2YLYA

Sulfonamides as selective estrogen receptor beta agonists.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
219
Chain Sequence
DALSPEQLVLTLLEAEPPHVLIFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sulfonamides as Selective Oestrogen Receptor Beta Agonists.
pubmed doi rcsb
molecule keywords ESTROGEN RECEPTOR BETA
molecule tags Receptor
source organism Homo sapiens
total genus 71
structure length 219
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2ylyA00
2GPVA 3OMOA 4ZNVA 3UP3A 4DMAA 4JL4A 4S0SA 3BEJA 2AM9A 3FEIA 2B50A 2Q7IA 5C4OA 2Q59B 3B1MA 3L3ZA 4QL8A 2OUZA 4ZI1A 4OILA 4WQPA 3UU7B 5E15A 4OKWA 2OAXA 3TY0A 5DMCA 1NQ7A 2BAWA 2E2RA 5KCCA 4OZTU 3AFRA 1TFCA 5DZ1A 5DV8A 2IHQA 1RDTD 5DXMA 3V9TA 3X31A 4E4QA 4ZNHA 4DK8A 3UUDB 3RLJA 2YATA 2F4BA 5DXGA 2Z4JA 4G1YA 4IA7A 3ADUA 5IAWA 4MG7B 4G2IA 3VSOA 1UOMA 2QXSA 3WWRA 2QGTA 3OSIA 2NXXA 2IOGA 2QZOB 3AN3A 4FNEA 2QSEA 5DKBA 2ZNOA 2AX6A 2ZXMA 4OIUA 4POHA 2ZK2A 4Q50A 4ZNSA 2ZK3A 1FCZA 5DVCA 5G5WA 3VRUA 5APKA 2ABIA 5KCEA 2XYWA 2AB2A 3H0AD 5JI0D 3V4AA 4S14A 1Q4XA 1K7LA 5DIGA 1XZXX 1UHLB 3HVLA 3P89A 3WT6A 1XNNA 3GZ9A 2Q1HA 2PIRA 3PO9A 3E94A 3WT7A 5FQTA 3S9SA 3OZ0A 2AMBA 5AVLA 3VRVA 3VN2A 4NIEA 1ZDUA 2PIQA 3A3ZX 3ADSA 3DY6A 4PF3A 3X1IA 3X1HA 4ZN9A 3DZYA 4IV4A 3OLFA 2ZMIA 2H79A 4RMDA 2GPPA 2ZASA 4ZJWA 4ZN7A 1PQ6A 2QE4A 3GWXA 4ZNWA 5DVSA 3UVVB 4PLEA 3CLDA 5AZVA 3R8DA 5DXPA 1XV9A 5DXBB 1X7RA 4IWFA 4XLDA 5DWGA 4XAOA 1L2IA 1RKHA 2HC4A 4MG8B 5DXQA 5GIDA 5B41A 4DQMA 4KZMA 1KNUA 2QA8B 2R40A 3OAPA 3HLVA 4UDBA 2HCDA 3VT7A 1UPVA 1FM9D 4PP5A 5DK9A 1ZH7A 2XHSA 1S9PA 3F7DA 5HCVA 3KMZA 3NOAA 3PRGA 4OH6A 4P6XA 1GWXA 3GWSX 2GIUA 2PIPL 3SP9A 1ZUCA 2AYRA 2AO6A 2NPAA 2VV3A 3CS8A 5EC9A 4JYIA 5G46A 4RMEA 2QXMA 3MNPA 3TKMA 2GPOA 2QH6A 2AA7A 2AA6A 3AZ1A 3PEQA 4DM8A 1NHZA 4LBDA 3V9YA 4OFUA 4R6SA 2YLYA 3VI8A 4N8RA 4FGYA 1R6GA 4CI5A 1T63A 4P6WA 2G44A 1QKTA 4XT9A 4E2JA 4XI3A 2OCFA 2P7ZA 3VHVA 3WJ5A 4OGHA 1R1KA 2HAMA 1XP9A 2Z4BA 2QTUA 5I4VA 1YY4A 5HJPB 5KD9A 3B0RA 2ZLCA 4RUOX 5HYKA 3L1BA 3V3QA 3KDTA 3PBAA 3D90A 3R2AA 2GL8A 4Y29A 5APJA 5DWLA 2VV1B 3AN4A 4NB6A 3VHUA 3D24A 4X1GA 2AX8A 1M13A 1XP6A 2LBDA 4HLWA 4OIVA 3B5RA 5DMFA 5H1EA 3OLSA 1XV9B 4OARA 3ZQTA 2FAIA 1S9QA 4IW8A 4N73A 1XVPB 3EYBA 4EM9A 5DX3B 1XQCA 1QKNA 2QA6A 3VSPA 3HODA 1X76A 1FM6A 3WGPA 4DOSA 1FD0A 1SQNA 1IE8A 5KCUA 2PINA 2Q60A 1A52A 1NAXA 4OZRE 1DB1A 3BC5A 3E00A 3L0EA 4JAZA 4RZGA 1LBDA 5KCTA 1OVLB 3P0UA 3X36A 5KCWA 3W0GA 2Q7LA 5AAVA 4RAKA 1EREA 1KV6A 2ACLA 2Q61A 2POGA 3ILZA 3Q95B 3G9EA 4ONIA 2P54A 3W0CA 4QK4A 5HZCA 2Q5SA 3B3KA 5DY8A 5ETHA 2B23A 3VTBA 3AUNA 2AAXA 2P1VA 4A4WA 5GT4A 5DYBA 3VT6A 3HO0A 4IUIA 4F9MA 5L7GA 3AX8A 3UP0A 3OMMA 4M8EA 3KYTA 5E14A 4RFWA 2P1UA 4K6IA 2JFAB 3FXVA 4L96A 2YLOA 2JJ3A 3D5FA 3OZJA 4UDDA 4ZO1B 5SYZA 2ZLAA 3WT5A 4J5XC 1S19A 3ADXA 4J5WC 2PIUA 1ILGA 3AZ3A 2ZMHA 2Q3YA 2PIXA 4LSJA 5DV3A 2HFPA 1T5ZA 4Q0AC 3G8OA 1EXAA 4TV1B 4OC7A 5JJMA 5KYAA 2YLPA 4NY9A 1YA3A 3L0JA 3RUTA 3K22A 3OSWA 5EGVA 4PP3A 5DIDA 1YOKA 3DT3A 3GN8A 3K23A 4PP6A 1T7MA 2HBHA 3VRTA 4WPFA 5AK2A 3QT0A 3V49A 5KROA 4IWCA 4XTAA 1I7IA 2H77A 1R1KD 2Q5PA 2B1VA 3AZ2A 4MDDA 1PRGA 4XUHA 4YPQA 3ET1A 2J14A 4MGDB 3CWDA 5IZ0A 1DKFA 3VJIA 2REWA 5IXKA 2VSRA 1HG4A 1PQCA 3L0LA 4MGAA 1XAPA 2GWXA 1R20A 2QMVA 3TKCA 5DWEA 3V3EA 2Q7KA 1R5KA 1T7TA 4J26A 4R2UA 3B65A 3TX7B 4MG5A 3UUAA 5KRMA 1OSVA 2ZVTA 1XDKA 3CTBA 4LNWA 2ZXZA 3CDPA 1FCXA 1NQ2A 1FM6D 5DWIA 3W0AA 3WFGA 4MGBA 4FHIA 2P4YA 2AXAA 3WJ4A 3WTQA 1MZNA 5KRHA 2ZMJA 5DWJA 3ADWA 4MG6A 5E0WA 3B0WA 3KDUA 3OS9A 1NYXA 3P8XA 3ADTA 3F5CA 5E0XA 5G45A 2Q6JA 3UUCA 4PPPA 4YNKA 5DUGA 3FUGA 2IOKA 4FN9A 4N5GA 2ZBSA 3G8IA 1ILHA 5KRKA 3AUQA 1T76A 3L03A 4M8HA 2ZK6A 5KRAA 2Q7JA 4N1YA 4REEA 1NRLA 3OMQA 5DXKA 5ICKA 5HYRA 1ZKYA 4WLBA 1ZAFA 5KRFA 3W5RA 1S0XA 4NQAB 3ERDA 2I0GA 3K6PA 3OGTA 3R8IA 3KPZA 2A3IA 1VJBA 2HASA 2PRGA 1I7GA 4OKBA 1XNXA 1T74A 3O1EA 2OVHA 1Z95A 4RZFA 1XLSE 2POBA 2P7GA 5DYDA 5DSHA 4IV2A 2Q1VA 4Q13A 3FURA 3VTCA 2QGWA 3SP6A 1NQ1A 2BJ4A 1RDTA 3IPSA 2OM9A 4RMCA 3ZR7A 5FQVA 3FLIA 1DKFB 4WHFA 1XOWA 3VRWA 2ZNNA 3OOFA 5EITA 1X7JA 5DZIA 3RLLA 5DTVA 1U3RA 4ZNUA 4MGAB 5DZHA 4OJ4A 1XIUA 1Z5XE 3UU7A 2NW4A 5K13A 2GPUA 4MG9A 1X7BA 3OSAA 4IS8A 3BQDA 5AWJA 4XUMA 3CS6A 1WM0X 3B68A 1K74A 1ZGYA 1ZDTA 1QKUA 2Q59A 2HB8A 1Y9RA 2O9IA 4OZTE 3IMYA 1YMTA 3GYUA 5KCDA 4G1DA 1NDEA 4LTWA 3WFFA 2YJAB 5DKEA 4ZOMA 2PIOA 3NSQA 5G44A 1BSXA 3W5PA 2P1TA 3IXPA 2HARA 3LMPA 5AZTA 5DUHA 3JZBA 4TUZA 4UDAA 4QE8A 1RKGA 3KBAA 2HB7A 2YFEA 4OJ9A 3IA6A 3HC5A 5DP0A 3W0IA 4OK1A 1YP0A 2J7YA 3RVFA 3OMPA 4B7WA 3D57A 4QJRA 5G42A 1PZLA 1G1UA 1IE9A 1KKQA 1T7RA 2EWPA 2PIWA 3CDSA 3UUDA 3DZUA 3L3XA 3NSPA 1R20D 2YHDA 1YJEA 2GP7A 3DZYD 1UPWA 1XQ3A 4RUJA 1PK5A 4MG7A 4DM6A 5AAUA 1PCGA 3MNOA 2QNVA 4QE6A 4QM0A 5KCFA 2QZOA 2ATHA 2AWHA 2J4AA 3A78A 3ET2A 4OEDA 1YIMA 2PIVA 4HEEX 5DKSA 5HJSA 5KRIA 1RK3A 2I4JA 3OS8A 1X7EA 4PVUA 3WMHA 4PPSA 5CJ6A 3PCUA 5E19A 4DORA 2QW4A 3B66A 4G2HA 4UDCA 3JZCA 2R40D 1T73A 1UHLA 3GBKA 3HZFA 3HC6A 3LBDA 3VT3A 2GTKA 1GWRA 1S0ZA 4IQRA 3RUUA 1PDUA 4MGCA 2ZL9A 1SKXA 1GS4A 2YLQA 3FC6B 2OZ7A 2V7CA 2ZKCA 3A2IA 3VT8A 1ZEOA 3R5NA 4L98A 2Q70A 5ACCA 1X78A 1M2ZA 5DL4A 1G2NA 4MG9B 3FALA 2V0VA 2I4ZA 3HM1A 3IPQA 3HQ5A 4WVDA 5DLRA 5C4TA 3B0TA 2ZK4A 1Y0SA 2XYJA 3W5QA 3UVVA 1XJ7A 1Z5XU 4IW6A 2HWQA 4PRGA 4RE8A 3O1DA 2FVJA 5DUEA 5F9BA 5L11A 4PLDA 4K7AA 5DXBA 5DXEA 2NV7A 1I37A 4MG8A 2FSZA 2QA8A 5EHJA 3CQVA 3OKIA 2QR9A 1NAVA 2AX9A 4TUZB 2Q6SA 3RY9A 3N00A 1OSHA 4K4JA 1SR7A 4J5XA 1MV9A 4J5WA 1N83A 5DIEA 4JGVA 4OFRA 4A4VA 5GICA 4OHAA 1XP1A 3DCUA 4X1FA 4IVYA 5DXRA 2AMAA 3ET3A 2HVCA 5DZ0A 3T03A 3FS1A 3E7CA 1K74D 2G0GA 1G50A 4OZRU 5AAVB 4JYGA 3W0YA 4ZJRA 2PJLA 2ACLB 5DZ3A 1N46A 2G5OA 3D6DA 3VJHA 3KFCA 2ZY0A 4G20A 4OKXA 3V9VA 2R6WA 4FHHA 3OOKA 2YJDA 3IXPD 3GYTA 3CJWA 4RWVA 2OVMA 3A9EA 5AVIA 3CS4A 3R5MA 5HJPA 2NXXE 2VSTA 4E4KA 4O8FA 2ZK5A 5APHA 1M7WA 1L2JA 1QKMA 1T7FA 5FQRA 1E3GA 2XKWA 5C4UA 3W0HA 3DZUD 3DCTA 3E00D 4A2JA 4JYHA 3W5TA 1YINA 4NUFA 3ZRAA 4OLMA 5JY3A 4IVWA 1XLSA 3B67A 5M96A 3FALB 1LV2A 3OKHA 1XPCA 3ADVA 2VV1A 2XYXA 3B0QA 3DR1A 2HWRA 3ERTA 5JJMB 5LWPA 2P7AA 4S0TA 3VJTA 4REFA 1E3KA 2B1ZA 3KWYA 4YMQA 5KRCA 4CI4A 5DV6A 1YUCA 3OLLA 1XVPA 5FQSA 4IU7A 5DX3A 2VV4A 3OMKA 2AA5A 3W0JA 4IA1A 4G1ZA 2O4RA 3GD2A 1K4WA 3M7RA 2VV0A 2PKLA 4KZJA 1H9UA 1U9EA 3A2HA 4OJBA 4OKTA 3IPUA 5EI1A 4ITFA 4IA3A 1A28A 3ZRBA 2VV2A 1ERRA 2QABA 5B5BA 3KMGA 1HJ1A 4G21A 3SZ1A 1OVLA 3FC6A 1T65A 3VT4A 2AX7A 2ZK1A 4ITEA 4POJA 5AWKA 2QPYA 4PWLA 5C4SA 5KRLA 3Q95A 5KYJA 3VHWA 1I38A 1YOWA 1SJ0A 4DK7A 2G0HA 3A40X 3UUAB 5FQPA 4OEAA 1XDKB 5DVVA 1OT7A 4WHGA 5E1CA 5G43A 5DU5A 3VJSA 4EMAA 3G0WA 3H0AA 4BCRA 2ZNPA 5L7HA 5KRJA 4CSJA 2ZXNA 3AURA 3A9EB 2JFAA 4MGBB 3VT9A 4KZIA 5E7VA 1PQ9A 4IA2A 1G5YA 1Y0XX 5DRMA 4R06A 2ZFXA 4OH5A 3U9QA 1XB7A 2R6YA 2P15A 3F5CB 4J24A 2AA2A 1NQ0A 4ZO1X 2Q6RA 1FCYA 2PNUA 1P8DA 5DI7A 1T79A 5AYGA 2I0JA 1NUOA 4RZEA 1MVCA 3P88A 4TV1A 3R8AA 5DKGA 2O4JA 1RJKA 1GWQA 1FBYA 2W8YA 3MNEA 3R29A 3ET0A 2PITA 5A86A 2VV4B 1P93A 2I4PA 1EXXA 3K8SA 3OS8C 4OEZA 3VTDA 1TXIA 4S15A 3A2JA 4XHDA 5KR9A 3VT5A 2Q5GA 4APUA 5EJVA 2ZNQA 4ZNTA 1YYEA 4RUPA 4MGDA 3FEJA 5DRJA 1FM9A 5GIEA 2BJ4B 3KMRA 4LNXA 4OEYA 2J7XA 5L7EA 3H52A 2Q8SA 1U3SA 3PLZA 5G3JA 4YT1A 1N4HA 2JF9A 4PXMA 1U3QA 2ZK0A 5LGAA
