2YVHA

Crystal structure of the operator-binding form of the multi-drug binding transcriptional repressor cgmr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
b'SKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription/dna
total genus 55
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yvhA00
3T6NA 4I6ZA 5FHPA 3SFIA 4W97A 1U9OA 3O8GA 4AF5A 3LSRA 4GCTA 5H9TA 3WHBA 2XGDA 3G56A 2VPRA 3V6GA 3AQSA 5F0CA 3GZIA 3BR6A 2NS8A 5D1RA 2ID6A 2G7SA 1QVTA 2RAEA 5F0FA 2G0EA 3S5RA 3ZQGA 2O7TA 3BR2A 3COLA 3O60A 5DAJA 3VW0A 1JT0A 3B81A 3IH4A 2QOPA 3BTJA 1RKWA 4B1RA 3NI7A 4D7MA 3BRUA 4D5CA 2HYTA 5C4YA 2WV1A 1UI5A 2FQ4A 5GP9A 1UI6A 2V57A 3QPLA 3VPRA 1T56A 3QBMA 1JUMA 2PBXA 3BTLA 3BR0A 4MXMA 2DG8A 3G1LA 1VI0A 3HGGA 3BQZA 3DPJA 2UXUA 1SGMA 5K7ZA 2IBDA 3ON2A 4M3FA 3FIWA 5IOYA 3ANPA 1JT6A 3VVYA 1QVUA 4D7NA 2IU5A 2UXIA 2NP5A 4ABZA 4GFKA 2FX0A 3BR1A 2ZOYA 3ANGA 3VUQA 2VKEA 2VKVA 2GBYA 2JJ7A 2XPUA 3E7QA 4W1UA 2EH3A 3LOCA 3VVZA 3F1BA 2TRTA 5HAWA 2NP3A 1ZKGA 3Q0WA 4JNNA 4MO7A 3SDGA 2IAIA 5AQCA 5HBUA 2Q24A 2FBQA 2F07A 5D19A 2ZCMA 3DCFA 3BR5A 4M3BA 3LSPA 3HGYA 5FGLA 3HIMA 3F0CA 1BJZA 4GFLA 4NELA 1ZK8A 4ME9A 2X6OA 3BR3A 2XB5A 1U9NA 1JUSA 3BNIA 1A6IA 2HXIA 3VW2A 4AC6A 5F1JA 3V78A 5CXGA 3B6CA 3EUPA 4GCLA 2HYJA 2QKOA 2PZ9A 4ACIA 2RHAA 2Y31A 3AQTA 4JKZA 3HTIA 3PASA 4M3DA 2HKUA 4M3GA 3Q0UA 5J3LA 3HE0A 2YVEA 1Z77A 5K7FA 4HKUA 5FKKA 2HXOA 1Z0XA 2XPVA 4I76A 3LHQA 2X9DA 4AC0A 4YZEA 5CXIA 3PPBA 3KKDA 3TP3A 1QPIA 2O7OA 5EFYA 2OERA 3BTCA 4JL3A 3ZQIA 4MK6A 2ZB9A 3MVPA 4PXIA 5EYRA 4CGRA 1RPWA 2G3BA 3G7RA 1RKTA 5F08A 4L62A 3KZ9A 2HQ5A 3NPIA 1JTYA 3LJLA 3NXCA 3TP0A 3ZQFA 3BT9A 2WUIA 2TCTA 2XGCA 3QKXA 2FJ1A 3JSJA 4G12A 5HSZA 3IH2A 2REKA 1JTXA 3BJBA 3NNRA 2G7GA 3WHCA 2QWTA 2GFNA 3IH3A 2RASA 4GCKA 3LSJA 2XRLA 5F04A 2UXHA 2NS7A 4AUXA 3BCGA 2XDNA 4KWAA 5IOZA 2D6YA 5FKOA 4B3AA 5CW8A 4JYKA 2IEKA 2FD5A 5FKLA 3VIBA 3CRJA 3VOKA 4UDSA 3CCYA 5K58A 3RD3A 