2YMEA

Crystal structure of a mutant binding protein (5htbp-achbp) in complex with granisetron
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYWERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Ligand Recognition in 5-Ht3 Receptors.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2ymeA00
5KE4A 4QABA 5J5GA 4WV9A 2C9TA 2BYQA 2XYTA 5HEHA 2WNCA 3UQ4A 2X00A 2BYRA 2ZJUA 5L47A 4AFGA 2XNTA 4HQPA 4Z90A 4QH1A 3TLUA 5AFJA 4ZK4A 3WIPA 5CFBA 4HFEA 5AFKA 3U8KA 4LMKA 3P4WA 2ZJVA 2UZ6A 1UW6A 5HEUA 5L4HA 1I9BA 3PMZA 3U8JA 4IL9A 3UU5A 5J5FA 4ZJSA 3UU8A 2XNUA 2XQ4A 3ZDHA 5HEJA 4HFCA 2BR7A 2WNJA 5BP0A 5LG3A 1UX2A 2BJ0A 4UM3A 4ZK1A 5L4EA 3JADA 3TLWA 4HFHA 3EHZA 3U8MA 2XZ6A 4LMJA 2XYSA 2YOEA 4A97A 5AFMB 4ILAA 5JMEA 4X5TA 4PIRA 2WZYA 5AFHA 3WTKA 4UM3P 2XQ9A 2Y57A 5CO5A 3T4MA 3WTHA 4ZJTA 2Y54A 3RIAA 4UM3S 5AFMA 2YMEA 5HCJA 3SQ9A 2XQAA 3C84A 4TNVA 2W8GA 4IL4A 2XQ8A 2BYPA 4ILBA 4QACA 4Z91A 3SQ6A 4NZBA 2XQ3A 2XZ5A 5J5HA 3WTMA 4A98A 2XQ5A 4QAAA 3WTLA 4ILCA 3U8LA 2BYNA 3P50A 5HEOA 3RIFA 3RQUA 3RQWA 4AFHA 3UUBA 3JAFA 3WTIA 2VL0A 2Y7YA 5FJVA 4UM1A 4ALXA 5IUXA 4QH4A 3TLVA 4IREA 2BG9B 4ZZBA 3C79A 3WTOA 4AFTA 2WN9A 3WTNA 2PGZA 3U8NA 3TLTA 2BG9C 2YMDA 3WTJA 4BFQA 4TWHA 4BQTA 2BG9A 4EZ1A 3UU6A 4HFIA 3GUAA 4DBMA 2PH9A 4UXUA 4ZZCA 5AINA 4NPPA 2XNVA 4ZRUA 3ZDGA 3PEOA 3IGQA 4XK9A 4QH5A 2W8FA 4TWFA 5HCMA 4COFA 5BRXA 4XHEA 2Y56A 3SIOA 2QC1B 3UQ7A 2X00D 4B5DA 3EI0A 3UU3A 2XQ7A 5BW2A 3UU4A 4LMLA 1UV6A 4D01A 2BG9E 3EAMA 5HEGA 3TLSA 4ZR6A 4F8HA 5TVCA 3SH1A 2BYSA 2WNLA 2XQ6A 3LSVA 2Y58A 4HFBA 4TNWA 3ZKRA 2BR8A 5LXBA 4UY2A 5AFLA 5J5IA 5J0ZA 5AFNA 4HFDA 5KZUA 3RHWA 2YN6A 3JAEA 5SYOA 2YKSA 4FRRA 3RI5A 4TWDA
chains in the Genus database with same CATH superfamily
5KE4A 4QABA 5J5GA 4WV9A 2C9TA 2BYQA 2XYTA 5HEHA 2WNCA 3UQ4A 2X00A 2BYRA 2ZJUA 5L47A 4AFGA 2XNTA 4HQPA 4Z90A 4QH1A 3TLUA 5AFJA 4ZK4A 3WIPA 5CFBA 4HFEA 5AFKA 3U8KA 4LMKA 3P4WA 2ZJVA 2UZ6A 1UW6A 5HEUA 5L4HA 1I9BA 3PMZA 3U8JA 4IL9A 3UU5A 5J5FA 4ZJSA 3UU8A 2XNUA 2XQ4A 3ZDHA 5HEJA 4HFCA 2BR7A 2WNJA 5BP0A 5LG3A 1UX2A 2BJ0A 4UM3A 4ZK1A 5L4EA 3JADA 3TLWA 4HFHA 3EHZA 3U8MA 2XZ6A 4LMJA 2XYSA 2YOEA 4A97A 5AFMB 4ILAA 5JMEA 