chains in the Genus database with same CATH superfamily
2GPVA 3OMOA 4ZNVA 3UP3A 4DMAA 4JL4A 4S0SA 3BEJA 2AM9A 3FEIA 2B50A 2Q7IA 5C4OA 2Q59B 3B1MA 3L3ZA 4QL8A 2OUZA 4ZI1A 4OILA 4WQPA 3UU7B 5E15A 4OKWA 2OAXA 3TY0A 5DMCA 1NQ7A 2BAWA 2E2RA 5KCCA 4OZTU 3AFRA 1TFCA 5DZ1A 5DV8A 2IHQA 1RDTD 5DXMA 3V9TA 3X31A 4E4QA 4ZNHA 4DK8A 3UUDB 3RLJA 2YATA 2F4BA 5DXGA 2Z4JA 4G1YA 4IA7A 3ADUA 5IAWA 4MG7B 4G2IA 3VSOA 1UOMA 2QXSA 3WWRA 2QGTA 3OSIA 2NXXA 2IOGA 2QZOB 3AN3A 4FNEA 2QSEA 5DKBA 2ZNOA 2AX6A 2ZXMA 4OIUA 4POHA 2ZK2A 4Q50A 4ZNSA 2ZK3A 1FCZA 5DVCA 5G5WA 3VRUA 5APKA 2ABIA 5KCEA 2XYWA 2AB2A 3H0AD 5JI0D 3V4AA 4S14A 1Q4XA 1K7LA 5DIGA 1XZXX 1UHLB 3HVLA 3P89A 3WT6A 1XNNA 3GZ9A 2Q1HA 2PIRA 3PO9A 3E94A 3WT7A 5FQTA 3S9SA 3OZ0A 2AMBA 5AVLA 3VRVA 3VN2A 4NIEA 1ZDUA 2PIQA 3A3ZX 3ADSA 3DY6A 4PF3A 3X1IA 3X1HA 4ZN9A 3DZYA 4IV4A 3OLFA 2ZMIA 2H79A 4RMDA 2GPPA 2ZASA 4ZJWA 4ZN7A 1PQ6A 2QE4A 3GWXA 4ZNWA 5DVSA 3UVVB 4PLEA 3CLDA 5AZVA 3R8DA 5DXPA 1XV9A 5DXBB 1X7RA 4IWFA 4XLDA 5DWGA 4XAOA 1L2IA 1RKHA 2HC4A 4MG8B 5DXQA 5GIDA 5B41A 4DQMA 4KZMA 1KNUA 2QA8B 2R40A 3OAPA 3HLVA 4UDBA 2HCDA 3VT7A 1UPVA 1FM9D 4PP5A 5DK9A 1ZH7A 2XHSA 1S9PA 3F7DA 5HCVA 3KMZA 3NOAA 3PRGA 4OH6A 4P6XA 1GWXA 3GWSX 2GIUA 2PIPL 3SP9A 1ZUCA 2AYRA 2AO6A 2NPAA 2VV3A 3CS8A 5EC9A 4JYIA 5G46A 4RMEA 2QXMA 3MNPA 3TKMA 2GPOA 2QH6A 2AA7A 2AA6A 3AZ1A 3PEQA 4DM8A 1NHZA 4LBDA 3V9YA 4OFUA 4R6SA 2YLYA 3VI8A 4N8RA 4FGYA 1R6GA 4CI5A 1T63A 4P6WA 2G44A 1QKTA 4XT9A 4E2JA 4XI3A 2OCFA 2P7ZA 3VHVA 3WJ5A 4OGHA 1R1KA 2HAMA 1XP9A 2Z4BA 2QTUA 5I4VA 1YY4A 5HJPB 5KD9A 3B0RA 2ZLCA 4RUOX 5HYKA 3L1BA 3V3QA 3KDTA 3PBAA 3D90A 3R2AA 2GL8A 4Y29A 5APJA 5DWLA 2VV1B 3AN4A 4NB6A 3VHUA 3D24A 4X1GA 2AX8A 1M13A 1XP6A 2LBDA 4HLWA 4OIVA 3B5RA 5DMFA 5H1EA 3OLSA 1XV9B 4OARA 3ZQTA 2FAIA 1S9QA 4IW8A 4N73A 1XVPB 3EYBA 4EM9A 5DX3B 1XQCA 1QKNA 2QA6A 3VSPA 3HODA 1X76A 1FM6A 3WGPA 4DOSA 1FD0A 1SQNA 1IE8A 5KCUA 2PINA 2Q60A 1A52A 1NAXA 4OZRE 1DB1A 3BC5A 3E00A 3L0EA 4JAZA 4RZGA 1LBDA 5KCTA 1OVLB 3P0UA 3X36A 5KCWA 3W0GA 2Q7LA 5AAVA 4RAKA 1EREA 1KV6A 2ACLA 2Q61A 2POGA 3ILZA 3Q95B 3G9EA 4ONIA 2P54A 3W0CA 4QK4A 5HZCA 2Q5SA 3B3KA 5DY8A 5ETHA 2B23A 3VTBA 3AUNA 2AAXA 2P1VA 4A4WA 5GT4A 5DYBA 3VT6A 3HO0A 4IUIA 4F9MA 5L7GA 3AX8A 3UP0A 3OMMA 4M8EA 3KYTA 5E14A 4RFWA 2P1UA 4K6IA 2JFAB 3FXVA 4L96A 2YLOA 2JJ3A 3D5FA 3OZJA 4UDDA 4ZO1B 5SYZA 2ZLAA 3WT5A 4J5XC 1S19A 3ADXA 4J5WC 2PIUA 1ILGA 3AZ3A 2ZMHA 2Q3YA 2PIXA 4LSJA 5DV3A 2HFPA 1T5ZA 4Q0AC 3G8OA 1EXAA 4TV1B 4OC7A 5JJMA 5KYAA 2YLPA 4NY9A 1YA3A 3L0JA 3RUTA 3K22A 3OSWA 5EGVA 4PP3A 5DIDA 1YOKA 3DT3A 3GN8A 3K23A 4PP6A 1T7MA 2HBHA 3VRTA 4WPFA 5AK2A 3QT0A 3V49A 5KROA 4IWCA 4XTAA 1I7IA 2H77A 1R1KD 2Q5PA 2B1VA 3AZ2A 4MDDA 1PRGA 4XUHA 4YPQA 3ET1A 2J14A 4MGDB 3CWDA 5IZ0A 1DKFA 3VJIA 2REWA 5IXKA 2VSRA 1HG4A 1PQCA 3L0LA 4MGAA 1XAPA 2GWXA 1R20A 2QMVA 3TKCA 5DWEA 3V3EA 2Q7KA 1R5KA 1T7TA 4J26A 4R2UA 3B65A 3TX7B 4MG5A 3UUAA 5KRMA 1OSVA 2ZVTA 1XDKA 3CTBA 4LNWA 2ZXZA 3CDPA 1FCXA 1NQ2A 1FM6D 5DWIA 3W0AA 3WFGA 4MGBA 4FHIA 2P4YA 2AXAA 3WJ4A 3WTQA 1MZNA 5KRHA 2ZMJA 5DWJA 3ADWA 4MG6A 5E0WA 3B0WA 3KDUA 3OS9A 1NYXA 3P8XA 3ADTA 3F5CA 5E0XA 5G45A 2Q6JA 3UUCA 4PPPA 4YNKA 5DUGA 3FUGA 2IOKA 4FN9A 4N5GA 2ZBSA 3G8IA 1ILHA 5KRKA 3AUQA 1T76A 3L03A 4M8HA 2ZK6A 5KRAA 2Q7JA 4N1YA 4REEA 1NRLA 3OMQA 5DXKA 5ICKA 5HYRA 1ZKYA 4WLBA 1ZAFA 5KRFA 3W5RA 1S0XA 4NQAB 3ERDA 2I0GA 3K6PA 3OGTA 3R8IA 3KPZA 2A3IA 1VJBA 2HASA 2PRGA 1I7GA 4OKBA 1XNXA 1T74A 3O1EA 2OVHA 1Z95A 4RZFA 1XLSE 2POBA 2P7GA 5DYDA 5DSHA 4IV2A 2Q1VA 4Q13A 3FURA 3VTCA 2QGWA 3SP6A 1NQ1A 2BJ4A 1RDTA 3IPSA 2OM9A 4RMCA 3ZR7A 5FQVA 3FLIA 1DKFB 4WHFA 1XOWA 3VRWA 2ZNNA 3OOFA 5EITA 1X7JA 5DZIA 3RLLA 5DTVA 1U3RA 4ZNUA 4MGAB 5DZHA 4OJ4A 1XIUA 1Z5XE 3UU7A 2NW4A 5K13A 2GPUA 4MG9A 1X7BA 3OSAA 4IS8A 3BQDA 5AWJA 4XUMA 3CS6A 1WM0X 3B68A 1K74A 1ZGYA 1ZDTA 1QKUA 2Q59A 2HB8A 1Y9RA 2O9IA 4OZTE 3IMYA 1YMTA 3GYUA 5KCDA 4G1DA 1NDEA 4LTWA 3WFFA 2YJAB 5DKEA 4ZOMA 2PIOA 3NSQA 5G44A 1BSXA 3W5PA 2P1TA 3IXPA 2HARA 3LMPA 5AZTA 5DUHA 3JZBA 4TUZA 4UDAA 4QE8A 1RKGA 3KBAA 2HB7A 2YFEA 4OJ9A 3IA6A 3HC5A 5DP0A 3W0IA 4OK1A 1YP0A 2J7YA 3RVFA 3OMPA 4B7WA 3D57A 4QJRA 5G42A 1PZLA 1G1UA 1IE9A 1KKQA 1T7RA 2EWPA 2PIWA 3CDSA 3UUDA 3DZUA 3L3XA 3NSPA 1R20D 2YHDA 1YJEA 2GP7A 3DZYD 1UPWA 1XQ3A 4RUJA 1PK5A 4MG7A 4DM6A 5AAUA 1PCGA 3MNOA 2QNVA 4QE6A 4QM0A 5KCFA 2QZOA 2ATHA 2AWHA 2J4AA 3A78A 3ET2A 4OEDA 1YIMA 2PIVA 4HEEX 5DKSA 5HJSA 5KRIA 1RK3A 2I4JA 3OS8A 1X7EA 4PVUA 3WMHA 4PPSA 5CJ6A 3PCUA 5E19A 4DORA 2QW4A 3B66A 4G2HA 4UDCA 3JZCA 2R40D 1T73A 1UHLA 3GBKA 3HZFA 3HC6A 3LBDA 3VT3A 2GTKA 1GWRA 1S0ZA 4IQRA 3RUUA 1PDUA 4MGCA 2ZL9A 1SKXA 1GS4A 2YLQA 3FC6B 2OZ7A 2V7CA 2ZKCA 3A2IA 3VT8A 1ZEOA 3R5NA 4L98A 2Q70A 5ACCA 1X78A 1M2ZA 5DL4A 1G2NA 4MG9B 3FALA 2V0VA 2I4ZA 3HM1A 3IPQA 3HQ5A 4WVDA 5DLRA 5C4TA 3B0TA 2ZK4A 1Y0SA 2XYJA 3W5QA 3UVVA 1XJ7A 1Z5XU 4IW6A 2HWQA 4PRGA 4RE8A 3O1DA 2FVJA 5DUEA 5F9BA 5L11A 4PLDA 4K7AA 5DXBA 5DXEA 2NV7A 1I37A 4MG8A 2FSZA 2QA8A 5EHJA 3CQVA 3OKIA 2QR9A 1NAVA 2AX9A 4TUZB 2Q6SA 3RY9A 3N00A 1OSHA 4K4JA 1SR7A 4J5XA 1MV9A 4J5WA 1N83A 5DIEA 4JGVA 4OFRA 4A4VA 5GICA 4OHAA 1XP1A 3DCUA 4X1FA 4IVYA 5DXRA 2AMAA 3ET3A 2HVCA 5DZ0A 3T03A 3FS1A 3E7CA 1K74D 2G0GA 1G50A 4OZRU 5AAVB 4JYGA 3W0YA 4ZJRA 2PJLA 2ACLB 5DZ3A 1N46A 2G5OA 3D6DA 3VJHA 3KFCA 2ZY0A 4G20A 4OKXA 3V9VA 2R6WA 4FHHA 3OOKA 2YJDA 3IXPD 3GYTA 3CJWA 4RWVA 2OVMA 3A9EA 5AVIA 3CS4A 3R5MA 5HJPA 2NXXE 2VSTA 4E4KA 4O8FA 2ZK5A 5APHA 1M7WA 1L2JA 1QKMA 1T7FA 5FQRA 1E3GA 2XKWA 5C4UA 3W0HA 3DZUD 3DCTA 3E00D 4A2JA 4JYHA 3W5TA 1YINA 4NUFA 3ZRAA 4OLMA 5JY3A 4IVWA 1XLSA 3B67A 5M96A 3FALB 1LV2A 3OKHA 1XPCA 3ADVA 2VV1A 2XYXA 