2DG7A 1JUPA 2ZOZA 4D5FA 3P9TA 5F27A 2NX4A 2W53A 2Y2ZA 3FK7A 3B6AA 5EZHA 3BTIA 2GENA 2QIBA 2OPTA 2YVHA 3CWRA 3C07A 5GPCA 5EZGA 3BQYA 4DW6A 3Q0VA 5K7HA 3VOXA 3C2BA 2UXOA 5D18A 3QQAA 3HTHA 2ID3A 5J1UA 4ICHA 3NRGA 4X1EA 3IUVA 3FRQA 4XK4A 3ZQHA 4V2GA 5FKNA 2XPWA 3ON4A 3GEUA 2XGEA 5J1RA 2GUHA 3KKCA 3Q3SA 3BHQA 2ZCXA 1T33A 3G1OA 2JK3A 3LWJA 2DTZA 3KNWA 2QTQA 2Y30A 2WGBA 3PM1A 3CDLA 3HTAA 5GPAA 3CJDA 3RH2A 5IP6A 3VP5A 3ZQLA 4NN1A 3VW1A 2UXPA 5J1YA 5FKMA 2ZCNA 4M3EA 3EGQA 2OF7A 3QPSA 3HTJA 3DEWA 3MNLA 3VVXA 3O8HA 1ORKA 5FMPA 2QCOA 2G7LA 3FK6A 5IPAA 2I10A 4V2FA 2OI8A 3G1MA 5F0HA
chains in the Genus database with same CATH superfamily
3T6NA 4I6ZA 5FHPA 3SFIA 4W97A 1U9OA 2PFVA 3O8GA 4AF5A 3LSRA 4GCTA 5H9TA 3WHBA 2XGDA 3G56A 2VPRA 3V6GA 3AQSA 5F0CA 3GZIA 3BR6A 2NS8A 5D1RA 2ID6A 2G7SA 1QVTA 3DU5A 2RAEA 5F0FA 2G0EA 3S5RA 3ZQGA 2O7TA 3BR2A 3COLA 3O60A 5DAJA 2R7RA 3VW0A 1JT0A 3B81A 3IH4A 2QOPA 3BTJA 1RKWA 4B1RA 3NI7A 4D7MA 3BRUA 4D5CA 2HYTA 5C4YA 2WV1A 1UI5A 2FQ4A 5GP9A 1UI6A 2V57A 3QPLA 3VPRA 1T56A 3QBMA 1JUMA 2PBXA 3BTLA 3BR0A 4MXMA 2DG8A 3G1LA 1VI0A 3HGGA 3BQZA 3DPJA 2UXUA 1SGMA 5K7ZA 2IBDA 3ON2A 4C2MA 4M3FA 3FIWA 5IOYA 4DVYP 3ANPA 1JT6A 3VVYA 1QVUA 4D7NA 2IU5A 2UXIA 2NP5A 4ABZA 4GFKA 2FX0A 3BR1A 2ZOYA 3ANGA 3VUQA 2VKEA 2VKVA 2GBYA 2JJ7A 2XPUA 3E7QA 4W1UA 2EH3A 3LOCA 3VVZA 3F1BA 3FHNA 2TRTA 5HAWA 2R7WA 2NP3A 1ZKGA 4OD5A 3Q0WA 4JNNA 4MO7A 3SDGA 2IAIA 5AQCA 5HBUA 2Q24A 2FBQA 2F07A 5D19A 2ZCMA 3DCFA 3BR5A 4M3BA 3LSPA 3HGYA 5FGLA 3HIMA 3F0CA 1BJZA 4GFLA 4NELA 1ZK8A 4ME9A 2X6OA 3BR3A 2XB5A 3KYLA 1U9NA 1JUSA 3BNIA 1A6IA 2HXIA 3VW2A 4AC6A 5F1JA 3V78A 5CXGA 3B6CA 3EUPA 4GCLA 2HYJA 2B1EA 2QKOA 2PZ9A 4ACIA 2RHAA 2Y31A 3AQTA 2ZY9A 4JKZA 3HTIA 3PASA 4M3DA 2HKUA 4M3GA 2R7OA 3Q0UA 5J3LA 4U9NA 4U9LA 3HE0A 2YVEA 1Z77A 4OD4A 5K7FA 4HKUA 5FKKA 2HXOA 1Z0XA 2XPVA 4I76A 3LHQA 2X9DA 4AC0A 4WIBA 4YZEA 5CXIA 3PPBA 3KKDA 3TP3A 1QPIA 2O7OA 2YVXA 