4X5TA 4PIRA 2WZYA 5AFHA 3WTKA 4UM3P 2XQ9A 2Y57A 5CO5A 3T4MA 3WTHA 4ZJTA 2Y54A 3RIAA 4UM3S 5AFMA 2YMEA 5HCJA 3SQ9A 2XQAA 3C84A 4TNVA 2W8GA 4IL4A 2XQ8A 2BYPA 4ILBA 4QACA 4Z91A 3SQ6A 4NZBA 2XQ3A 2XZ5A 5J5HA 3WTMA 4A98A 2XQ5A 4QAAA 3WTLA 4ILCA 3U8LA 2BYNA 3P50A 5HEOA 3RIFA 3RQUA 3RQWA 4AFHA 3UUBA 3JAFA 3WTIA 2VL0A 2Y7YA 5FJVA 4UM1A 4ALXA 5IUXA 4QH4A 3TLVA 4IREA 2BG9B 4ZZBA 3C79A 3WTOA 4AFTA 2WN9A 3WTNA 2PGZA 3U8NA 3TLTA 2BG9C 2YMDA 3WTJA 4BFQA 4TWHA 4BQTA 2BG9A 4EZ1A 3UU6A 4HFIA 3GUAA 4DBMA 2PH9A 4UXUA 4ZZCA 5AINA 4NPPA 2XNVA 4ZRUA 3ZDGA 3PEOA 3IGQA 4XK9A 4QH5A 2W8FA 4TWFA 5HCMA 4COFA 5BRXA 4XHEA 2Y56A 3SIOA 2QC1B 3UQ7A 2X00D 4B5DA 3EI0A 3UU3A 2XQ7A 5BW2A 3UU4A 4LMLA 1UV6A 4D01A 2BG9E 3EAMA 5HEGA 3TLSA 4ZR6A 4F8HA 5TVCA 3SH1A 2BYSA 2WNLA 2XQ6A 3LSVA 2Y58A 4HFBA 4TNWA 3ZKRA 2BR8A 5LXBA 4UY2A 5AFLA 5J5IA 5J0ZA 5AFNA 4HFDA 5KZUA 3RHWA 2YN6A 3JAEA 5SYOA 2YKSA 4FRRA 3RI5A 4TWDA
chains in the Genus database with same CATH topology
5KE4A 4QABA 5J5GA 4WV9A 2C9TA 2BYQA 2XYTA 5HEHA 2WNCA 3UQ4A 2X00A 2BYRA 2ZJUA 5L47A 4AFGA 2XNTA 4HQPA 4Z90A 4QH1A 3TLUA 5AFJA 4ZK4A 3WIPA 5CFBA 4HFEA 5AFKA 3U8KA 4LMKA 3P4WA 2ZJVA 2UZ6A 1UW6A 5HEUA 5L4HA 1I9BA 3PMZA 3U8JA 4IL9A 3UU5A 5J5FA 4ZJSA 3UU8A 2XNUA 2XQ4A 3ZDHA 5HEJA 4HFCA 2BR7A 2WNJA 5BP0A 5LG3A 1UX2A 2BJ0A 4UM3A 4ZK1A 5L4EA 3JADA 3TLWA 4HFHA 3EHZA 3U8MA 2XZ6A 4LMJA 2XYSA 2YOEA 4A97A 5AFMB 4ILAA 5JMEA 4X5TA 4PIRA 2WZYA 5AFHA 3WTKA 4UM3P 2XQ9A 2Y57A 5CO5A 3T4MA 3WTHA 4ZJTA 2Y54A 3RIAA 4UM3S 5AFMA 2YMEA 5HCJA 3SQ9A 2XQAA 3C84A 4TNVA 2W8GA 4IL4A 2XQ8A 2BYPA 4ILBA 4QACA 4Z91A 3SQ6A 4NZBA 2XQ3A 2XZ5A 5J5HA 3WTMA 4A98A 2XQ5A 4QAAA 3WTLA 4ILCA 3U8LA 2BYNA 3P50A 5HEOA 3RIFA 3RQUA 3RQWA 4AFHA 3UUBA 3JAFA 3WTIA 2VL0A 2Y7YA 5FJVA 4UM1A 4ALXA 5IUXA 4QH4A 3TLVA 4IREA 2BG9B 4ZZBA 3C79A 3WTOA 4AFTA 2WN9A 3WTNA 2PGZA 3U8NA 3TLTA 2BG9C 2YMDA 3WTJA 4BFQA 4TWHA 4BQTA 2BG9A 4EZ1A 3UU6A 4HFIA 3GUAA 4DBMA 2PH9A 4UXUA 4ZZCA 5AINA 4NPPA 2XNVA 4ZRUA 3ZDGA 3PEOA 3IGQA 4XK9A 4QH5A 2W8FA 4TWFA 5HCMA 4COFA 5BRXA 4XHEA 2Y56A 3SIOA 2QC1B 3UQ7A 2X00D 4B5DA 3EI0A 3UU3A 2XQ7A 5BW2A 3UU4A 4LMLA 1UV6A 4D01A 2BG9E 3EAMA 5HEGA 3TLSA 4ZR6A 4F8HA 