3B0QA 3DR1A 2HWRA 3ERTA 5JJMB 5LWPA 2P7AA 4S0TA 3VJTA 4REFA 1E3KA 2B1ZA 3KWYA 4YMQA 5KRCA 4CI4A 5DV6A 1YUCA 3OLLA 1XVPA 5FQSA 4IU7A 5DX3A 2VV4A 3OMKA 2AA5A 3W0JA 4IA1A 4G1ZA 2O4RA 3GD2A 1K4WA 3M7RA 2VV0A 2PKLA 4KZJA 1H9UA 1U9EA 3A2HA 4OJBA 4OKTA 3IPUA 5EI1A 4ITFA 4IA3A 1A28A 3ZRBA 2VV2A 1ERRA 2QABA 5B5BA 3KMGA 1HJ1A 4G21A 3SZ1A 1OVLA 3FC6A 1T65A 3VT4A 2AX7A 2ZK1A 4ITEA 4POJA 5AWKA 2QPYA 4PWLA 5C4SA 5KRLA 3Q95A 5KYJA 3VHWA 1I38A 1YOWA 1SJ0A 4DK7A 2G0HA 3A40X 3UUAB 5FQPA 4OEAA 1XDKB 5DVVA 1OT7A 4WHGA 5E1CA 5G43A 5DU5A 3VJSA 4EMAA 3G0WA 3H0AA 4BCRA 2ZNPA 5L7HA 5KRJA 4CSJA 2ZXNA 3AURA 3A9EB 2JFAA 4MGBB 3VT9A 4KZIA 5E7VA 1PQ9A 4IA2A 1G5YA 1Y0XX 5DRMA 4R06A 2ZFXA 4OH5A 3U9QA 1XB7A 2R6YA 2P15A 3F5CB 4J24A 2AA2A 1NQ0A 4ZO1X 2Q6RA 1FCYA 2PNUA 1P8DA 5DI7A 1T79A 5AYGA 2I0JA 1NUOA 4RZEA 1MVCA 3P88A 4TV1A 3R8AA 5DKGA 2O4JA 1RJKA 1GWQA 1FBYA 2W8YA 3MNEA 3R29A 3ET0A 2PITA 5A86A 2VV4B 1P93A 2I4PA 1EXXA 3K8SA 3OS8C 4OEZA 3VTDA 1TXIA 4S15A 3A2JA 4XHDA 5KR9A 3VT5A 2Q5GA 4APUA 5EJVA 2ZNQA 4ZNTA 1YYEA 4RUPA 4MGDA 3FEJA 5DRJA 1FM9A 5GIEA 2BJ4B 3KMRA 4LNXA 4OEYA 2J7XA 5L7EA 3H52A 2Q8SA 1U3SA 3PLZA 5G3JA 4YT1A 1N4HA 2JF9A 4PXMA 1U3QA 2ZK0A 5LGAA
chains in the Genus database with same CATH topology
2GPVA 3OMOA 4ZNVA 3UP3A 4DMAA 4JL4A 4S0SA 3BEJA 2AM9A 3FEIA 2B50A 2Q7IA 5C4OA 2Q59B 3B1MA 3L3ZA 4QL8A 2OUZA 4ZI1A 4OILA 4WQPA 3UU7B 5E15A 4OKWA 2OAXA 3TY0A 5DMCA 1NQ7A 2BAWA 2E2RA 5KCCA 4OZTU 3AFRA 1TFCA 5DZ1A 5DV8A 2IHQA 1RDTD 5DXMA 3V9TA 3X31A 4E4QA 4ZNHA 4DK8A 3UUDB 3RLJA 2YATA 2F4BA 5DXGA 2Z4JA 4G1YA 4IA7A 3ADUA 5IAWA 4MG7B 4G2IA 3VSOA 1UOMA 2QXSA 3WWRA 2QGTA 3OSIA 2NXXA 2IOGA 2QZOB 3AN3A 4FNEA 2QSEA 5DKBA 2ZNOA 2AX6A 2ZXMA 4OIUA 4POHA 2ZK2A 4Q50A 4ZNSA 2ZK3A 1FCZA 5DVCA 5G5WA 3VRUA 5APKA 2ABIA 5KCEA 2XYWA 2AB2A 3H0AD 5JI0D 3V4AA 4S14A 1Q4XA 1K7LA 5DIGA 1XZXX 1UHLB 3HVLA 3P89A 3WT6A 1XNNA 3GZ9A 2Q1HA 2PIRA 3PO9A 3E94A 3WT7A 5FQTA 3S9SA 3OZ0A 2AMBA 5AVLA 3VRVA 3VN2A 4NIEA 1ZDUA 2PIQA 3A3ZX 3ADSA 3DY6A 4PF3A 3X1IA 3X1HA 4ZN9A 3DZYA 4IV4A 3OLFA 2ZMIA 2H79A 4RMDA 2GPPA 2ZASA 4ZJWA 4ZN7A 1PQ6A 2QE4A 3GWXA 4ZNWA 5DVSA 3UVVB 4PLEA 3CLDA 5AZVA 3R8DA 5DXPA 1XV9A 5DXBB 1X7RA 4IWFA 4XLDA 5DWGA 4XAOA 1L2IA 1RKHA 2HC4A 4MG8B 5DXQA 5GIDA 5B41A 4DQMA 4KZMA 1KNUA 2QA8B 2R40A 3OAPA 3HLVA 4UDBA 2HCDA 3VT7A 1UPVA 1FM9D 4PP5A 5DK9A 1ZH7A 2XHSA 1S9PA 3F7DA 5HCVA 3KMZA 3NOAA 3PRGA 4OH6A 4P6XA 1GWXA 3GWSX 2GIUA 2PIPL 3SP9A 1ZUCA 2AYRA 2AO6A 2NPAA 2VV3A 3CS8A 5EC9A 4JYIA 5G46A 4RMEA 2QXMA 3MNPA 3TKMA 2GPOA 2QH6A 2AA7A 2AA6A 3AZ1A 3PEQA 4DM8A 1NHZA 4LBDA 3V9YA 4OFUA 4R6SA 2YLYA 3VI8A 4N8RA 4FGYA 1R6GA 4CI5A 1T63A 4P6WA 2G44A 1QKTA 4XT9A 4E2JA 4XI3A 2OCFA 2P7ZA 3VHVA 3WJ5A 4OGHA 1R1KA 2HAMA 1XP9A 2Z4BA 2QTUA 5I4VA 1YY4A 5HJPB 5KD9A 3B0RA 2ZLCA 4RUOX 5HYKA 3L1BA 3V3QA 3KDTA 3PBAA 3D90A 3R2AA 2GL8A 4Y29A 5APJA 5DWLA 2VV1B 3AN4A 4NB6A 3VHUA 3D24A 4X1GA 2AX8A 1M13A 1XP6A 2LBDA 4HLWA 4OIVA 3B5RA 5DMFA 5H1EA 3OLSA 1XV9B 4OARA 3ZQTA 2FAIA 1S9QA 4IW8A 4N73A 1XVPB 3EYBA 4EM9A 5DX3B 1XQCA 1QKNA 2QA6A 3VSPA 3HODA 1X76A 1FM6A 3WGPA 4DOSA 1FD0A 1SQNA 1IE8A 5KCUA 2PINA 2Q60A 1A52A 1NAXA 4OZRE 1DB1A 3BC5A 3E00A 3L0EA 4JAZA 4RZGA 1LBDA 5KCTA 1OVLB 3P0UA 3X36A 5KCWA 3W0GA 2Q7LA 5AAVA 4RAKA 1EREA 1KV6A 2ACLA 2Q61A 2POGA 3ILZA 3Q95B 3G9EA 4ONIA 2P54A 3W0CA 4QK4A 5HZCA 2Q5SA 3B3KA 5DY8A 5ETHA 2B23A 3VTBA 3AUNA 2AAXA 2P1VA 4A4WA 5GT4A 5DYBA 3VT6A 3HO0A 4IUIA 4F9MA 5L7GA 3AX8A 3UP0A 3OMMA 4M8EA 3KYTA 5E14A 4RFWA 2P1UA 4K6IA 2JFAB 3FXVA 4L96A 2YLOA 2JJ3A 3D5FA 3OZJA 4UDDA 4ZO1B 5SYZA 2ZLAA 3WT5A 4J5XC 1S19A 3ADXA 4J5WC 2PIUA 1ILGA 3AZ3A 2ZMHA 2Q3YA 2PIXA 4LSJA 5DV3A 2HFPA 1T5ZA 4Q0AC 3G8OA 1EXAA 4TV1B 4OC7A 5JJMA 5KYAA 2YLPA 4NY9A 1YA3A 3L0JA 3RUTA 3K22A 3OSWA 5EGVA 4PP3A 5DIDA 1YOKA 3DT3A 3GN8A 3K23A 4PP6A 1T7MA 2HBHA 3VRTA 4WPFA 5AK2A 3QT0A 3V49A 5KROA 4IWCA 4XTAA 1I7IA 2H77A 1R1KD 2Q5PA 2B1VA 3AZ2A 4MDDA 1PRGA 4XUHA 4YPQA 3ET1A 2J14A 4MGDB 3CWDA 5IZ0A 1DKFA 3VJIA 2REWA 5IXKA 2VSRA 1HG4A 1PQCA 3L0LA 4MGAA 1XAPA 2GWXA 1R20A 2QMVA 3TKCA 5DWEA 3V3EA 2Q7KA 1R5KA 1T7TA 4J26A 4R2UA 3B65A 3TX7B 4MG5A 3UUAA 5KRMA 1OSVA 2ZVTA 1XDKA 3CTBA 4LNWA 2ZXZA 3CDPA 1FCXA 1NQ2A 1FM6D 5DWIA 3W0AA 3WFGA 4MGBA 4FHIA 2P4YA 2AXAA 3WJ4A 3WTQA 1MZNA 5KRHA 2ZMJA 5DWJA 3ADWA 4MG6A 5E0WA 3B0WA 3KDUA 3OS9A 1NYXA 3P8XA 3ADTA 3F5CA 5E0XA 5G45A 2Q6JA 3UUCA 4PPPA 4YNKA 5DUGA 3FUGA 2IOKA 4FN9A 4N5GA 2ZBSA 3G8IA 1ILHA 5KRKA 3AUQA 1T76A 3L03A 4M8HA 2ZK6A 5KRAA 2Q7JA 4N1YA 4REEA 1NRLA 3OMQA 5DXKA 5ICKA 5HYRA 1ZKYA 4WLBA 1ZAFA 5KRFA 3W5RA 1S0XA 4NQAB 3ERDA 2I0GA 3K6PA 3OGTA 3R8IA 3KPZA 2A3IA 1VJBA 2HASA 2PRGA 1I7GA 4OKBA 1XNXA 1T74A 3O1EA 2OVHA 1Z95A 4RZFA 1XLSE 2POBA 2P7GA 5DYDA 5DSHA 4IV2A 2Q1VA 4Q13A 3FURA 3VTCA 2QGWA 3SP6A 1NQ1A 2BJ4A 1RDTA 3IPSA 2OM9A 4RMCA 3ZR7A 5FQVA 3FLIA 1DKFB 4WHFA 1XOWA 3VRWA 2ZNNA 3OOFA 5EITA 1X7JA 5DZIA 3RLLA 5DTVA 1U3RA 4ZNUA 4MGAB 5DZHA 4OJ4A 1XIUA 1Z5XE 3UU7A 2NW4A 5K13A 2GPUA 4MG9A 1X7BA 3OSAA 4IS8A 3BQDA 5AWJA 4XUMA 3CS6A 1WM0X 3B68A 1K74A 1ZGYA 1ZDTA 1QKUA 2Q59A 2HB8A 1Y9RA 2O9IA 4OZTE 3IMYA 1YMTA 3GYUA 5KCDA 4G1DA 1NDEA 4LTWA 3WFFA 2YJAB 5DKEA 4ZOMA 2PIOA 3NSQA 5G44A 1BSXA 3W5PA 2P1TA 3IXPA 2HARA 3LMPA 5AZTA 5DUHA 3JZBA 4TUZA 4UDAA 4QE8A 1RKGA 3KBAA 2HB7A 2YFEA 4OJ9A 3IA6A 3HC5A 5DP0A 3W0IA 4OK1A 1YP0A 2J7YA 3RVFA 3OMPA 4B7WA 3D57A 4QJRA 5G42A 1PZLA 1G1UA 1IE9A 1KKQA 1T7RA 2EWPA 2PIWA 3CDSA 3UUDA 3DZUA 3L3XA 3NSPA 1R20D 2YHDA 1YJEA 2GP7A 3DZYD 1UPWA 1XQ3A 4RUJA 1PK5A 4MG7A 4DM6A 5AAUA 1PCGA 3MNOA 2QNVA 4QE6A 4QM0A 5KCFA 2QZOA 2ATHA 2AWHA 2J4AA 3A78A 3ET2A 4OEDA 1YIMA 2PIVA 4HEEX 5DKSA 5HJSA 5KRIA 1RK3A 2I4JA 3OS8A 1X7EA 4PVUA 3WMHA 4PPSA 5CJ6A 3PCUA 5E19A 4DORA 2QW4A 3B66A 4G2HA 4UDCA 3JZCA 2R40D 1T73A 1UHLA 3GBKA 3HZFA 3HC6A 3LBDA 3VT3A 2GTKA 1GWRA 1S0ZA 4IQRA 3RUUA 1PDUA 4MGCA 2ZL9A 1SKXA 1GS4A 2YLQA 3FC6B 2OZ7A 2V7CA 2ZKCA 3A2IA 3VT8A 1ZEOA 3R5NA 4L98A 2Q70A 5ACCA 1X78A 1M2ZA 5DL4A 1G2NA 4MG9B 3FALA 2V0VA 2I4ZA 3HM1A 3IPQA 3HQ5A 4WVDA 5DLRA 5C4TA 3B0TA 2ZK4A 1Y0SA 2XYJA 3W5QA 3UVVA 1XJ7A 1Z5XU 4IW6A 2HWQA 4PRGA 4RE8A 3O1DA 2FVJA 5DUEA 5F9BA 5L11A 4PLDA 4K7AA 5DXBA 5DXEA 2NV7A 1I37A 4MG8A 2FSZA 2QA8A 5EHJA 3CQVA 3OKIA 2QR9A 1NAVA 2AX9A 4TUZB 2Q6SA 3RY9A 3N00A 1OSHA 4K4JA 1SR7A 4J5XA 1MV9A 4J5WA 1N83A 5DIEA 4JGVA 4OFRA 4A4VA 5GICA 4OHAA 1XP1A 3DCUA 4X1FA 4IVYA 5DXRA 2AMAA 3ET3A 2HVCA 5DZ0A 3T03A 3FS1A 3E7CA 1K74D 2G0GA 1G50A 4OZRU 5AAVB 4JYGA 3W0YA 4ZJRA 2PJLA 2ACLB 5DZ3A 1N46A 