5EFYA 2OERA 3BTCA 4JL3A 3ZQIA 4IRVA 2R7UA 4MK6A 2ZB9A 3MVPA 4PXIA 5EYRA 4CGRA 1RPWA 2G3BA 3G7RA 1RKTA 5F08A 4L62A 3KZ9A 2HQ5A 3NPIA 1JTYA 3LJLA 3NXCA 3TP0A 3ZQFA 3BT9A 2WUIA 2TCTA 2XGCA 3QKXA 2FJ1A 3JSJA 4G12A 5HSZA 3NS4A 3IH2A 2REKA 2FJI1 1JTXA 3BJBA 3NNRA 2G7GA 3WHCA 2QWTA 2GFNA 3IH3A 2RASA 3DU6A 4GCKA 3LSJA 2XRLA 5F04A 2UXHA 2NS7A 4AUXA 3BCGA 2XDNA 4KWAA 5IOZA 2D6YA 5FKOA 4B3AA 5CW8A 4JYKA 2IEKA 2FD5A 5FKLA 3VIBA 3CRJA 3VOKA 4UDSA 3CCYA 5K58A 3RD3A 2DG7A 2R7SA 1JUPA 2ZOZA 3VTIA 3P9TA 4D5FA 5F27A 2NX4A 2W53A 2Y2ZA 3FK7A 3B6AA 5EZHA 3BTIA 2GENA 2QIBA 2OPTA 2YVHA 3SWHA 3CWRA 3C07A 5GPCA 5EZGA 3BQYA 4DW6A 3Q0VA 5K7HA 3VOXA 3C2BA 2UXOA 5D18A 3QQAA 3HTHA 2ID3A 3K8PC 5J1UA 4ICHA 3NRGA 4X1EA 3IUVA 3FRQA 4XK4A 3ZQHA 4V2GA 5FKNA 2XPWA 3ON4A 3GEUA 2XGEA 5J1RA 2GUHA 3KKCA 3Q3SA 3BHQA 2ZCXA 2R7XA 1T33A 3G1OA 2JK3A 3LWJA 2DTZA 3KNWA 2QTQA 2A2FX 2Y30A 2WGBA 3PM1A 3CDLA 3HTAA 5GPAA 3CJDA 3RH2A 5IP6A 3VP5A 3ZQLA 4NN1A 5CQGA 2B3WA 3VW1A 2UXPA 5J1YA 2R7VA 5FKMA 2ZCNA 4M3EA 3EGQA 2OF7A 3QPSA 3HTJA 2R7QA 3DEWA 3MNLA 3VVXA 3O8HA 1ORKA 5FMPA 2QCOA 2G7LA 3FK6A 5IPAA 2R7TA 2I10A 4V2FA 2OI8A 3G1MA 5F0HA
chains in the Genus database with same CATH topology
3T6NA 4I6ZA 5FHPA 3SFIA 4W97A 1U9OA 3O8GA 4AF5A 3LSRA 4GCTA 5H9TA 3WHBA 2XGDA 3G56A 2VPRA 3V6GA 3AQSA 5F0CA 3GZIA 3BR6A 2NS8A 5D1RA 2ID6A 2G7SA 1QVTA 2RAEA 5F0FA 2G0EA 3S5RA 3ZQGA 2O7TA 3BR2A 3COLA 3O60A 5DAJA 3VW0A 1JT0A 3B81A 3IH4A 2QOPA 3BTJA 1RKWA 4B1RA 3NI7A 4D7MA 3BRUA 4D5CA 2HYTA 5C4YA 2WV1A 1UI5A 2FQ4A 5GP9A 1UI6A 2V57A 3QPLA 3VPRA 1T56A 3QBMA 1JUMA 2PBXA 3BTLA 3BR0A 4MXMA 2DG8A 3G1LA 1VI0A 3HGGA 3BQZA 3DPJA 2UXUA 1SGMA 5K7ZA 2IBDA 3ON2A 4M3FA 3FIWA 5IOYA 3ANPA 1JT6A 3VVYA 1QVUA 4D7NA 2IU5A 2UXIA 2NP5A 4ABZA 4GFKA 2FX0A 3BR1A 2ZOYA 3ANGA 3VUQA 2VKEA 2VKVA 2GBYA 2JJ7A 2XPUA 3E7QA 4W1UA 2EH3A 3LOCA 3VVZA 3F1BA 2TRTA 5HAWA 2NP3A 1ZKGA 3Q0WA 4JNNA 4MO7A 3SDGA 2IAIA 5AQCA 