5TVCA 3SH1A 2BYSA 2WNLA 2XQ6A 3LSVA 2Y58A 4HFBA 4TNWA 3ZKRA 2BR8A 5LXBA 4UY2A 5AFLA 5J5IA 5J0ZA 5AFNA 4HFDA 5KZUA 3RHWA 2YN6A 3JAEA 5SYOA 2YKSA 4FRRA 3RI5A 4TWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KE4 A;  4QAB A;  5J5G A;  4WV9 A;  2C9T A;  2BYQ A;  2XYT A;  5HEH A;  2WNC A;  3UQ4 A;  2X00 A;  2BYR A;  2ZJU A;  5L47 A;  4AFG A;  2XNT A;  4HQP A;  4Z90 A;  4QH1 A;  3TLU A;  5AFJ A;  4ZK4 A;  3WIP A;  5CFB A;  4HFE A;  5AFK A;  3U8K A;  4LMK A;  3P4W A;  2ZJV A;  2UZ6 A;  1UW6 A;  5HEU A;  5L4H A;  1I9B A;  3PMZ A;  3U8J A;  4IL9 A;  3UU5 A;  5J5F A;  4ZJS A;  3UU8 A;  2XNU A;  2XQ4 A;  3ZDH A;  5HEJ A;  4HFC A;  2BR7 A;  2WNJ A;  5BP0 A;  5LG3 A;  1UX2 A;  2BJ0 A;  4UM3 A;  4ZK1 A;  5L4E A;  3JAD A;  3TLW A;  4HFH A;  3EHZ A;  3U8M A;  2XZ6 A;  4LMJ A;  2XYS A;  2YOE A;  4A97 A;  5AFM B;  4ILA A;  5JME A;  4X5T A;  4PIR A;  2WZY A;  5AFH A;  3WTK A;  4UM3 P;  2XQ9 A;  2Y57 A;  5CO5 A;  3T4M A;  3WTH A;  4ZJT A;  2Y54 A;  3RIA A;  4UM3 S;  5AFM A;  2YME A;  5HCJ A;  3SQ9 A;  2XQA A;  3C84 A;  4TNV A;  2W8G A;  4IL4 A;  2XQ8 A;  2BYP A;  4ILB A;  4QAC A;  4Z91 A;  3SQ6 A;  4NZB A;  2XQ3 A;  2XZ5 A;  5J5H A;  3WTM A;  4A98 A;  2XQ5 A;  4QAA A;  3WTL A;  4ILC A;  3U8L A;  2BYN A;  3P50 A;  5HEO A;  3RIF A;  3RQU A;  3RQW A;  4AFH A;  3UUB A;  3JAF A;  3WTI A;  2VL0 A;  2Y7Y A;  5FJV A;  4UM1 A;  4ALX A;  5IUX A;  4QH4 A;  3TLV A;  4IRE A;  2BG9 B;  4ZZB A;  3C79 A;  3WTO A;  4AFT A;  2WN9 A;  3WTN A;  2PGZ A;  3U8N A;  3TLT A;  2BG9 C;  2YMD A;  3WTJ A;  4BFQ A;  4TWH A;  4BQT A;  2BG9 A;  4EZ1 A;  3UU6 A;  4HFI A;  3GUA A;  4DBM A;  2PH9 A;  4UXU A;  4ZZC A;  5AIN A;  4NPP A;  2XNV A;  4ZRU A;  3ZDG A;  3PEO A;  3IGQ A;  4XK9 A;  4QH5 A;  2W8F A;  4TWF A;  5HCM A;  4COF A;  5BRX A;  4XHE A;  2Y56 A;  3SIO A;  2QC1 B;  3UQ7 A;  2X00 D;  4B5D A;  3EI0 A;  3UU3 A;  2XQ7 A;  5BW2 A;  3UU4 A;  4LML A;  1UV6 A;  4D01 A;  2BG9 E;  3EAM A;  5HEG A;  3TLS A;  4ZR6 A;  4F8H A;  5TVC A;  3SH1 A;  2BYS A;  2WNL A;  2XQ6 A;  3LSV A;  2Y58 A;  4HFB A;  4TNW A;  3ZKR A;  2BR8 A;  5LXB A;  4UY2 A;  5AFL A;  5J5I A;  5J0Z A;  5AFN A;  4HFD A;  5KZU A;  3RHW A;  2YN6 A;  3JAE A;  5SYO A;  2YKS A;  4FRR A;  3RI5 A;  4TWD A; 