2G5OA 3D6DA 3VJHA 3KFCA 2ZY0A 4G20A 4OKXA 3V9VA 2R6WA 4FHHA 3OOKA 2YJDA 3IXPD 3GYTA 3CJWA 4RWVA 2OVMA 3A9EA 5AVIA 3CS4A 3R5MA 5HJPA 2NXXE 2VSTA 4E4KA 4O8FA 2ZK5A 5APHA 1M7WA 1L2JA 1QKMA 1T7FA 5FQRA 1E3GA 2XKWA 5C4UA 3W0HA 3DZUD 3DCTA 3E00D 4A2JA 4JYHA 3W5TA 1YINA 4NUFA 3ZRAA 4OLMA 5JY3A 4IVWA 1XLSA 3B67A 5M96A 3FALB 1LV2A 3OKHA 1XPCA 3ADVA 2VV1A 2XYXA 3B0QA 3DR1A 2HWRA 3ERTA 5JJMB 5LWPA 2P7AA 4S0TA 3VJTA 4REFA 1E3KA 2B1ZA 3KWYA 4YMQA 5KRCA 4CI4A 5DV6A 1YUCA 3OLLA 1XVPA 5FQSA 4IU7A 5DX3A 2VV4A 3OMKA 2AA5A 3W0JA 4IA1A 4G1ZA 2O4RA 3GD2A 1K4WA 3M7RA 2VV0A 2PKLA 4KZJA 1H9UA 1U9EA 3A2HA 4OJBA 4OKTA 3IPUA 5EI1A 4ITFA 4IA3A 1A28A 3ZRBA 2VV2A 1ERRA 2QABA 5B5BA 3KMGA 1HJ1A 4G21A 3SZ1A 1OVLA 3FC6A 1T65A 3VT4A 2AX7A 2ZK1A 4ITEA 4POJA 5AWKA 2QPYA 4PWLA 5C4SA 5KRLA 3Q95A 5KYJA 3VHWA 1I38A 1YOWA 1SJ0A 4DK7A 2G0HA 3A40X 3UUAB 5FQPA 4OEAA 1XDKB 5DVVA 1OT7A 4WHGA 5E1CA 5G43A 5DU5A 3VJSA 4EMAA 3G0WA 3H0AA 4BCRA 2ZNPA 5L7HA 5KRJA 4CSJA 2ZXNA 3AURA 3A9EB 2JFAA 4MGBB 3VT9A 4KZIA 5E7VA 1PQ9A 4IA2A 1G5YA 1Y0XX 5DRMA 4R06A 2ZFXA 4OH5A 3U9QA 1XB7A 2R6YA 2P15A 3F5CB 4J24A 2AA2A 1NQ0A 4ZO1X 2Q6RA 1FCYA 2PNUA 1P8DA 5DI7A 1T79A 5AYGA 2I0JA 1NUOA 4RZEA 1MVCA 3P88A 4TV1A 3R8AA 5DKGA 2O4JA 1RJKA 1GWQA 1FBYA 2W8YA 3MNEA 3R29A 3ET0A 2PITA 5A86A 2VV4B 1P93A 2I4PA 1EXXA 3K8SA 3OS8C 4OEZA 3VTDA 1TXIA 4S15A 3A2JA 4XHDA 5KR9A 3VT5A 2Q5GA 4APUA 5EJVA 2ZNQA 4ZNTA 1YYEA 4RUPA 4MGDA 3FEJA 5DRJA 1FM9A 5GIEA 2BJ4B 3KMRA 4LNXA 4OEYA 2J7XA 5L7EA 3H52A 2Q8SA 1U3SA 3PLZA 5G3JA 4YT1A 1N4HA 2JF9A 4PXMA 1U3QA 2ZK0A 5LGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPV A;  3OMO A;  4ZNV A;  3UP3 A;  4DMA A;  4JL4 A;  4S0S A;  3BEJ A;  2AM9 A;  3FEI A;  2B50 A;  2Q7I A;  5C4O A;  2Q59 B;  3B1M A;  3L3Z A;  4QL8 A;  2OUZ A;  4ZI1 A;  4OIL A;  4WQP A;  3UU7 B;  5E15 A;  4OKW A;  2OAX A;  3TY0 A;  5DMC A;  1NQ7 A;  2BAW A;  2E2R A;  5KCC A;  4OZT U;  3AFR A;  1TFC A;  5DZ1 A;  5DV8 A;  2IHQ A;  1RDT D;  5DXM A;  3V9T A;  3X31 A;  4E4Q A;  4ZNH A;  4DK8 A;  3UUD B;  3RLJ A;  2YAT A;  2F4B A;  5DXG A;  2Z4J A;  4G1Y A;  4IA7 A;  3ADU A;  5IAW A;  4MG7 B;  4G2I A;  3VSO A;  1UOM A;  2QXS A;  3WWR A;  2QGT A;  3OSI A;  2NXX A;  2IOG A;  2QZO B;  3AN3 A;  4FNE A;  2QSE A;  5DKB A;  2ZNO A;  2AX6 A;  2ZXM A;  4OIU A;  4POH A;  2ZK2 A;  4Q50 A;  4ZNS A;  2ZK3 A;  1FCZ A;  5DVC A;  5G5W A;  3VRU A;  5APK A;  2ABI A;  5KCE A;  2XYW A;  2AB2 A;  3H0A D;  5JI0 D;  3V4A A;  4S14 A;  1Q4X A;  1K7L A;  5DIG A;  1XZX X;  1UHL B;  3HVL A;  3P89 A;  3WT6 A;  1XNN A;  3GZ9 A;  2Q1H A;  2PIR A;  3PO9 A;  3E94 A;  3WT7 A;  5FQT A;  3S9S A;  3OZ0 A;  2AMB A;  5AVL A;  3VRV A;  3VN2 A;  4NIE A;  1ZDU A;  2PIQ A;  3A3Z X;  3ADS A;  3DY6 A;  4PF3 A;  3X1I A;  3X1H A;  4ZN9 A;  3DZY A;  4IV4 A;  3OLF A;  2ZMI A;  2H79 A;  4RMD A;  2GPP A;  2ZAS A;  4ZJW A;  4ZN7 A;  1PQ6 A;  2QE4 A;  3GWX A;  4ZNW A;  5DVS A;  3UVV B;  4PLE A;  3CLD A;  5AZV A;  3R8D A;  5DXP A;  1XV9 A;  5DXB B;  1X7R A;  4IWF A;  4XLD A;  5DWG A;  4XAO A;  1L2I A;  1RKH A;  2HC4 A;  4MG8 B;  5DXQ A;  5GID A;  5B41 A;  4DQM A;  4KZM A;  1KNU A;  2QA8 B;  2R40 A;  3OAP A;  3HLV A;  4UDB A;  2HCD A;  3VT7 A;  1UPV A;  1FM9 D;  4PP5 A;  5DK9 A;  1ZH7 A;  2XHS A;  1S9P A;  3F7D A;  5HCV A;  3KMZ A;  3NOA A;  3PRG A;  4OH6 A;  4P6X A;  1GWX A;  3GWS X;  2GIU A;  2PIP L;  3SP9 A;  1ZUC A;  2AYR A;  2AO6 A;  2NPA A;  2VV3 A;  3CS8 A;  5EC9 A;  4JYI A;  5G46 A;  4RME A;  2QXM A;  3MNP A;  3TKM A;  2GPO A;  2QH6 A;  2AA7 A;  2AA6 A;  3AZ1 A;  3PEQ A;  4DM8 A;  1NHZ A;  4LBD A;  3V9Y A;  4OFU A;  4R6S A;  2YLY A;  3VI8 A;  4N8R A;  4FGY A;  1R6G A;  4CI5 A;  1T63 A;  4P6W A;  2G44 A;  1QKT A;  4XT9 A;  4E2J A;  4XI3 A;  2OCF A;  2P7Z A;  3VHV A;  3WJ5 A;  4OGH A;  1R1K A;  2HAM A;  1XP9 A;  2Z4B A;  2QTU A;  5I4V A;  1YY4 A;  5HJP B;  5KD9 A;  3B0R A;  2ZLC A;  4RUO X;  5HYK A;  3L1B A;  3V3Q A;  3KDT A;  3PBA A;  3D90 A;  3R2A A;  2GL8 A;  4Y29 A;  5APJ A;  5DWL A;  2VV1 B;  3AN4 A;  4NB6 A;  3VHU A;  3D24 A;  4X1G A;  2AX8 A;  1M13 A;  1XP6 A;  2LBD A;  4HLW A;  4OIV A;  3B5R A;  5DMF A;  5H1E A;  3OLS A;  1XV9 B;  4OAR A;  3ZQT A;  2FAI A;  1S9Q A;  4IW8 A;  4N73 A;  1XVP B;  3EYB A;  4EM9 A;  5DX3 B;  1XQC A;  1QKN A;  2QA6 A;  3VSP A;  3HOD A;  1X76 A;  1FM6 A;  3WGP A;  4DOS A;  1FD0 A;  1SQN A;  1IE8 A;  5KCU A;  2PIN A;  2Q60 A;  1A52 A;  1NAX A;  4OZR E;  1DB1 A;  3BC5 A;  3E00 A;  3L0E A;  4JAZ A;  4RZG A;  1LBD A;  5KCT A;  1OVL B;  3P0U A;  3X36 A;  5KCW A;  3W0G A;  2Q7L A;  5AAV A;  4RAK A;  1ERE A;  1KV6 A;  2ACL A;  2Q61 A;  2POG A;  3ILZ A;  3Q95 B;  3G9E A;  4ONI A;  2P54 A;  3W0C A;  4QK4 A;  5HZC A;  2Q5S A;  3B3K A;  5DY8 A;  5ETH A;  2B23 A;  3VTB A;  3AUN A;  2AAX A;  2P1V A;  4A4W A;  5GT4 A;  5DYB A;  3VT6 A;  3HO0 A;  4IUI A;  4F9M A;  5L7G A;  3AX8 A;  3UP0 A;  3OMM A;  4M8E A;  3KYT A;  5E14 A;  4RFW A;  2P1U A;  4K6I A;  2JFA B;  3FXV A;  4L96 A;  2YLO A;  2JJ3 A;  3D5F A;  3OZJ A;  4UDD A;  4ZO1 B;  5SYZ A;  2ZLA A;  3WT5 A;  4J5X C;  1S19 A;  3ADX A;  4J5W C;  2PIU A;  1ILG A;  3AZ3 A;  2ZMH A;  2Q3Y A;  2PIX A;  4LSJ A;  5DV3 A;  2HFP A;  1T5Z A;  4Q0A C;  3G8O A;  1EXA A;  4TV1 B;  4OC7 A;  5JJM A;  5KYA A;  2YLP A;  4NY9 A;  1YA3 A;  3L0J A;  3RUT A;  3K22 A;  3OSW A;  5EGV A;  4PP3 A;  5DID A;  1YOK A;  3DT3 A;  3GN8 A;  3K23 A;  4PP6 A;  1T7M A;  2HBH A;  3VRT A;  4WPF A;  5AK2 A;  3QT0 A;  3V49 A;  5KRO A;  4IWC A;  4XTA A;  1I7I A;  2H77 A;  1R1K D;  2Q5P A;  2B1V A;  3AZ2 A;  4MDD A;  1PRG A;  4XUH A;  4YPQ A;  3ET1 A;  2J14 A;  4MGD B;  3CWD A;  5IZ0 A;  1DKF A;  3VJI A;  2REW A;  5IXK A;  2VSR A;  1HG4 A;  1PQC A;  3L0L A;  4MGA A;  1XAP A;  2GWX A;  1R20 A;  2QMV A;  3TKC A;  5DWE A;  3V3E A;  2Q7K A;  1R5K A;  1T7T A;  4J26 A;  4R2U A;  3B65 A;  3TX7 B;  4MG5 A;  3UUA A;  5KRM A;  1OSV A;  2ZVT A;  1XDK A;  3CTB A;  4LNW A;  2ZXZ A;  3CDP A;  1FCX A;  1NQ2 A;  1FM6 D;  5DWI A;  3W0A A;  3WFG A;  4MGB A;  4FHI A;  2P4Y A;  2AXA A;  3WJ4 A;  3WTQ A;  1MZN A;  5KRH A;  2ZMJ A;  5DWJ A;  3ADW A;  4MG6 A;  5E0W A;  3B0W A;  3KDU A;  3OS9 A;  1NYX A;  3P8X A;  3ADT A;  3F5C A;  5E0X A;  5G45 A;  2Q6J A;  3UUC A;  4PPP A;  4YNK A;  5DUG A;  3FUG A;  2IOK A;  4FN9 A;  4N5G A;  2ZBS A;  3G8I A;  1ILH A;  5KRK A;  3AUQ A;  1T76 A;  3L03 A;  4M8H A;  2ZK6 A;  5KRA A;  2Q7J A;  4N1Y A;  4REE