5HBUA 2Q24A 2FBQA 2F07A 5D19A 2ZCMA 3DCFA 3BR5A 4M3BA 3LSPA 3HGYA 5FGLA 3HIMA 3F0CA 1BJZA 4GFLA 4NELA 1ZK8A 4ME9A 2X6OA 3BR3A 2XB5A 1U9NA 1JUSA 3BNIA 1A6IA 2HXIA 3VW2A 4AC6A 5F1JA 3V78A 5CXGA 3B6CA 3EUPA 4GCLA 2HYJA 2QKOA 2PZ9A 4ACIA 2RHAA 2Y31A 3AQTA 4JKZA 3HTIA 3PASA 4M3DA 2HKUA 4M3GA 3Q0UA 5J3LA 3HE0A 2YVEA 1Z77A 5K7FA 4HKUA 5FKKA 2HXOA 1Z0XA 2XPVA 4I76A 3LHQA 2X9DA 4AC0A 4YZEA 5CXIA 3PPBA 3KKDA 3TP3A 1QPIA 2O7OA 5EFYA 2OERA 3BTCA 4JL3A 3ZQIA 4MK6A 2ZB9A 3MVPA 4PXIA 5EYRA 4CGRA 1RPWA 2G3BA 3G7RA 1RKTA 5F08A 4L62A 3KZ9A 2HQ5A 3NPIA 1JTYA 3LJLA 3NXCA 3TP0A 3ZQFA 3BT9A 2WUIA 2TCTA 2XGCA 3QKXA 2FJ1A 3JSJA 4G12A 5HSZA 3IH2A 2REKA 1JTXA 3BJBA 3NNRA 2G7GA 3WHCA 2QWTA 2GFNA 3IH3A 2RASA 4GCKA 3LSJA 2XRLA 5F04A 2UXHA 2NS7A 4AUXA 3BCGA 2XDNA 4KWAA 5IOZA 2D6YA 5FKOA 4B3AA 5CW8A 4JYKA 2IEKA 2FD5A 5FKLA 3VIBA 3CRJA 3VOKA 4UDSA 3CCYA 5K58A 3RD3A 2DG7A 1JUPA 2ZOZA 4D5FA 3P9TA 5F27A 2NX4A 2W53A 2Y2ZA 3FK7A 3B6AA 5EZHA 3BTIA 2GENA 2QIBA 2OPTA 2YVHA 3CWRA 3C07A 5GPCA 5EZGA 3BQYA 4DW6A 3Q0VA 5K7HA 3VOXA 3C2BA 2UXOA 5D18A 3QQAA 3HTHA 2ID3A 5J1UA 4ICHA 3NRGA 4X1EA 3IUVA 3FRQA 4XK4A 3ZQHA 4V2GA 5FKNA 2XPWA 3ON4A 3GEUA 2XGEA 5J1RA 2GUHA 3KKCA 3Q3SA 3BHQA 2ZCXA 1T33A 3G1OA 2JK3A 3LWJA 2DTZA 3KNWA 2QTQA 2Y30A 2WGBA 3PM1A 3CDLA 3HTAA 5GPAA 3CJDA 3RH2A 5IP6A 3VP5A 3ZQLA 4NN1A 3VW1A 2UXPA 5J1YA 5FKMA 2ZCNA 4M3EA 3EGQA 2OF7A 3QPSA 3HTJA 3DEWA 3MNLA 3VVXA 3O8HA 1ORKA 5FMPA 2QCOA 2G7LA 3FK6A 5IPAA 2I10A 4V2FA 2OI8A 3G1MA 5F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6N A;  4I6Z A;  5FHP A;  3SFI A;  4W97 A;  1U9O A;  3O8G A;  4AF5 A;  3LSR A;  4GCT A;  5H9T A;  3WHB A;  2XGD A;  3G56 A;  2VPR A;  3V6G A;  3AQS A;  5F0C A;  3GZI A;  3BR6 A;  2NS8 A;  5D1R A;  2ID6 A;  2G7S A;  1QVT A;  2RAE A;  5F0F A;  2G0E A;  3S5R A;  3ZQG A;  2O7T A;  3BR2 A;  3COL A;  3O60 A;  5DAJ A;  3VW0 A;  1JT0 A;  3B81 A;  3IH4 A;  2QOP A;  3BTJ A;  