR A;  4OV0 A;  3ODU A;  1KGB A;  1S51 A;  2WJK A;  2YCW A;  3UTV A;  5ETZ A;  3HAO A;  1JFP A;  4N6H A;  5G28 A;  4PXK A;  5LWE A;  4X31 A;  3BVD B;  5AHY A;  5A8E A; 
#chains in the Genus database with same CATH topology
 4L35 A;  5AWZ A;  3S3B B;  4KLY A;  1QM8 A;  4BWB A;  3PWH A;  2L6X A;  4XXJ A;  2HPY A;  2LNL A;  2I35 A;  5H2M A;  4LDO A;  1R2N A;  3CAP A;  4BUO A;  5H2J A;  4BV0 A;  4DKL A;  2ZFE A;  5H2I A;  5G2D A;  4JQ6 A;  3T45 A;  3VVK A;  5BR5 A;  2YDO A;  3QJQ B;  1FBK A;  5H2H A;  4LDE A;  1C3W A;  2YCZ A;  3UTY A;  3NY8 A;  3QBI A;  3COD A;  1XME B;  5B6Y A;  4UHR A;  3UZA A;  4G70 B;  4MQS A;  1S52 A;  2KSY A;  3RZE A;  1BRD A;  4Y9H A;  4XT1 A;  3V2Y A;  3EML A;  3C9L A;  3HAQ A;  4XTO A;  5FJG A;  3EH3 B;  2YCX A;  3REY A;  4K5Y A;  3PXO A;  5H2L A;  4J4Q A;  4A4M A;  3DDL A;  4IAQ A;  1IW6 A;  1F4Z A;  1VGO A;  2I20 A;  1IW9 A;  1L9H A;  2X72 A;  4X1H A;  4TL3 A;  3RFM A;  3ZEV A;  3HAS A;  2WJL A;  1PXR A;  4EA3 A;  4QI1 A;  3ZPQ A;  4WAV A;  1GZM A;  3A7K A;  4XTL A;  5AHZ A;  2M3G A;  4AMI A;  3VHZ A;  4LDL A;  1HZX A;  1S53 A;  4BVN A;  1AP9 A;  3OAX A;  1JV7 A;  3QJU B;  4G71 B;  3QJR B;  5G36 A;  1GUE A;  2Y01 A;  1F88 A;  3QBG A;  4FPD A;  2KSB A;  2AT9 A;  3HAN A;  2RH1 A;  4GYC A;  2I1X A;  1XIO A;  5JJE A;  5JJN A;  4G7S B;  2NTW A;  1MGY A;  3S8G B;  1H68 A;  4QID A;  3UTW A;  1X0K 1;  2Z55 A;  3UZC A;  4JR8 A;  1TN0 A;  1QKO A;  4KNF A;  3ZPR A;  5H2P A;  5G2A A;  3X3B A;  4WW3 A;  4DS7 E;  3ABW A;  4HWL A;  1BRX A;  5F8U A;  3P0G A;  5B6Z A;  1LN6 A;  4DJH A;  4GPO A;  3UG9 A;  4NC3 A;  5B6W A;  1E0P A;  5DYS A;  5ITE A;  1KG9 A;  3D4S A;  5G2C A;  1X0S A;  1DZE A;  5AX1 A;  2R4R A;  3EH4 B;  1XJI A;  3SN6 R;  3UON A;  5G53 A;  1S54 A;  1M0L A;  1BRR A;  5TGZ A;  3QBL A;  4GRV A;  4L6R A;  2KS9 A;  4EIY A;  3QJV B;  5ITC A;  1P8I A;  5BR2 A;  2YCY A;  4N4W A;  4AMJ A;  3WQJ A;  3KJ6 A;  1Q5J A;  2Y04 A;  4IAR A;  1UAZ A;  1JV6 A;  5A45 A;  3QDC A;  1AT9 A;  4G72 B;  2QPE B;  3PDS A;  1EHK B;  5B0W A;  2QPD B;  1M0M A;  1X0I 1;  3C9M A;  1O0A A;  5A44 A;  1TN5 A;  1UCQ A;  4MBS A;  4BEZ A;  4JKV A;  3S3C B;  1L0M A;  1H2S A;  2BRD A;  4GP8 B;  4IB4 A;  3VI0 A;  1P8H A;  2G87 A;  1VJM A;  3PBL A;  5AZD A;  2F95 A;  5B35 A;  1R84 