A;  1NRL A;  3OMQ A;  5DXK A;  5ICK A;  5HYR A;  1ZKY A;  4WLB A;  1ZAF A;  5KRF A;  3W5R A;  1S0X A;  4NQA B;  3ERD A;  2I0G A;  3K6P A;  3OGT A;  3R8I A;  3KPZ A;  2A3I A;  1VJB A;  2HAS A;  2PRG A;  1I7G A;  4OKB A;  1XNX A;  1T74 A;  3O1E A;  2OVH A;  1Z95 A;  4RZF A;  1XLS E;  2POB A;  2P7G A;  5DYD A;  5DSH A;  4IV2 A;  2Q1V A;  4Q13 A;  3FUR A;  3VTC A;  2QGW A;  3SP6 A;  1NQ1 A;  2BJ4 A;  1RDT A;  3IPS A;  2OM9 A;  4RMC A;  3ZR7 A;  5FQV A;  3FLI A;  1DKF B;  4WHF A;  1XOW A;  3VRW A;  2ZNN A;  3OOF A;  5EIT A;  1X7J A;  5DZI A;  3RLL A;  5DTV A;  1U3R A;  4ZNU A;  4MGA B;  5DZH A;  4OJ4 A;  1XIU A;  1Z5X E;  3UU7 A;  2NW4 A;  5K13 A;  2GPU A;  4MG9 A;  1X7B A;  3OSA A;  4IS8 A;  3BQD A;  5AWJ A;  4XUM A;  3CS6 A;  1WM0 X;  3B68 A;  1K74 A;  1ZGY A;  1ZDT A;  1QKU A;  2Q59 A;  2HB8 A;  1Y9R A;  2O9I A;  4OZT E;  3IMY A;  1YMT A;  3GYU A;  5KCD A;  4G1D A;  1NDE A;  4LTW A;  3WFF A;  2YJA B;  5DKE A;  4ZOM A;  2PIO A;  3NSQ A;  5G44 A;  1BSX A;  3W5P A;  2P1T A;  3IXP A;  2HAR A;  3LMP A;  5AZT A;  5DUH A;  3JZB A;  4TUZ A;  4UDA A;  4QE8 A;  1RKG A;  3KBA A;  2HB7 A;  2YFE A;  4OJ9 A;  3IA6 A;  3HC5 A;  5DP0 A;  3W0I A;  4OK1 A;  1YP0 A;  2J7Y A;  3RVF A;  3OMP A;  4B7W A;  3D57 A;  4QJR A;  5G42 A;  1PZL A;  1G1U A;  1IE9 A;  1KKQ A;  1T7R A;  2EWP A;  2PIW A;  3CDS A;  3UUD A;  3DZU A;  3L3X A;  3NSP A;  1R20 D;  2YHD A;  1YJE A;  2GP7 A;  3DZY D;  1UPW A;  1XQ3 A;  4RUJ A;  1PK5 A;  4MG7 A;  4DM6 A;  5AAU A;  1PCG A;  3MNO A;  2QNV A;  4QE6 A;  4QM0 A;  5KCF A;  2QZO A;  2ATH A;  2AWH A;  2J4A A;  3A78 A;  3ET2 A;  4OED A;  1YIM A;  2PIV A;  4HEE X;  5DKS A;  5HJS A;  5KRI A;  1RK3 A;  2I4J A;  3OS8 A;  1X7E A;  4PVU A;  3WMH A;  4PPS A;  5CJ6 A;  3PCU A;  5E19 A;  4DOR A;  2QW4 A;  3B66 A;  4G2H A;  4UDC A;  3JZC A;  2R40 D;  1T73 A;  1UHL A;  3GBK A;  3HZF A;  3HC6 A;  3LBD A;  3VT3 A;  2GTK A;  1GWR A;  1S0Z A;  4IQR A;  3RUU A;  1PDU A;  4MGC A;  2ZL9 A;  1SKX A;  1GS4 A;  2YLQ A;  3FC6 B;  2OZ7 A;  2V7C A;  2ZKC A;  3A2I A;  3VT8 A;  1ZEO A;  3R5N A;  4L98 A;  2Q70 A;  5ACC A;  1X78 A;  1M2Z A;  5DL4 A;  1G2N A;  4MG9 B;  3FAL A;  2V0V A;  2I4Z A;  3HM1 A;  3IPQ A;  3HQ5 A;  4WVD A;  5DLR A;  5C4T A;  3B0T A;  2ZK4 A;  1Y0S A;  2XYJ A;  3W5Q A;  3UVV A;  1XJ7 A;  1Z5X U;  4IW6 A;  2HWQ A;  4PRG A;  4RE8 A;  3O1D A;  2FVJ A;  5DUE A;  5F9B A;  5L11 A;  4PLD A;  4K7A A;  5DXB A;  5DXE A;  2NV7 A;  1I37 A;  4MG8 A;  2FSZ A;  2QA8 A;  5EHJ A;  3CQV A;  3OKI A;  2QR9 A;  1NAV A;  2AX9 A;  4TUZ B;  2Q6S A;  3RY9 A;  3N00 A;  1OSH A;  4K4J A;  1SR7 A;  4J5X A;  1MV9 A;  4J5W A;  1N83 A;  5DIE A;  4JGV A;  4OFR A;  4A4V A;  5GIC A;  4OHA A;  1XP1 A;  3DCU A;  4X1F A;  4IVY A;  5DXR A;  2AMA A;  3ET3 A;  2HVC A;  5DZ0 A;  3T03 A;  3FS1 A;  3E7C A;  1K74 D;  2G0G A;  1G50 A;  4OZR U;  5AAV B;  4JYG A;  3W0Y A;  4ZJR A;  2PJL A;  2ACL B;  5DZ3 A;  1N46 A;  2G5O A;  3D6D A;  3VJH A;  3KFC A;  2ZY0 A;  4G20 A;  4OKX A;  3V9V A;  2R6W A;  4FHH A;  3OOK A;  2YJD A;  3IXP D;  3GYT A;  3CJW A;  4RWV A;  2OVM A;  3A9E A;  5AVI A;  3CS4 A;  3R5M A;  5HJP A;  2NXX E;  2VST A;  4E4K A;  4O8F A;  2ZK5 A;  5APH A;  1M7W A;  1L2J A;  1QKM A;  1T7F A;  5FQR A;  1E3G A;  2XKW A;  5C4U A;  3W0H A;  3DZU D;  3DCT A;  3E00 D;  4A2J A;  4JYH A;  3W5T A;  1YIN A;  4NUF A;  3ZRA A;  4OLM A;  5JY3 A;  4IVW A;  1XLS A;  3B67 A;  5M96 A;  3FAL B;  1LV2 A;  3OKH A;  1XPC A;  3ADV A;  2VV1 A;  2XYX A;  3B0Q A;  3DR1 A;  2HWR A;  3ERT A;  5JJM B;  5LWP A;  2P7A A;  4S0T A;  3VJT A;  4REF A;  1E3K A;  2B1Z A;  3KWY A;  4YMQ A;  5KRC A;  4CI4 A;  5DV6 A;  1YUC A;  3OLL A;  1XVP A;  5FQS A;  4IU7 A;  5DX3 A;  2VV4 A;  3OMK A;  2AA5 A;  3W0J A;  4IA1 A;  4G1Z A;  2O4R A;  3GD2 A;  1K4W A;  3M7R A;  2VV0 A;  2PKL A;  4KZJ A;  1H9U A;  1U9E A;  3A2H A;  4OJB A;  4OKT A;  3IPU A;  5EI1 A;  4ITF A;  4IA3 A;  1A28 A;  3ZRB A;  2VV2 A;  1ERR A;  2QAB A;  5B5B A;  3KMG A;  1HJ1 A;  4G21 A;  3SZ1 A;  1OVL A;  3FC6 A;  1T65 A;  3VT4 A;  2AX7 A;  2ZK1 A;  4ITE A;  4POJ A;  5AWK A;  2QPY A;  4PWL A;  5C4S A;  5KRL A;  3Q95 A;  5KYJ A;  3VHW A;  1I38 A;  1YOW A;  1SJ0 A;  4DK7 A;  2G0H A;  3A40 X;  3UUA B;  5FQP A;  4OEA A;  1XDK B;  5DVV A;  1OT7 A;  4WHG A;  5E1C A;  5G43 A;  5DU5 A;  3VJS A;  4EMA A;  3G0W A;  3H0A A;  4BCR A;  2ZNP A;  5L7H A;  5KRJ A;  4CSJ A;  2ZXN A;  3AUR A;  3A9E B;  2JFA A;  4MGB B;  3VT9 A;  4KZI A;  5E7V A;  1PQ9 A;  4IA2 A;  1G5Y A;  1Y0X X;  5DRM A;  4R06 A;  2ZFX A;  4OH5 A;  3U9Q A;  1XB7 A;  2R6Y A;  2P15 A;  3F5C B;  4J24 A;  2AA2 A;  1NQ0 A;  4ZO1 X;  2Q6R A;  1FCY A;  2PNU A;  1P8D A;  5DI7 A;  1T79 A;  5AYG A;  2I0J A;  1NUO A;  4RZE A;  1MVC A;  3P88 A;  4TV1 A;  3R8A A;  5DKG A;  2O4J A;  1RJK A;  1GWQ A;  1FBY A;  2W8Y A;  3MNE A;  3R29 A;  3ET0 A;  2PIT A;  5A86 A;  2VV4 B;  1P93 A;  2I4P A;  1EXX A;  3K8S A;  3OS8 C;  4OEZ A;  3VTD A;  1TXI A;  4S15 A;  3A2J A;  4XHD A;  5KR9 A;  3VT5 A;  2Q5G A;  4APU A;  5EJV A;  2ZNQ A;  4ZNT A;  1YYE A;  4RUP A;  4MGD A;  3FEJ A;  5DRJ A;  1FM9 A;  5GIE A;  2BJ4 B;  3KMR A;  4LNX A;  4OEY A;  2J7X A;  5L7E A;  3H52 A;  2Q8S A;  1U3S A;  3PLZ A;  5G3J A;  4YT1 A;  1N4H A;  2JF9 A;  4PXM A;  1U3Q A;  2ZK0 A;  5LGA A; 
#chains in the Genus database with same CATH topology
 2GPV A;  3OMO A;  4ZNV A;  3UP3 A;  4DMA A;  4JL4 A;  4S0S A;  3BEJ A;  2AM9 A;  3FEI A;  2B50 A;  2Q7I A;  5C4O A;  2Q59 B;  3B1M A;  3L3Z A;  4QL8 A;  2OUZ A;  4ZI1 A;  4OIL A;  4WQP A;  3UU7 B;  5E15 A;  4OKW A;  2OAX A;  3TY0 A;  5DMC A;  1NQ7 A;  2BAW A;  2E2R A;  5KCC A;  4OZT U;  3AFR A;  1TFC A;  5DZ1 A;  5DV8 A;  2IHQ A;  1RDT D;  5DXM A;  3V9T A;  3X31 A;  4E4Q A;  4ZNH A;  4DK8 A;  3UUD B;  3RLJ A;  2YAT A;  2F4B A;  5DXG A;  2Z4J A;  4G1Y A;  4IA7 A;  3ADU A;  5IAW A;  4MG7 B;  4G2I A;  3VSO A;  1UOM A;  2QXS A;  3WWR A;  2QGT A;  3OSI A;  2NXX A;  2IOG A;  2QZO B;  3AN3 A;  4FNE A;  2QSE A;  5DKB A;  2ZNO A;  2AX6 A;  2ZXM A;  4OIU A;  4POH A;  2ZK2 A;  4Q50 A;  4ZNS A;  2ZK3 A;  1FCZ A;  5DVC A;  5G5W A;  3VRU A;  5APK A;  2ABI A;  5KCE A;  2XYW A;  2AB2 A;  3H0A D;  5JI0 D;  3V4A A;  4S14 A;  1Q4X A;  1K7L A;  5DIG A;  1XZX X;  1UHL B;  3HVL A;  3P89 A;  3WT6 A;  1XNN A;  3GZ9 A;  2Q1H A;  2PIR A;  3PO9 A;  3E94 A;  3WT7 A;  5FQT A;  3S9S A;  3OZ0 A;  2AMB A;  5AVL A;  3VRV A;  