1RKW A;  4B1R A;  3NI7 A;  4D7M A;  3BRU A;  4D5C A;  2HYT A;  5C4Y A;  2WV1 A;  1UI5 A;  2FQ4 A;  5GP9 A;  1UI6 A;  2V57 A;  3QPL A;  3VPR A;  1T56 A;  3QBM A;  1JUM A;  2PBX A;  3BTL A;  3BR0 A;  4MXM A;  2DG8 A;  3G1L A;  1VI0 A;  3HGG A;  3BQZ A;  3DPJ A;  2UXU A;  1SGM A;  5K7Z A;  2IBD A;  3ON2 A;  4M3F A;  3FIW A;  5IOY A;  3ANP A;  1JT6 A;  3VVY A;  1QVU A;  4D7N A;  2IU5 A;  2UXI A;  2NP5 A;  4ABZ A;  4GFK A;  2FX0 A;  3BR1 A;  2ZOY A;  3ANG A;  3VUQ A;  2VKE A;  2VKV A;  2GBY A;  2JJ7 A;  2XPU A;  3E7Q A;  4W1U A;  2EH3 A;  3LOC A;  3VVZ A;  3F1B A;  2TRT A;  5HAW A;  2NP3 A;  1ZKG A;  3Q0W A;  4JNN A;  4MO7 A;  3SDG A;  2IAI A;  5AQC A;  5HBU A;  2Q24 A;  2FBQ A;  2F07 A;  5D19 A;  2ZCM A;  3DCF A;  3BR5 A;  4M3B A;  3LSP A;  3HGY A;  5FGL A;  3HIM A;  3F0C A;  1BJZ A;  4GFL A;  4NEL A;  1ZK8 A;  4ME9 A;  2X6O A;  3BR3 A;  2XB5 A;  1U9N A;  1JUS A;  3BNI A;  1A6I A;  2HXI A;  3VW2 A;  4AC6 A;  5F1J A;  3V78 A;  5CXG A;  3B6C A;  3EUP A;  4GCL A;  2HYJ A;  2QKO A;  2PZ9 A;  4ACI A;  2RHA A;  2Y31 A;  3AQT A;  4JKZ A;  3HTI A;  3PAS A;  4M3D A;  2HKU A;  4M3G A;  3Q0U A;  5J3L A;  3HE0 A;  2YVE A;  1Z77 A;  5K7F A;  4HKU A;  5FKK A;  2HXO A;  1Z0X A;  2XPV A;  4I76 A;  3LHQ A;  2X9D A;  4AC0 A;  4YZE A;  5CXI A;  3PPB A;  3KKD A;  3TP3 A;  1QPI A;  2O7O A;  5EFY A;  2OER A;  3BTC A;  4JL3 A;  3ZQI A;  4MK6 A;  2ZB9 A;  3MVP A;  4PXI A;  5EYR A;  4CGR A;  1RPW A;  2G3B A;  3G7R A;  1RKT A;  5F08 A;  4L62 A;  3KZ9 A;  2HQ5 A;  3NPI A;  1JTY A;  3LJL A;  3NXC A;  3TP0 A;  3ZQF A;  3BT9 A;  2WUI A;  2TCT A;  2XGC A;  3QKX A;  2FJ1 A;  3JSJ A;  4G12 A;  5HSZ A;  3IH2 A;  2REK A;  1JTX A;  3BJB A;  3NNR A;  2G7G A;  3WHC A;  2QWT A;  2GFN A;  3IH3 A;  2RAS A;  4GCK A;  3LSJ A;  2XRL A;  5F04 A;  2UXH A;  2NS7 A;  4AUX A;  3BCG A;  2XDN A;  4KWA A;  5IOZ A;  2D6Y A;  5FKO A;  4B3A A;  5CW8 A;  4JYK A;  