2YFBA

X-ray structure of mcps ligand binding domain in complex with succinate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
235
structure length
235
Chain Sequence
GSHMGDIGQLNKDLTDLRIARLQYMIANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARPEADSVRLAQYQLISKARQQLLQVRIDVRGYIAENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANITTSRAEMTVQGADIVKRSDALYQIQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Chemoreceptors with Bimodular Ligand-Binding Regions Harboring Two Signal-Binding Sites.
pubmed doi rcsb
molecule keywords METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER
molecule tags Receptor
source organism Pseudomonas putida
total genus 115
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfbA01
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfbA02
2YFBA 2YFAA 3VA9A
chains in the Genus database with same CATH superfamily
2QGMA 2ZRRA 2RADA 2JB1A 4JCVE 3FNBA 4PL4A 3VA9A 4G76A 2A2CA 2RIOA 3DA3A 2FEFA 2CAZB 3LJ2A 2JBWA 2KKMA 3UITA 2JB3A 4Q9VA 1YO7A 4PL5A 5LNK1 3Q8DA 4NV2A 4HEA1 3IAS1 4O1PA 4YZ9A 2V1CC 2ETDA 3JSBA 5HGIA 2BL7A 2QSBA 2ZW3A 3SDJA 1U5KA 3KP9A 2F66B 3FVVA 3AJFA 2L1LB 2K19A 2MJFB 4Z7HA 4GXTA 3DO9A 4OAUC 2V6EA 2XMXA 4OAVB 2YFBA 4AS3A 3LJ0A 4G75A 3LJ1A 4O1OA 2FUG1 2JAEA 1SJ8A 2F6MB 3FBVA 2FU2A 3B55A 3IAM1 4HFVA 2QZGA 3L0IA 4NV5A 3F4MA 4DWLA 1TDPA 3DA4A 1JQOA 4PL3A 2XTRA 4U6RA 2BL8A 1W3SA 2HGKA 2IP6A 2RLDA 2GSCA 4AS2A 2XTQA 2A2DA 2P22B 2E8GA 2JB2A 4YZDA 3P23A 4I1TA 3I9V1 4YZCA 4Z7GA 2YFAA
chains in the Genus database with same CATH topology
2ZRRA 2JB1A 4JCVE 4PL4A 3VA9A 4G76A 2A2CA 2RIOA 3DA3A 2CAZB 3LJ2A 2KKMA 3UITA 2JB3A 4Q9VA 1YO7A 4PL5A 5LNK1 3Q8DA 4NV2A 4HEA1 3IAS1 4O1PA 4YZ9A 2V1CC 3JSBA 5HGIA 3SDJA 1U5KA 3KP9A 2F66B 3AJFA 2L1LB 2K19A 2MJFB 4Z7HA 4GXTA 3DO9A 4OAUC 2V6EA 2XMXA 4OAVB 2YFBA 4AS3A 3LJ0A 4G75A 3LJ1A 4O1OA 2FUG1 2JAEA 1SJ8A 2F6MB 3FBVA 3IAM1 4HFVA 3L0IA 4NV5A 3F4MA 4DWLA 3DA4A 4PL3A 2XTRA 4U6RA 1W3SA 2IP6A 4AS2A 2XTQA 2A2DA 2P22B 2E8GA 2JB2A 4YZDA 3P23A 4I1TA 3I9V1 4YZCA 4Z7GA 2YFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFB A;  2YFA A;  3VA9 A; 
#chains in the Genus database with same CATH topology
 2QGM A;  2ZRR A;  2RAD A;  2JB1 A;  4JCV E;  3FNB A;  4PL4 A;  3VA9 A;  4G76 A;  2A2C A;  2RIO A;  3DA3 A;  2FEF A;  2CAZ B;  3LJ2 A;  2JBW A;  2KKM A;  3UIT A;  2JB3 A;  4Q9V A;  1YO7 A;  4PL5 A;  5LNK 1;  3Q8D A;  4NV2 A;  4HEA 1;  3IAS 1;  4O1P A;  4YZ9 A;  2V1C C;  2ETD A;  3JSB A;  5HGI A;  2BL7 A;  2QSB A;  2ZW3 A;  3SDJ A;  1U5K A;  3KP9 A;  2F66 B;  3FVV A;  3AJF A;  2L1L B;  2K19 A;  2MJF B;  4Z7H A;  4GXT A;  3DO9 A;  4OAU C;  2V6E A;  2XMX A;  4OAV B;  2YFB A;  4AS3 A;  3LJ0 A;  4G75 A;  3LJ1 A;  4O1O A;  2FUG 1;  2JAE A;  1SJ8 A;  2F6M B;  3FBV A;  2FU2 A;  3B55 A;  3IAM 1;  4HFV A;  2QZG A;  3L0I A;  4NV5 A;  3F4M A;  4DWL A;  1TDP A;  3DA4 A;  1JQO A;  4PL3 A;  2XTR A;  4U6R A;  2BL8 A;  1W3S A;  2HGK A;  2IP6 A;  2RLD A;  2GSC A;  4AS2 A;  2XTQ A;  2A2D A;  2P22 B;  2E8G A;  2JB2 A;  4YZD A;  3P23 A;  4I1T A;  3I9V 1;  4YZC A;  4Z7G A;  2YFA A; 
#chains in the Genus database with same CATH homology
 2ZRR A;  2JB1 A;  4JCV E;  4PL4 A;  3VA9 A;  4G76 A;  2A2C A;  2RIO A;  3DA3 A;  2CAZ B;  3LJ2 A;  2KKM A;  3UIT A;  2JB3 A;  4Q9V A;  1YO7 A;  4PL5 A;  5LNK 1;  3Q8D A;  4NV2 A;  4HEA 1;  3IAS 1;  4O1P A;  4YZ9 A;  2V1C C;  3JSB A;  5HGI A;  3SDJ A;  1U5K A;  3KP9 A;  2F66 B;  3AJF A;  2L1L B;  2K19 A;  2MJF B;  4Z7H A;  4GXT A;  3DO9 A;  4OAU C;  2V6E A;  2XMX A;  4OAV B;  2YFB A;  4AS3 A;  3LJ0 A;  4G75 A;  3LJ1 A;  4O1O A;  2FUG 1;  2JAE A;  1SJ8 A;  2F6M B;  3FBV A;  3IAM 1;  4HFV A;  3L0I A;  4NV5 A;  3F4M A;  4DWL A;  3DA4 A;  4PL3 A;  2XTR A;  4U6R A;  1W3S A;  2IP6 A;  4AS2 A;  2XTQ A;  2A2D A;  2P22 B;  2E8G A;  2JB2 A;  4YZD A;  3P23 A;  4I1T A;  3I9V 1;  4YZC A;  4Z7G A;  2YFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...