3VN2 A;  4NIE A;  1ZDU A;  2PIQ A;  3A3Z X;  3ADS A;  3DY6 A;  4PF3 A;  3X1I A;  3X1H A;  4ZN9 A;  3DZY A;  4IV4 A;  3OLF A;  2ZMI A;  2H79 A;  4RMD A;  2GPP A;  2ZAS A;  4ZJW A;  4ZN7 A;  1PQ6 A;  2QE4 A;  3GWX A;  4ZNW A;  5DVS A;  3UVV B;  4PLE A;  3CLD A;  5AZV A;  3R8D A;  5DXP A;  1XV9 A;  5DXB B;  1X7R A;  4IWF A;  4XLD A;  5DWG A;  4XAO A;  1L2I A;  1RKH A;  2HC4 A;  4MG8 B;  5DXQ A;  5GID A;  5B41 A;  4DQM A;  4KZM A;  1KNU A;  2QA8 B;  2R40 A;  3OAP A;  3HLV A;  4UDB A;  2HCD A;  3VT7 A;  1UPV A;  1FM9 D;  4PP5 A;  5DK9 A;  1ZH7 A;  2XHS A;  1S9P A;  3F7D A;  5HCV A;  3KMZ A;  3NOA A;  3PRG A;  4OH6 A;  4P6X A;  1GWX A;  3GWS X;  2GIU A;  2PIP L;  3SP9 A;  1ZUC A;  2AYR A;  2AO6 A;  2NPA A;  2VV3 A;  3CS8 A;  5EC9 A;  4JYI A;  5G46 A;  4RME A;  2QXM A;  3MNP A;  3TKM A;  2GPO A;  2QH6 A;  2AA7 A;  2AA6 A;  3AZ1 A;  3PEQ A;  4DM8 A;  1NHZ A;  4LBD A;  3V9Y A;  4OFU A;  4R6S A;  2YLY A;  3VI8 A;  4N8R A;  4FGY A;  1R6G A;  4CI5 A;  1T63 A;  4P6W A;  2G44 A;  1QKT A;  4XT9 A;  4E2J A;  4XI3 A;  2OCF A;  2P7Z A;  3VHV A;  3WJ5 A;  4OGH A;  1R1K A;  2HAM A;  1XP9 A;  2Z4B A;  2QTU A;  5I4V A;  1YY4 A;  5HJP B;  5KD9 A;  3B0R A;  2ZLC A;  4RUO X;  5HYK A;  3L1B A;  3V3Q A;  3KDT A;  3PBA A;  3D90 A;  3R2A A;  2GL8 A;  4Y29 A;  5APJ A;  5DWL A;  2VV1 B;  3AN4 A;  4NB6 A;  3VHU A;  3D24 A;  4X1G A;  2AX8 A;  1M13 A;  1XP6 A;  2LBD A;  4HLW A;  4OIV A;  3B5R A;  5DMF A;  5H1E A;  3OLS A;  1XV9 B;  4OAR A;  3ZQT A;  2FAI A;  1S9Q A;  4IW8 A;  4N73 A;  1XVP B;  3EYB A;  4EM9 A;  5DX3 B;  1XQC A;  1QKN A;  2QA6 A;  3VSP A;  3HOD A;  1X76 A;  1FM6 A;  3WGP A;  4DOS A;  1FD0 A;  1SQN A;  1IE8 A;  5KCU A;  2PIN A;  2Q60 A;  1A52 A;  1NAX A;  4OZR E;  1DB1 A;  3BC5 A;  3E00 A;  3L0E A;  4JAZ A;  4RZG A;  1LBD A;  5KCT A;  1OVL B;  3P0U A;  3X36 A;  5KCW A;  3W0G A;  2Q7L A;  5AAV A;  4RAK A;  1ERE A;  1KV6 A;  2ACL A;  2Q61 A;  2POG A;  3ILZ A;  3Q95 B;  3G9E A;  4ONI A;  2P54 A;  3W0C A;  4QK4 A;  5HZC A;  2Q5S A;  3B3K A;  5DY8 A;  5ETH A;  2B23 A;  3VTB A;  3AUN A;  2AAX A;  2P1V A;  4A4W A;  5GT4 A;  5DYB A;  3VT6 A;  3HO0 A;  4IUI A;  4F9M A;  5L7G A;  3AX8 A;  3UP0 A;  3OMM A;  4M8E A;  3KYT A;  5E14 A;  4RFW A;  2P1U A;  4K6I A;  2JFA B;  3FXV A;  4L96 A;  2YLO A;  2JJ3 A;  3D5F A;  3OZJ A;  4UDD A;  4ZO1 B;  5SYZ A;  2ZLA A;  3WT5 A;  4J5X C;  1S19 A;  3ADX A;  4J5W C;  2PIU A;  1ILG A;  3AZ3 A;  2ZMH A;  2Q3Y A;  2PIX A;  4LSJ A;  5DV3 A;  2HFP A;  1T5Z A;  4Q0A C;  3G8O A;  1EXA A;  4TV1 B;  4OC7 A;  5JJM A;  5KYA A;  2YLP A;  4NY9 A;  1YA3 A;  3L0J A;  3RUT A;  3K22 A;  3OSW A;  5EGV A;  4PP3 A;  5DID A;  1YOK A;  3DT3 A;  3GN8 A;  3K23 A;  4PP6 A;  1T7M A;  2HBH A;  3VRT A;  4WPF A;  5AK2 A;  3QT0 A;  3V49 A;  5KRO A;  4IWC A;  4XTA A;  1I7I A;  2H77 A;  1R1K D;  2Q5P A;  2B1V A;  3AZ2 A;  4MDD A;  1PRG A;  4XUH A;  4YPQ A;  3ET1 A;  2J14 A;  4MGD B;  3CWD A;  5IZ0 A;  1DKF A;  3VJI A;  2REW A;  5IXK A;  2VSR A;  1HG4 A;  1PQC A;  3L0L A;  4MGA A;  1XAP A;  2GWX A;  1R20 A;  2QMV A;  3TKC A;  5DWE A;  3V3E A;  2Q7K A;  1R5K A;  1T7T A;  4J26 A;  4R2U A;  3B65 A;  3TX7 B;  4MG5 A;  3UUA A;  5KRM A;  1OSV A;  2ZVT A;  1XDK A;  3CTB A;  4LNW A;  2ZXZ A;  3CDP A;  1FCX A;  1NQ2 A;  1FM6 D;  5DWI A;  3W0A A;  3WFG A;  4MGB A;  4FHI A;  2P4Y A;  2AXA A;  3WJ4 A;  3WTQ A;  1MZN A;  5KRH A;  2ZMJ A;  5DWJ A;  3ADW A;  4MG6 A;  5E0W A;  3B0W A;  3KDU A;  3OS9 A;  1NYX A;  3P8X A;  3ADT A;  3F5C A;  5E0X A;  5G45 A;  2Q6J A;  3UUC A;  4PPP A;  4YNK A;  5DUG A;  3FUG A;  2IOK A;  4FN9 A;  4N5G A;  2ZBS A;  3G8I A;  1ILH A;  5KRK A;  3AUQ A;  1T76 A;  3L03 A;  4M8H A;  2ZK6 A;  5KRA A;  2Q7J A;  4N1Y A;  4REE A;  1NRL A;  3OMQ A;  5DXK A;  5ICK A;  5HYR A;  1ZKY A;  4WLB A;  1ZAF A;  5KRF A;  3W5R A;  1S0X A;  4NQA B;  3ERD A;  2I0G A;  3K6P A;  3OGT A;  3R8I A;  3KPZ A;  2A3I A;  1VJB A;  2HAS A;  2PRG A;  1I7G A;  4OKB A;  1XNX A;  1T74 A;  3O1E A;  2OVH A;  1Z95 A;  4RZF A;  1XLS E;  2POB A;  2P7G A;  5DYD A;  5DSH A;  4IV2 A;  2Q1V A;  4Q13 A;  3FUR A;  3VTC A;  2QGW A;  3SP6 A;  1NQ1 A;  2BJ4 A;  1RDT A;  3IPS A;  2OM9 A;  4RMC A;  3ZR7 A;  5FQV A;  3FLI A;  1DKF B;  4WHF A;  1XOW A;  3VRW A;  2ZNN A;  3OOF A;  5EIT A;  1X7J A;  5DZI A;  3RLL A;  5DTV A;  1U3R A;  4ZNU A;  4MGA B;  5DZH A;  4OJ4 A;  1XIU A;  1Z5X E;  3UU7 A;  2NW4 A;  5K13 A;  2GPU A;  4MG9 A;  1X7B A;  3OSA A;  4IS8 A;  3BQD A;  5AWJ A;  4XUM A;  3CS6 A;  1WM0 X;  3B68 A;  1K74 A;  1ZGY A;  1ZDT A;  1QKU A;  2Q59 A;  2HB8 A;  1Y9R A;  2O9I A;  4OZT E;  3IMY A;  1YMT A;  3GYU A;  5KCD A;  4G1D A;  1NDE A;  4LTW A;  3WFF A;  2YJA B;  5DKE A;  4ZOM A;  2PIO A;  3NSQ A;  5G44 A;  1BSX A;  3W5P A;  2P1T A;  3IXP A;  2HAR A;  3LMP A;  5AZT A;  5DUH A;  3JZB A;  4TUZ A;  4UDA A;  4QE8 A;  1RKG A;  3KBA A;  2HB7 A;  2YFE A;  4OJ9 A;  3IA6 A;  3HC5 A;  5DP0 A;  3W0I A;  4OK1 A;  1YP0 A;  2J7Y A;  3RVF A;  3OMP A;  4B7W A;  3D57 A;  4QJR A;  5G42 A;  1PZL A;  1G1U A;  1IE9 A;  1KKQ A;  1T7R A;  2EWP A;  2PIW A;  3CDS A;  3UUD A;  3DZU A;  3L3X A;  3NSP A;  1R20 D;  2YHD A;  1YJE A;  2GP7 A;  3DZY D;  1UPW A;  1XQ3 A;  4RUJ A;  1PK5 A;  4MG7 A;  4DM6 A;  5AAU A;  1PCG A;  3MNO A;  2QNV A;  4QE6 A;  4QM0 A;  5KCF A;  2QZO A;  2ATH A;  2AWH A;  2J4A A;  3A78 A;  3ET2 A;  4OED A;  1YIM A;  2PIV A;  4HEE X;  5DKS A;  5HJS A;  5KRI A;  1RK3 A;  2I4J A;  3OS8 A;  1X7E A;  4PVU A;  3WMH A;  4PPS A;  5CJ6 A;  3PCU A;  5E19 A;  4DOR A;  2QW4 A;  3B66 A;  4G2H A;  4UDC A;  3JZC A;  2R40 D;  1T73 A;  1UHL A;  3GBK A;  3HZF A;  3HC6 A;  3LBD A;  3VT3 A;  2GTK A;  1GWR A;  1S0Z A;  4IQR A;  3RUU A;  1PDU A;  4MGC A;  2ZL9 A;  1SKX A;  1GS4 A;  2YLQ A;  3FC6 B;  2OZ7 A;  2V7C A;  2ZKC A;  3A2I A;  3VT8 A;  1ZEO A;  3R5N A;  4L98 A;  2Q70 A;  5ACC A;  1X78 A;  1M2Z A;  5DL4 A;  1G2N A;  4MG9 B;  3FAL A;  2V0V A;  2I4Z A;  3HM1 A;  3IPQ A;  3HQ5 A;  4WVD A;  5DLR A;  5C4T A;  3B0T A;  2ZK4 A;  1Y0S A;  2XYJ A;  3W5Q A;  3UVV A;  1XJ7 A;  1Z5X U;  4IW6 A;  2HWQ A;  4PRG A;  4RE8 A;  3O1D A;  2FVJ A;  5DUE A;  5F9B A;  5L11 A;  4PLD A;  4K7A A;  5DXB A;  5DXE A;  2NV7 A;  1I37 A;  4MG8 A;  2FSZ A;  2QA8 A;  5EHJ A;  3CQV A;  3OKI A;  2QR9 A;  1NAV A;  2AX9 A;  4TUZ B;  2Q6S A;  3RY9 A;  3N00 A;  1OSH A;  4K4J A;  1SR7 A;  4J5X A;  1MV9 A;  4J5W A;  1N83 A;  5DIE A;  