2IEK A;  2FD5 A;  5FKL A;  3VIB A;  3CRJ A;  3VOK A;  4UDS A;  3CCY A;  5K58 A;  3RD3 A;  2DG7 A;  1JUP A;  2ZOZ A;  4D5F A;  3P9T A;  5F27 A;  2NX4 A;  2W53 A;  2Y2Z A;  3FK7 A;  3B6A A;  5EZH A;  3BTI A;  2GEN A;  2QIB A;  2OPT A;  2YVH A;  3CWR A;  3C07 A;  5GPC A;  5EZG A;  3BQY A;  4DW6 A;  3Q0V A;  5K7H A;  3VOX A;  3C2B A;  2UXO A;  5D18 A;  3QQA A;  3HTH A;  2ID3 A;  5J1U A;  4ICH A;  3NRG A;  4X1E A;  3IUV A;  3FRQ A;  4XK4 A;  3ZQH A;  4V2G A;  5FKN A;  2XPW A;  3ON4 A;  3GEU A;  2XGE A;  5J1R A;  2GUH A;  3KKC A;  3Q3S A;  3BHQ A;  2ZCX A;  1T33 A;  3G1O A;  2JK3 A;  3LWJ A;  2DTZ A;  3KNW A;  2QTQ A;  2Y30 A;  2WGB A;  3PM1 A;  3CDL A;  3HTA A;  5GPA A;  3CJD A;  3RH2 A;  5IP6 A;  3VP5 A;  3ZQL A;  4NN1 A;  3VW1 A;  2UXP A;  5J1Y A;  5FKM A;  2ZCN A;  4M3E A;  3EGQ A;  2OF7 A;  3QPS A;  3HTJ A;  3DEW A;  3MNL A;  3VVX A;  3O8H A;  1ORK A;  5FMP A;  2QCO A;  2G7L A;  3FK6 A;  5IPA A;  2I10 A;  4V2F A;  2OI8 A;  3G1M A;  5F0H A; 
#chains in the Genus database with same CATH topology
 3T6N A;  4I6Z A;  5FHP A;  3SFI A;  4W97 A;  1U9O A;  2PFV A;  3O8G A;  4AF5 A;  3LSR A;  4GCT A;  5H9T A;  3WHB A;  2XGD A;  3G56 A;  2VPR A;  3V6G A;  3AQS A;  5F0C A;  3GZI A;  3BR6 A;  2NS8 A;  5D1R A;  2ID6 A;  2G7S A;  1QVT A;  3DU5 A;  2RAE A;  5F0F A;  2G0E A;  3S5R A;  3ZQG A;  2O7T A;  3BR2 A;  3COL A;  3O60 A;  5DAJ A;  2R7R A;  3VW0 A;  1JT0 A;  3B81 A;  3IH4 A;  2QOP A;  3BTJ A;  1RKW A;  4B1R A;  3NI7 A;  4D7M A;  3BRU A;  4D5C A;  2HYT A;  5C4Y A;  2WV1 A;  1UI5 A;  2FQ4 A;  5GP9 A;  1UI6 A;  2V57 A;  3QPL A;  3VPR A;  1T56 A;  3QBM A;  1JUM A;  2PBX A;  3BTL A;  3BR0 A;  4MXM A;  2DG8 A;  3G1L A;  1VI0 A;  3HGG A;  3BQZ A;  3DPJ A;  2UXU A;  1SGM A;  5K7Z A;  2IBD A;  3ON2 A;  4C2M A;  4M3F A;  3FIW A;  5IOY A;  4DVY P;  3ANP A;  1JT6 A;  3VVY A;  1QVU A;  4D7N A;  2IU5 A;  2UXI A;  2NP5 A;  4ABZ A;  