2YFAA

X-ray structure of mcps ligand binding domain in complex with malate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
236
structure length
236
Chain Sequence
GSHMGDIGQLNKDLTDLRIARLQYMIANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARPEADSVRLAQYQLISKARQQLLQVRIDVRGYIAENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANITTSRAEMTVQGADIVKRSDALYQIQLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Chemoreceptors with Bimodular Ligand-Binding Regions Harboring Two Signal-Binding Sites.
pubmed doi rcsb
molecule keywords METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER
molecule tags Receptor
source organism Pseudomonas putida
total genus 118
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfaA01
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfaA02
2YFAA 2YFBA 3VA9A
chains in the Genus database with same CATH superfamily
4NV2A 3FBVA 3I9V1 4O1PA 2XMXA 2K19A 4PL4A 4HFVA 3KP9A 1JQOA 2CAZB 4HEA1 2ETDA 2JAEA 3FNBA 4Z7GA 2GSCA 2HGKA 5HGIA 2FEFA 2RIOA 3DA3A 3Q8DA 2JBWA 3SDJA 2MJFB 2JB2A 3LJ2A 2JB3A 4AS2A 4PL5A 2XTQA 4DWLA 3VA9A 2F66B 2ZRRA 2XTRA 2IP6A 4NV5A 3LJ1A 1W3SA 2L1LB 1SJ8A 2A2CA 2YFAA 3L0IA 1U5KA 1TDPA 4AS3A 4OAUC 2F6MB 4G75A 4GXTA 2KKMA 4JCVE 3UITA 4PL3A 2A2DA 2JB1A 3IAS1 3IAM1 3P23A 3F4MA 4YZCA 4O1OA 3JSBA 3AJFA 2RLDA 3DA4A 4YZDA 2FU2A 2P22B 2BL7A 4Q9VA 2E8GA 2RADA 4U6RA 3FVVA 2ZW3A 2QZGA 2YFBA 2FUG1 2QSBA 2QGMA 4OAVB 3LJ0A 4Z7HA 2V6EA 3B55A 4I1TA 3DO9A 4YZ9A 1YO7A 5LNK1 2BL8A 2V1CC 4G76A
chains in the Genus database with same CATH topology
4NV2A 3FBVA 3I9V1 4O1PA 2XMXA 2K19A 4PL4A 4HFVA 3KP9A 2CAZB 4HEA1 2JAEA 4Z7GA 5HGIA 2RIOA 3DA3A 3Q8DA 3SDJA 2MJFB 2JB2A 3LJ2A 2JB3A 4AS2A 4PL5A 2XTQA 4DWLA 3VA9A 2F66B 2ZRRA 2XTRA 2IP6A 4NV5A 3LJ1A 1W3SA 2L1LB 1SJ8A 2A2CA 2YFAA 3L0IA 1U5KA 4AS3A 4OAUC 2F6MB 4G75A 4GXTA 2KKMA 4JCVE 3UITA 4PL3A 2A2DA 2JB1A 3IAS1 3IAM1 3P23A 3F4MA 4YZCA 4O1OA 3JSBA 3AJFA 3DA4A 4YZDA 2P22B 4Q9VA 2E8GA 4U6RA 2YFBA 2FUG1 4OAVB 3LJ0A 4Z7HA 2V6EA 4I1TA 3DO9A 4YZ9A 1YO7A 5LNK1 2V1CC 4G76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFA A;  2YFB A;  3VA9 A; 
#chains in the Genus database with same CATH topology
 4NV2 A;  3FBV A;  3I9V 1;  4O1P A;  2XMX A;  2K19 A;  4PL4 A;  4HFV A;  3KP9 A;  1JQO A;  2CAZ B;  4HEA 1;  2ETD A;  2JAE A;  3FNB A;  4Z7G A;  2GSC A;  2HGK A;  5HGI A;  2FEF A;  2RIO A;  3DA3 A;  3Q8D A;  2JBW A;  3SDJ A;  2MJF B;  2JB2 A;  3LJ2 A;  2JB3 A;  4AS2 A;  4PL5 A;  2XTQ A;  4DWL A;  3VA9 A;  2F66 B;  2ZRR A;  2XTR A;  2IP6 A;  4NV5 A;  3LJ1 A;  1W3S A;  2L1L B;  1SJ8 A;  2A2C A;  2YFA A;  3L0I A;  1U5K A;  1TDP A;  4AS3 A;  4OAU C;  2F6M B;  4G75 A;  4GXT A;  2KKM A;  4JCV E;  3UIT A;  4PL3 A;  2A2D A;  2JB1 A;  3IAS 1;  3IAM 1;  3P23 A;  3F4M A;  4YZC A;  4O1O A;  3JSB A;  3AJF A;  2RLD A;  3DA4 A;  4YZD A;  2FU2 A;  2P22 B;  2BL7 A;  4Q9V A;  2E8G A;  2RAD A;  4U6R A;  3FVV A;  2ZW3 A;  2QZG A;  2YFB A;  2FUG 1;  2QSB A;  2QGM A;  4OAV B;  3LJ0 A;  4Z7H A;  2V6E A;  3B55 A;  4I1T A;  3DO9 A;  4YZ9 A;  1YO7 A;  5LNK 1;  2BL8 A;  2V1C C;  4G76 A; 
#chains in the Genus database with same CATH homology
 4NV2 A;  3FBV A;  3I9V 1;  4O1P A;  2XMX A;  2K19 A;  4PL4 A;  4HFV A;  3KP9 A;  2CAZ B;  4HEA 1;  2JAE A;  4Z7G A;  5HGI A;  2RIO A;  3DA3 A;  3Q8D A;  3SDJ A;  2MJF B;  2JB2 A;  3LJ2 A;  2JB3 A;  4AS2 A;  4PL5 A;  2XTQ A;  4DWL A;  3VA9 A;  2F66 B;  2ZRR A;  2XTR A;  2IP6 A;  4NV5 A;  3LJ1 A;  1W3S A;  2L1L B;  1SJ8 A;  2A2C A;  2YFA A;  3L0I A;  1U5K A;  4AS3 A;  4OAU C;  2F6M B;  4G75 A;  4GXT A;  2KKM A;  4JCV E;  3UIT A;  4PL3 A;  2A2D A;  2JB1 A;  3IAS 1;  3IAM 1;  3P23 A;  3F4M A;  4YZC A;  4O1O A;  3JSB A;  3AJF A;  3DA4 A;  4YZD A;  2P22 B;  4Q9V A;  2E8G A;  4U6R A;  2YFB A;  2FUG 1;  4OAV B;  3LJ0 A;  4Z7H A;  2V6E A;  4I1T A;  3DO9 A;  4YZ9 A;  1YO7 A;  5LNK 1;  2V1C C;  4G76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...