4JGV A;  4OFR A;  4A4V A;  5GIC A;  4OHA A;  1XP1 A;  3DCU A;  4X1F A;  4IVY A;  5DXR A;  2AMA A;  3ET3 A;  2HVC A;  5DZ0 A;  3T03 A;  3FS1 A;  3E7C A;  1K74 D;  2G0G A;  1G50 A;  4OZR U;  5AAV B;  4JYG A;  3W0Y A;  4ZJR A;  2PJL A;  2ACL B;  5DZ3 A;  1N46 A;  2G5O A;  3D6D A;  3VJH A;  3KFC A;  2ZY0 A;  4G20 A;  4OKX A;  3V9V A;  2R6W A;  4FHH A;  3OOK A;  2YJD A;  3IXP D;  3GYT A;  3CJW A;  4RWV A;  2OVM A;  3A9E A;  5AVI A;  3CS4 A;  3R5M A;  5HJP A;  2NXX E;  2VST A;  4E4K A;  4O8F A;  2ZK5 A;  5APH A;  1M7W A;  1L2J A;  1QKM A;  1T7F A;  5FQR A;  1E3G A;  2XKW A;  5C4U A;  3W0H A;  3DZU D;  3DCT A;  3E00 D;  4A2J A;  4JYH A;  3W5T A;  1YIN A;  4NUF A;  3ZRA A;  4OLM A;  5JY3 A;  4IVW A;  1XLS A;  3B67 A;  5M96 A;  3FAL B;  1LV2 A;  3OKH A;  1XPC A;  3ADV A;  2VV1 A;  2XYX A;  3B0Q A;  3DR1 A;  2HWR A;  3ERT A;  5JJM B;  5LWP A;  2P7A A;  4S0T A;  3VJT A;  4REF A;  1E3K A;  2B1Z A;  3KWY A;  4YMQ A;  5KRC A;  4CI4 A;  5DV6 A;  1YUC A;  3OLL A;  1XVP A;  5FQS A;  4IU7 A;  5DX3 A;  2VV4 A;  3OMK A;  2AA5 A;  3W0J A;  4IA1 A;  4G1Z A;  2O4R A;  3GD2 A;  1K4W A;  3M7R A;  2VV0 A;  2PKL A;  4KZJ A;  1H9U A;  1U9E A;  3A2H A;  4OJB A;  4OKT A;  3IPU A;  5EI1 A;  4ITF A;  4IA3 A;  1A28 A;  3ZRB A;  2VV2 A;  1ERR A;  2QAB A;  5B5B A;  3KMG A;  1HJ1 A;  4G21 A;  3SZ1 A;  1OVL A;  3FC6 A;  1T65 A;  3VT4 A;  2AX7 A;  2ZK1 A;  4ITE A;  4POJ A;  5AWK A;  2QPY A;  4PWL A;  5C4S A;  5KRL A;  3Q95 A;  5KYJ A;  3VHW A;  1I38 A;  1YOW A;  1SJ0 A;  4DK7 A;  2G0H A;  3A40 X;  3UUA B;  5FQP A;  4OEA A;  1XDK B;  5DVV A;  1OT7 A;  4WHG A;  5E1C A;  5G43 A;  5DU5 A;  3VJS A;  4EMA A;  3G0W A;  3H0A A;  4BCR A;  2ZNP A;  5L7H A;  5KRJ A;  4CSJ A;  2ZXN A;  3AUR A;  3A9E B;  2JFA A;  4MGB B;  3VT9 A;  4KZI A;  5E7V A;  1PQ9 A;  4IA2 A;  1G5Y A;  1Y0X X;  5DRM A;  4R06 A;  2ZFX A;  4OH5 A;  3U9Q A;  1XB7 A;  2R6Y A;  2P15 A;  3F5C B;  4J24 A;  2AA2 A;  1NQ0 A;  4ZO1 X;  2Q6R A;  1FCY A;  2PNU A;  1P8D A;  5DI7 A;  1T79 A;  5AYG A;  2I0J A;  1NUO A;  4RZE A;  1MVC A;  3P88 A;  4TV1 A;  3R8A A;  5DKG A;  2O4J A;  1RJK A;  1GWQ A;  1FBY A;  2W8Y A;  3MNE A;  3R29 A;  3ET0 A;  2PIT A;  5A86 A;  2VV4 B;  1P93 A;  2I4P A;  1EXX A;  3K8S A;  3OS8 C;  4OEZ A;  3VTD A;  1TXI A;  4S15 A;  3A2J A;  4XHD A;  5KR9 A;  3VT5 A;  2Q5G A;  4APU A;  5EJV A;  2ZNQ A;  4ZNT A;  1YYE A;  4RUP A;  4MGD A;  3FEJ A;  5DRJ A;  1FM9 A;  5GIE A;  2BJ4 B;  3KMR A;  4LNX A;  4OEY A;  2J7X A;  5L7E A;  3H52 A;  2Q8S A;  1U3S A;  3PLZ A;  5G3J A;  4YT1 A;  1N4H A;  2JF9 A;  4PXM A;  1U3Q A;  2ZK0 A;  5LGA A; 
#chains in the Genus database with same CATH homology
 2GPV A;  3OMO A;  4ZNV A;  3UP3 A;  4DMA A;  4JL4 A;  4S0S A;  3BEJ A;  2AM9 A;  3FEI A;  2B50 A;  2Q7I A;  5C4O A;  2Q59 B;  3B1M A;  3L3Z A;  4QL8 A;  2OUZ A;  4ZI1 A;  4OIL A;  4WQP A;  3UU7 B;  5E15 A;  4OKW A;  2OAX A;  3TY0 A;  5DMC A;  1NQ7 A;  2BAW A;  2E2R A;  5KCC A;  4OZT U;  3AFR A;  1TFC A;  5DZ1 A;  5DV8 A;  2IHQ A;  1RDT D;  5DXM A;  3V9T A;  3X31 A;  4E4Q A;  4ZNH A;  4DK8 A;  3UUD B;  3RLJ A;  2YAT A;  2F4B A;  5DXG A;  2Z4J A;  4G1Y A;  4IA7 A;  3ADU A;  5IAW A;  4MG7 B;  4G2I A;  3VSO A;  1UOM A;  2QXS A;  3WWR A;  2QGT A;  3OSI A;  2NXX A;  2IOG A;  2QZO B;  3AN3 A;  4FNE A;  2QSE A;  5DKB A;  2ZNO A;  2AX6 A;  2ZXM A;  4OIU A;  4POH A;  2ZK2 A;  4Q50 A;  4ZNS A;  2ZK3 A;  1FCZ A;  5DVC A;  5G5W A;  3VRU A;  5APK A;  2ABI A;  5KCE A;  2XYW A;  2AB2 A;  3H0A D;  5JI0 D;  3V4A A;  4S14 A;  1Q4X A;  1K7L A;  5DIG A;  1XZX X;  1UHL B;  3HVL A;  3P89 A;  3WT6 A;  1XNN A;  3GZ9 A;  2Q1H A;  2PIR A;  3PO9 A;  3E94 A;  3WT7 A;  5FQT A;  3S9S A;  3OZ0 A;  2AMB A;  5AVL A;  3VRV A;  3VN2 A;  4NIE A;  1ZDU A;  2PIQ A;  3A3Z X;  3ADS A;  3DY6 A;  4PF3 A;  3X1I A;  3X1H A;  4ZN9 A;  3DZY A;  4IV4 A;  3OLF A;  2ZMI A;  2H79 A;  4RMD A;  2GPP A;  2ZAS A;  4ZJW A;  4ZN7 A;  1PQ6 A;  2QE4 A;  3GWX A;  4ZNW A;  5DVS A;  3UVV B;  4PLE A;  3CLD A;  5AZV A;  3R8D A;  5DXP A;  1XV9 A;  5DXB B;  1X7R A;  4IWF A;  4XLD A;  5DWG A;  4XAO A;  1L2I A;  1RKH A;  2HC4 A;  4MG8 B;  5DXQ A;  5GID A;  5B41 A;  4DQM A;  4KZM A;  1KNU A;  2QA8 B;  2R40 A;  3OAP A;  3HLV A;  4UDB A;  2HCD A;  3VT7 A;  1UPV A;  1FM9 D;  4PP5 A;  5DK9 A;  1ZH7 A;  2XHS A;  1S9P A;  3F7D A;  5HCV A;  3KMZ A;  3NOA A;  3PRG A;  4OH6 A;  4P6X A;  1GWX A;  3GWS X;  2GIU A;  2PIP L;  3SP9 A;  1ZUC A;  2AYR A;  2AO6 A;  2NPA A;  2VV3 A;  3CS8 A;  5EC9 A;  4JYI A;  5G46 A;  4RME A;  2QXM A;  3MNP A;  3TKM A;  2GPO A;  2QH6 A;  2AA7 A;  2AA6 A;  3AZ1 A;  3PEQ A;  4DM8 A;  1NHZ A;  4LBD A;  3V9Y A;  4OFU A;  4R6S A;  2YLY A;  3VI8 A;  4N8R A;  4FGY A;  1R6G A;  4CI5 A;  1T63 A;  4P6W A;  2G44 A;  1QKT A;  4XT9 A;  4E2J A;  4XI3 A;  2OCF A;  2P7Z A;  3VHV A;  3WJ5 A;  4OGH A;  1R1K A;  2HAM A;  1XP9 A;  2Z4B A;  2QTU A;  5I4V A;  1YY4 A;  5HJP B;  5KD9 A;  3B0R A;  2ZLC A;  4RUO X;  5HYK A;  3L1B A;  3V3Q A;  3KDT A;  3PBA A;  3D90 A;  3R2A A;  2GL8 A;  4Y29 A;  5APJ A;  5DWL A;  2VV1 B;  3AN4 A;  4NB6 A;  3VHU A;  3D24 A;  4X1G A;  2AX8 A;  1M13 A;  1XP6 A;  2LBD A;  4HLW A;  4OIV A;  3B5R A;  5DMF A;  5H1E A;  3OLS A;  1XV9 B;  4OAR A;  3ZQT A;  2FAI A;  1S9Q A;  4IW8 A;  4N73 A;  1XVP B;  3EYB A;  4EM9 A;  5DX3 B;  1XQC A;  1QKN A;  2QA6 A;  3VSP A;  3HOD A;  1X76 A;  1FM6 A;  3WGP A;  4DOS A;  1FD0 A;  1SQN A;  1IE8 A;  5KCU A;  2PIN A;  2Q60 A;  1A52 A;  1NAX A;  4OZR E;  1DB1 A;  3BC5 A;  3E00 A;  3L0E A;  4JAZ A;  4RZG A;  1LBD A;  5KCT A;  1OVL B;  3P0U A;  3X36 A;  5KCW A;  3W0G A;  2Q7L A;  5AAV A;  4RAK A;  1ERE A;  1KV6 A;  2ACL A;  2Q61 A;  2POG A;  3ILZ A;  3Q95 B;  3G9E A;  4ONI A;  2P54 A;  3W0C A;  4QK4 A;  5HZC A;  2Q5S A;  3B3K A;  5DY8 A;  5ETH A;  2B23 A;  3VTB A;  3AUN A;  2AAX A;  2P1V A;  4A4W A;  5GT4 A;  5DYB A;  3VT6 A;  3HO0 A;  4IUI A;  4F9M A;  5L7G A;  3AX8 A;  3UP0 A;  3OMM A;  4M8E A;  3KYT A;  5E14 A;  4RFW A;  2P1U A;  4K6I A;  2JFA B;  3FXV A;  4L96 A;  2YLO A;  2JJ3 A;  3D5F A;  3OZJ A;  4UDD A;  4ZO1 B;  5SYZ A;  2ZLA A;  3WT5 A;  4J5X C;  1S19 A;  3ADX A;  4J5W C;  2PIU A;  1ILG A;  3AZ3 A;  2ZMH A;  2Q3Y A;  2PIX A;  4LSJ A;  5DV3 A;  2HFP A;  1T5Z A;  4Q0A C;  3G8O A;  1EXA A;  4TV1 B;  4OC7 A;  5JJM A;  5KYA A;  2YLP A;  4NY9 A;  1YA3 A;  3L0J A;  3RUT A;  3K22 A;  3OSW A;  5EGV A;  4PP3 A;  5DID