A;  3X3C A;  5G54 A;  3OE8 A;  5B2N A;  5DHH A;  4MD1 A;  2Y02 A;  4N4Y B;  5B6X A;  4MD2 A;  3VG9 A;  2J4Y A;  3QJS B;  5H2O A;  4X32 A;  3EH5 B;  1KG8 A;  1PXS A;  3QAK A;  2KSA A;  4EJ4 A;  1E12 A;  2EI4 A;  5H2N A;  4FBZ A;  1C8S A;  4G7Q B;  3HAP A;  1CWQ A;  3AYN A;  3PQR A;  2Z73 A;  1Q5I A;  5C1M A;  4BEY A;  4FAA B;  3QJT B;  5B6V A;  2JAF A;  2PED A;  2NTU A;  1GU8 A;  2ZIY A;  3NSB A;  5DHG A;  1S8J A;  1IXF A;  5H2K A;  3AM6 A;  3QAP A;  5KKH A;  2F93 A;  3VW7 A;  1F50 A;  4XT3 A;  1PY6 A;  3QBK A;  2Y00 A;  3VGA A;  4GP4 B;  3NS0 A;  4QRY A;  1U19 A;  3HAR A;  4UG2 A;  2ZZL A;  4G7R B;  4PXF A;  4HYJ A;  3NYA A;  3UTX A;  5EN0 A;  4XTN A;  5AX0 A;  3OE9 A;  5JJJ A;  1M0K A;  1KME A;  1JGJ A;  3AYM A;  3V2W A;  2I21 A;  4MQT A;  3NY9 A;  1FBB A;  2JAG A;  1S8L A;  2VT4 A;  2Y03 A;  4FA7 B;  1BM1 A;  3COC A;  1P8U A;  3S3D B;  5B34 A;  3OE6 A;  1QHJ A;  4DAJ A;  3OE0 A;  5J7A A;  2R4S A;  3MBV A;  2YDV A;  4GP5 B;  4HYX A;  3DQB A;  1QKP A;  1C8R A;  3S8F B;  4GBR A;  4OV0 A;  3ODU A;  1KGB A;  1S51 A;  2WJK A;  2YCW A;  3UTV A;  5ETZ A;  3HAO A;  1JFP A;  4N6H A;  5G28 A;  4PXK A;  5LWE A;  4X31 A;  3BVD B;  5AHY A;  5A8E A; 
#chains in the Genus database with same CATH homology
 4L35 A;  5AWZ A;  3S3B B;  4KLY A;  1QM8 A;  4BWB A;  3PWH A;  2L6X A;  4XXJ A;  2HPY A;  2LNL A;  2I35 A;  5H2M A;  4LDO A;  1R2N A;  3CAP A;  4BUO A;  5H2J A;  4BV0 A;  4DKL A;  2ZFE A;  5H2I A;  5G2D A;  4JQ6 A;  3T45 A;  3VVK A;  5BR5 A;  2YDO A;  3QJQ B;  1FBK A;  5H2H A;  4LDE A;  1C3W A;  2YCZ A;  3UTY A;  3NY8 A;  3QBI A;  3COD A;  1XME B;  5B6Y A;  4UHR A;  3UZA A;  4G70 B;  4MQS A;  1S52 A;  2KSY A;  3RZE A;  1BRD A;  4Y9H A;  4XT1 A;  3V2Y A;  3EML A;  3C9L A;  3HAQ A;  4XTO A;  5FJG A;  3EH3 B;  2YCX A;  3REY A;  4K5Y A;  3PXO A;  5H2L A;  4J4Q A;  4A4M A;  3DDL A;  4IAQ A;  1IW6 A;  1F4Z A;  1VGO A;  2I20 A;  1IW9 A;  1L9H A;  2X72 A;  4X1H A;  4TL3 A;  3RFM A;  3ZEV A;  3HAS A;  2WJL A;  1PXR A;  4EA3 A;  4QI1 A;  3ZPQ A;  4WAV A;  1GZM A;  3A7K A;  4XTL A;  5AHZ A;  2M3G A;  4AMI A;  3VHZ A;  4LDL A;  1HZX A;  1S53 A;  4BVN A;  1AP9 A;  3OAX A;  1JV7 A;  3QJU B;  4G71 B;  3QJR B;  5G36 A;  1GUE A;  2Y01 A;  1F88 A;  3QBG A;  4FPD A;  2KSB A;  2AT9 A;  3HAN