#chains in the Genus database with same CATH topology
 5KE4 A;  4QAB A;  5J5G A;  4WV9 A;  2C9T A;  2BYQ A;  2XYT A;  5HEH A;  2WNC A;  3UQ4 A;  2X00 A;  2BYR A;  2ZJU A;  5L47 A;  4AFG A;  2XNT A;  4HQP A;  4Z90 A;  4QH1 A;  3TLU A;  5AFJ A;  4ZK4 A;  3WIP A;  5CFB A;  4HFE A;  5AFK A;  3U8K A;  4LMK A;  3P4W A;  2ZJV A;  2UZ6 A;  1UW6 A;  5HEU A;  5L4H A;  1I9B A;  3PMZ A;  3U8J A;  4IL9 A;  3UU5 A;  5J5F A;  4ZJS A;  3UU8 A;  2XNU A;  2XQ4 A;  3ZDH A;  5HEJ A;  4HFC A;  2BR7 A;  2WNJ A;  5BP0 A;  5LG3 A;  1UX2 A;  2BJ0 A;  4UM3 A;  4ZK1 A;  5L4E A;  3JAD A;  3TLW A;  4HFH A;  3EHZ A;  3U8M A;  2XZ6 A;  4LMJ A;  2XYS A;  2YOE A;  4A97 A;  5AFM B;  4ILA A;  5JME A;  4X5T A;  4PIR A;  2WZY A;  5AFH A;  3WTK A;  4UM3 P;  2XQ9 A;  2Y57 A;  5CO5 A;  3T4M A;  3WTH A;  4ZJT A;  2Y54 A;  3RIA A;  4UM3 S;  5AFM A;  2YME A;  5HCJ A;  3SQ9 A;  2XQA A;  3C84 A;  4TNV A;  2W8G A;  4IL4 A;  2XQ8 A;  2BYP A;  4ILB A;  4QAC A;  4Z91 A;  3SQ6 A;  4NZB A;  2XQ3 A;  2XZ5 A;  5J5H A;  3WTM A;  4A98 A;  2XQ5 A;  4QAA A;  3WTL A;  4ILC A;  3U8L A;  2BYN A;  3P50 A;  5HEO A;  3RIF A;  3RQU A;  3RQW A;  4AFH A;  3UUB A;  3JAF A;  3WTI A;  2VL0 A;  2Y7Y A;  5FJV A;  4UM1 A;  4ALX A;  5IUX A;  4QH4 A;  3TLV A;  4IRE A;  2BG9 B;  4ZZB A;  3C79 A;  3WTO A;  4AFT A;  2WN9 A;  3WTN A;  2PGZ A;  3U8N A;  3TLT A;  2BG9 C;  2YMD A;  3WTJ A;  4BFQ A;  4TWH A;  4BQT A;  2BG9 A;  4EZ1 A;  3UU6 A;  4HFI A;  3GUA A;  4DBM A;  2PH9 A;  4UXU A;  4ZZC A;  5AIN A;  4NPP A;  2XNV A;  4ZRU A;  3ZDG A;  3PEO A;  3IGQ A;  4XK9 A;  4QH5 A;  2W8F A;  4TWF A;  5HCM A;  4COF A;  5BRX A;  4XHE A;  2Y56 A;  3SIO A;  2QC1 B;  3UQ7 A;  2X00 D;  4B5D A;  3EI0 A;  3UU3 A;  2XQ7 A;  5BW2 A;  3UU4 A;  4LML A;  1UV6 A;  4D01 A;  2BG9 E;  3EAM A;  5HEG A;  3TLS A;  4ZR6 A;  4F8H A;  5TVC A;  3SH1 A;  2BYS A;  2WNL A;  2XQ6 A;  3LSV A;  2Y58 A;  4HFB A;  4TNW A;  3ZKR A;  2BR8 A;  5LXB A;  4UY2 A;  5AFL A;  5J5I A;  5J0Z A;  5AFN A;  4HFD A;  5KZU A;  3RHW A;  2YN6 A;  3JAE A;  5SYO A;  2YKS A;  4FRR A;  3RI5 A;  4TWD A; 