A;  1YOK A;  3DT3 A;  3GN8 A;  3K23 A;  4PP6 A;  1T7M A;  2HBH A;  3VRT A;  4WPF A;  5AK2 A;  3QT0 A;  3V49 A;  5KRO A;  4IWC A;  4XTA A;  1I7I A;  2H77 A;  1R1K D;  2Q5P A;  2B1V A;  3AZ2 A;  4MDD A;  1PRG A;  4XUH A;  4YPQ A;  3ET1 A;  2J14 A;  4MGD B;  3CWD A;  5IZ0 A;  1DKF A;  3VJI A;  2REW A;  5IXK A;  2VSR A;  1HG4 A;  1PQC A;  3L0L A;  4MGA A;  1XAP A;  2GWX A;  1R20 A;  2QMV A;  3TKC A;  5DWE A;  3V3E A;  2Q7K A;  1R5K A;  1T7T A;  4J26 A;  4R2U A;  3B65 A;  3TX7 B;  4MG5 A;  3UUA A;  5KRM A;  1OSV A;  2ZVT A;  1XDK A;  3CTB A;  4LNW A;  2ZXZ A;  3CDP A;  1FCX A;  1NQ2 A;  1FM6 D;  5DWI A;  3W0A A;  3WFG A;  4MGB A;  4FHI A;  2P4Y A;  2AXA A;  3WJ4 A;  3WTQ A;  1MZN A;  5KRH A;  2ZMJ A;  5DWJ A;  3ADW A;  4MG6 A;  5E0W A;  3B0W A;  3KDU A;  3OS9 A;  1NYX A;  3P8X A;  3ADT A;  3F5C A;  5E0X A;  5G45 A;  2Q6J A;  3UUC A;  4PPP A;  4YNK A;  5DUG A;  3FUG A;  2IOK A;  4FN9 A;  4N5G A;  2ZBS A;  3G8I A;  1ILH A;  5KRK A;  3AUQ A;  1T76 A;  3L03 A;  4M8H A;  2ZK6 A;  5KRA A;  2Q7J A;  4N1Y A;  4REE A;  1NRL A;  3OMQ A;  5DXK A;  5ICK A;  5HYR A;  1ZKY A;  4WLB A;  1ZAF A;  5KRF A;  3W5R A;  1S0X A;  4NQA B;  3ERD A;  2I0G A;  3K6P A;  3OGT A;  3R8I A;  3KPZ A;  2A3I A;  1VJB A;  2HAS A;  2PRG A;  1I7G A;  4OKB A;  1XNX A;  1T74 A;  3O1E A;  2OVH A;  1Z95 A;  4RZF A;  1XLS E;  2POB A;  2P7G A;  5DYD A;  5DSH A;  4IV2 A;  2Q1V A;  4Q13 A;  3FUR A;  3VTC A;  2QGW A;  3SP6 A;  1NQ1 A;  2BJ4 A;  1RDT A;  3IPS A;  2OM9 A;  4RMC A;  3ZR7 A;  5FQV A;  3FLI A;  1DKF B;  4WHF A;  1XOW A;  3VRW A;  2ZNN A;  3OOF A;  5EIT A;  1X7J A;  5DZI A;  3RLL A;  5DTV A;  1U3R A;  4ZNU A;  4MGA B;  5DZH A;  4OJ4 A;  1XIU A;  1Z5X E;  3UU7 A;  2NW4 A;  5K13 A;  2GPU A;  4MG9 A;  1X7B A;  3OSA A;  4IS8 A;  3BQD A;  5AWJ A;  4XUM A;  3CS6 A;  1WM0 X;  3B68 A;  1K74 A;  1ZGY A;  1ZDT A;  1QKU A;  2Q59 A;  2HB8 A;  1Y9R A;  2O9I A;  4OZT E;  3IMY A;  1YMT A;  3GYU A;  5KCD A;  4G1D A;  1NDE A;  4LTW A;  3WFF A;  2YJA B;  5DKE A;  4ZOM A;  2PIO A;  3NSQ A;  5G44 A;  1BSX A;  3W5P A;  2P1T A;  3IXP A;  2HAR A;  3LMP A;  5AZT A;  5DUH A;  3JZB A;  4TUZ A;  4UDA A;  4QE8 A;  1RKG A;  3KBA A;  2HB7 A;  2YFE A;  4OJ9 A;  3IA6 A;  3HC5 A;  5DP0 A;  3W0I A;  4OK1 A;  1YP0 A;  2J7Y A;  3RVF A;  3OMP A;  4B7W A;  3D57 A;  4QJR A;  5G42 A;  1PZL A;  1G1U A;  1IE9 A;  1KKQ A;  1T7R A;  2EWP A;  2PIW A;  3CDS A;  3UUD A;  3DZU A;  3L3X A;  3NSP A;  1R20 D;  2YHD A;  1YJE A;  2GP7 A;  3DZY D;  1UPW A;  1XQ3 A;  4RUJ A;  1PK5 A;  4MG7 A;  4DM6 A;  5AAU A;  1PCG A;  3MNO A;  2QNV A;  4QE6 A;  4QM0 A;  5KCF A;  2QZO A;  2ATH A;  2AWH A;  2J4A A;  3A78 A;  3ET2 A;  4OED A;  1YIM A;  2PIV A;  4HEE X;  5DKS A;  5HJS A;  5KRI A;  1RK3 A;  2I4J A;  3OS8 A;  1X7E A;  4PVU A;  3WMH A;  4PPS A;  5CJ6 A;  3PCU A;  5E19 A;  4DOR A;  2QW4 A;  3B66 A;  4G2H A;  4UDC A;  3JZC A;  2R40 D;  1T73 A;  1UHL A;  3GBK A;  3HZF A;  3HC6 A;  3LBD A;  3VT3 A;  2GTK A;  1GWR A;  1S0Z A;  4IQR A;  3RUU A;  1PDU A;  4MGC A;  2ZL9 A;  1SKX A;  1GS4 A;  2YLQ A;  3FC6 B;  2OZ7 A;  2V7C A;  2ZKC A;  3A2I A;  3VT8 A;  1ZEO A;  3R5N A;  4L98 A;  2Q70 A;  5ACC A;  1X78 A;  1M2Z A;  5DL4 A;  1G2N A;  4MG9 B;  3FAL A;  2V0V A;  2I4Z A;  3HM1 A;  3IPQ A;  3HQ5 A;  4WVD A;  5DLR A;  5C4T A;  3B0T A;  2ZK4 A;  1Y0S A;  2XYJ A;  3W5Q A;  3UVV A;  1XJ7 A;  1Z5X U;  4IW6 A;  2HWQ A;  4PRG A;  4RE8 A;  3O1D A;  2FVJ A;  5DUE A;  5F9B A;  5L11 A;  4PLD A;  4K7A A;  5DXB A;  5DXE A;  2NV7 A;  1I37 A;  4MG8 A;  2FSZ A;  2QA8 A;  5EHJ A;  3CQV A;  3OKI A;  2QR9 A;  1NAV A;  2AX9 A;  4TUZ B;  2Q6S A;  3RY9 A;  3N00 A;  1OSH A;  4K4J A;  1SR7 A;  4J5X A;  1MV9 A;  4J5W A;  1N83 A;  5DIE A;  4JGV A;  4OFR A;  4A4V A;  5GIC A;  4OHA A;  1XP1 A;  3DCU A;  4X1F A;  4IVY A;  5DXR A;  2AMA A;  3ET3 A;  2HVC A;  5DZ0 A;  3T03 A;  3FS1 A;  3E7C A;  1K74 D;  2G0G A;  1G50 A;  4OZR U;  5AAV B;  4JYG A;  3W0Y A;  4ZJR A;  2PJL A;  2ACL B;  5DZ3 A;  1N46 A;  2G5O A;  3D6D A;  3VJH A;  3KFC A;  2ZY0 A;  4G20 A;  4OKX A;  3V9V A;  2R6W A;  4FHH A;  3OOK A;  2YJD A;  3IXP D;  3GYT A;  3CJW A;  4RWV A;  2OVM A;  3A9E A;  5AVI A;  3CS4 A;  3R5M A;  5HJP A;  2NXX E;  2VST A;  4E4K A;  4O8F A;  2ZK5 A;  5APH A;  1M7W A;  1L2J A;  1QKM A;  1T7F A;  5FQR A;  1E3G A;  2XKW A;  5C4U A;  3W0H A;  3DZU D;  3DCT A;  3E00 D;  4A2J A;  4JYH A;  3W5T A;  1YIN A;  4NUF A;  3ZRA A;  4OLM A;  5JY3 A;  4IVW A;  1XLS A;  3B67 A;  5M96 A;  3FAL B;  1LV2 A;  3OKH A;  1XPC A;  3ADV A;  2VV1 A;  2XYX A;  3B0Q A;  3DR1 A;  2HWR A;  3ERT A;  5JJM B;  5LWP A;  2P7A A;  4S0T A;  3VJT A;  4REF A;  1E3K A;  2B1Z A;  3KWY A;  4YMQ A;  5KRC A;  4CI4 A;  5DV6 A;  1YUC A;  3OLL A;  1XVP A;  5FQS A;  4IU7 A;  5DX3 A;  2VV4 A;  3OMK A;  2AA5 A;  3W0J A;  4IA1 A;  4G1Z A;  2O4R A;  3GD2 A;  1K4W A;  3M7R A;  2VV0 A;  2PKL A;  4KZJ A;  1H9U A;  1U9E A;  3A2H A;  4OJB A;  4OKT A;  3IPU A;  5EI1 A;  4ITF A;  4IA3 A;  1A28 A;  3ZRB A;  2VV2 A;  1ERR A;  2QAB A;  5B5B A;  3KMG A;  1HJ1 A;  4G21 A;  3SZ1 A;  1OVL A;  3FC6 A;  1T65 A;  3VT4 A;  2AX7 A;  2ZK1 A;  4ITE A;  4POJ A;  5AWK A;  2QPY A;  4PWL A;  5C4S A;  5KRL A;  3Q95 A;  5KYJ A;  3VHW A;  1I38 A;  1YOW A;  1SJ0 A;  4DK7 A;  2G0H A;  3A40 X;  3UUA B;  5FQP A;  4OEA A;  1XDK B;  5DVV A;  1OT7 A;  4WHG A;  5E1C A;  5G43 A;  5DU5 A;  3VJS A;  4EMA A;  3G0W A;  3H0A A;  4BCR A;  2ZNP A;  5L7H A;  5KRJ A;  4CSJ A;  2ZXN A;  3AUR A;  3A9E B;  2JFA A;  4MGB B;  3VT9 A;  4KZI A;  5E7V A;  1PQ9 A;  4IA2 A;  1G5Y A;  1Y0X X;  5DRM A;  4R06 A;  2ZFX A;  4OH5 A;  3U9Q A;  1XB7 A;  2R6Y A;  2P15 A;  3F5C B;  4J24 A;  2AA2 A;  1NQ0 A;  4ZO1 X;  2Q6R A;  1FCY A;  2PNU A;  1P8D A;  5DI7 A;  1T79 A;  5AYG A;  2I0J A;  1NUO A;  4RZE A;  1MVC A;  3P88 A;  4TV1 A;  3R8A A;  5DKG A;  2O4J A;  1RJK A;  1GWQ A;  1FBY A;  2W8Y A;  3MNE A;  3R29 A;  3ET0 A;  2PIT A;  5A86 A;  2VV4 B;  1P93 A;  2I4P A;  1EXX A;  3K8S A;  3OS8 C;  4OEZ A;  3VTD A;  1TXI A;  4S15 A;  3A2J A;  4XHD A;  5KR9 A;  3VT5 A;  2Q5G A;  4APU A;  5EJV A;  2ZNQ A;  4ZNT A;  1YYE A;  4RUP A;  4MGD A;  3FEJ A;  5DRJ A;  1FM9 A;  5GIE A;  2BJ4 B;  3KMR A;  4LNX A;  4OEY A;  2J7X A;  5L7E A;  3H52 A;  2Q8S A;  1U3S A;  3PLZ A;  5G3J A;  4YT1 A;  1N4H A;  2JF9 A;  4PXM A;  1U3Q A;  2ZK0 A;  5LGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...