A;  2RH1 A;  4GYC A;  2I1X A;  1XIO A;  5JJE A;  5JJN A;  4G7S B;  2NTW A;  1MGY A;  3S8G B;  1H68 A;  4QID A;  3UTW A;  1X0K 1;  2Z55 A;  3UZC A;  4JR8 A;  1TN0 A;  1QKO A;  4KNF A;  3ZPR A;  5H2P A;  5G2A A;  3X3B A;  4WW3 A;  4DS7 E;  3ABW A;  4HWL A;  1BRX A;  5F8U A;  3P0G A;  5B6Z A;  1LN6 A;  4DJH A;  4GPO A;  3UG9 A;  4NC3 A;  5B6W A;  1E0P A;  5DYS A;  5ITE A;  1KG9 A;  3D4S A;  5G2C A;  1X0S A;  1DZE A;  5AX1 A;  2R4R A;  3EH4 B;  1XJI A;  3SN6 R;  3UON A;  5G53 A;  1S54 A;  1M0L A;  1BRR A;  5TGZ A;  3QBL A;  4GRV A;  4L6R A;  2KS9 A;  4EIY A;  3QJV B;  5ITC A;  1P8I A;  5BR2 A;  2YCY A;  4N4W A;  4AMJ A;  3WQJ A;  3KJ6 A;  1Q5J A;  2Y04 A;  4IAR A;  1UAZ A;  1JV6 A;  5A45 A;  3QDC A;  1AT9 A;  4G72 B;  2QPE B;  3PDS A;  1EHK B;  5B0W A;  2QPD B;  1M0M A;  1X0I 1;  3C9M A;  1O0A A;  5A44 A;  1TN5 A;  1UCQ A;  4MBS A;  4BEZ A;  4JKV A;  3S3C B;  1L0M A;  1H2S A;  2BRD A;  4GP8 B;  4IB4 A;  3VI0 A;  1P8H A;  2G87 A;  1VJM A;  3PBL A;  5AZD A;  2F95 A;  5B35 A;  1R84 A;  3X3C A;  5G54 A;  3OE8 A;  5B2N A;  5DHH A;  4MD1 A;  2Y02 A;  4N4Y B;  5B6X A;  4MD2 A;  3VG9 A;  2J4Y A;  3QJS B;  5H2O A;  4X32 A;  3EH5 B;  1KG8 A;  1PXS A;  3QAK A;  2KSA A;  4EJ4 A;  1E12 A;  2EI4 A;  5H2N A;  4FBZ A;  1C8S A;  4G7Q B;  3HAP A;  1CWQ A;  3AYN A;  3PQR A;  2Z73 A;  1Q5I A;  5C1M A;  4BEY A;  4FAA B;  3QJT B;  5B6V A;  2JAF A;  2PED A;  2NTU A;  1GU8 A;  2ZIY A;  3NSB A;  5DHG A;  1S8J A;  1IXF A;  5H2K A;  3AM6 A;  3QAP A;  5KKH A;  2F93 A;  3VW7 A;  1F50 A;  4XT3 A;  1PY6 A;  3QBK A;  2Y00 A;  3VGA A;  4GP4 B;  3NS0 A;  4QRY A;  1U19 A;  3HAR A;  4UG2 A;  2ZZL A;  4G7R B;  4PXF A;  4HYJ A;  3NYA A;  3UTX A;  5EN0 A;  4XTN A;  5AX0 A;  3OE9 A;  5JJJ A;  1M0K A;  1KME A;  1JGJ A;  3AYM A;  3V2W A;  2I21 A;  4MQT A;  3NY9 A;  1FBB A;  2JAG A;  1S8L A;  2VT4 A;  2Y03 A;  4FA7 B;  1BM1 A;  3COC A;  1P8U A;  3S3D B;  5B34 A;  3OE6 A;  1QHJ A;  4DAJ A;  3OE0 A;  5J7A A;  2R4S A;  3MBV A;  2YDV A;  4GP5 B;  4HYX A;  3DQB A;  1QKP A;  1C8R A;  3S8F B;  4GBR A;  4OV0 A;  3ODU A;  1KGB A;  1S51 A;  2WJK A;  2YCW A;  3UTV A;  5ETZ A;  3HAO A;  1JFP A;  4N6H A;  5G28 A;  4PXK A;  5LWE A;  4X31 A;  3BVD B;  5AHY A;  5A8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...