#chains in the Genus database with same CATH homology
 5KE4 A;  4QAB A;  5J5G A;  4WV9 A;  2C9T A;  2BYQ A;  2XYT A;  5HEH A;  2WNC A;  3UQ4 A;  2X00 A;  2BYR A;  2ZJU A;  5L47 A;  4AFG A;  2XNT A;  4HQP A;  4Z90 A;  4QH1 A;  3TLU A;  5AFJ A;  4ZK4 A;  3WIP A;  5CFB A;  4HFE A;  5AFK A;  3U8K A;  4LMK A;  3P4W A;  2ZJV A;  2UZ6 A;  1UW6 A;  5HEU A;  5L4H A;  1I9B A;  3PMZ A;  3U8J A;  4IL9 A;  3UU5 A;  5J5F A;  4ZJS A;  3UU8 A;  2XNU A;  2XQ4 A;  3ZDH A;  5HEJ A;  4HFC A;  2BR7 A;  2WNJ A;  5BP0 A;  5LG3 A;  1UX2 A;  2BJ0 A;  4UM3 A;  4ZK1 A;  5L4E A;  3JAD A;  3TLW A;  4HFH A;  3EHZ A;  3U8M A;  2XZ6 A;  4LMJ A;  2XYS A;  2YOE A;  4A97 A;  5AFM B;  4ILA A;  5JME A;  4X5T A;  4PIR A;  2WZY A;  5AFH A;  3WTK A;  4UM3 P;  2XQ9 A;  2Y57 A;  5CO5 A;  3T4M A;  3WTH A;  4ZJT A;  2Y54 A;  3RIA A;  4UM3 S;  5AFM A;  2YME A;  5HCJ A;  3SQ9 A;  2XQA A;  3C84 A;  4TNV A;  2W8G A;  4IL4 A;  2XQ8 A;  2BYP A;  4ILB A;  4QAC A;  4Z91 A;  3SQ6 A;  4NZB A;  2XQ3 A;  2XZ5 A;  5J5H A;  3WTM A;  4A98 A;  2XQ5 A;  4QAA A;  3WTL A;  4ILC A;  3U8L A;  2BYN A;  3P50 A;  5HEO A;  3RIF A;  3RQU A;  3RQW A;  4AFH A;  3UUB A;  3JAF A;  3WTI A;  2VL0 A;  2Y7Y A;  5FJV A;  4UM1 A;  4ALX A;  5IUX A;  4QH4 A;  3TLV A;  4IRE A;  2BG9 B;  4ZZB A;  3C79 A;  3WTO A;  4AFT A;  2WN9 A;  3WTN A;  2PGZ A;  3U8N A;  3TLT A;  2BG9 C;  2YMD A;  3WTJ A;  4BFQ A;  4TWH A;  4BQT A;  2BG9 A;  4EZ1 A;  3UU6 A;  4HFI A;  3GUA A;  4DBM A;  2PH9 A;  4UXU A;  4ZZC A;  5AIN A;  4NPP A;  2XNV A;  4ZRU A;  3ZDG A;  3PEO A;  3IGQ A;  4XK9 A;  4QH5 A;  2W8F A;  4TWF A;  5HCM A;  4COF A;  5BRX A;  4XHE A;  2Y56 A;  3SIO A;  2QC1 B;  3UQ7 A;  2X00 D;  4B5D A;  3EI0 A;  3UU3 A;  2XQ7 A;  5BW2 A;  3UU4 A;  4LML A;  1UV6 A;  4D01 A;  2BG9 E;  3EAM A;  5HEG A;  3TLS A;  4ZR6 A;  4F8H A;  5TVC A;  3SH1 A;  2BYS A;  2WNL A;  2XQ6 A;  3LSV A;  2Y58 A;  4HFB A;  4TNW A;  3ZKR A;  2BR8 A;  5LXB A;  4UY2 A;  5AFL A;  5J5I A;  5J0Z A;  5AFN A;  4HFD A;  5KZU A;  3RHW A;  2YN6 A;  3JAE A;  5SYO A;  2YKS A;  4FRR A;  3RI5 A;  4TWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...