4GFK A;  2FX0 A;  3BR1 A;  2ZOY A;  3ANG A;  3VUQ A;  2VKE A;  2VKV A;  2GBY A;  2JJ7 A;  2XPU A;  3E7Q A;  4W1U A;  2EH3 A;  3LOC A;  3VVZ A;  3F1B A;  3FHN A;  2TRT A;  5HAW A;  2R7W A;  2NP3 A;  1ZKG A;  4OD5 A;  3Q0W A;  4JNN A;  4MO7 A;  3SDG A;  2IAI A;  5AQC A;  5HBU A;  2Q24 A;  2FBQ A;  2F07 A;  5D19 A;  2ZCM A;  3DCF A;  3BR5 A;  4M3B A;  3LSP A;  3HGY A;  5FGL A;  3HIM A;  3F0C A;  1BJZ A;  4GFL A;  4NEL A;  1ZK8 A;  4ME9 A;  2X6O A;  3BR3 A;  2XB5 A;  3KYL A;  1U9N A;  1JUS A;  3BNI A;  1A6I A;  2HXI A;  3VW2 A;  4AC6 A;  5F1J A;  3V78 A;  5CXG A;  3B6C A;  3EUP A;  4GCL A;  2HYJ A;  2B1E A;  2QKO A;  2PZ9 A;  4ACI A;  2RHA A;  2Y31 A;  3AQT A;  2ZY9 A;  4JKZ A;  3HTI A;  3PAS A;  4M3D A;  2HKU A;  4M3G A;  2R7O A;  3Q0U A;  5J3L A;  4U9N A;  4U9L A;  3HE0 A;  2YVE A;  1Z77 A;  4OD4 A;  5K7F A;  4HKU A;  5FKK A;  2HXO A;  1Z0X A;  2XPV A;  4I76 A;  3LHQ A;  2X9D A;  4AC0 A;  4WIB A;  4YZE A;  5CXI A;  3PPB A;  3KKD A;  3TP3 A;  1QPI A;  2O7O A;  2YVX A;  5EFY A;  2OER A;  3BTC A;  4JL3 A;  3ZQI A;  4IRV A;  2R7U A;  4MK6 A;  2ZB9 A;  3MVP A;  4PXI A;  5EYR A;  4CGR A;  1RPW A;  2G3B A;  3G7R A;  1RKT A;  5F08 A;  4L62 A;  3KZ9 A;  2HQ5 A;  3NPI A;  1JTY A;  3LJL A;  3NXC A;  3TP0 A;  3ZQF A;  3BT9 A;  2WUI A;  2TCT A;  2XGC A;  3QKX A;  2FJ1 A;  3JSJ A;  4G12 A;  5HSZ A;  3NS4 A;  3IH2 A;  2REK A;  2FJI 1;  1JTX A;  3BJB A;  3NNR A;  2G7G A;  3WHC A;  2QWT A;  2GFN A;  3IH3 A;  2RAS A;  3DU6 A;  4GCK A;  3LSJ A;  2XRL A;  5F04 A;  2UXH A;  2NS7 A;  4AUX A;  3BCG A;  2XDN A;  4KWA A;  5IOZ A;  2D6Y A;  5FKO A;  4B3A A;  5CW8 A;  4JYK A;  2IEK A;  2FD5 A;  5FKL A;  3VIB A;  3CRJ A;  3VOK A;  4UDS A;  3CCY A;  5K58 A;  3RD3 A;  2DG7 A;  2R7S A;  1JUP A;  2ZOZ A;  3VTI A;  3P9T A;  4D5F A;  5F27 A;  2NX4 A;  2W53 A;  2Y2Z A;  3FK7 A;  3B6A A;  5EZH A;  3BTI A;  2GEN A;  2QIB A;  2OPT A;  2YVH A;  3SWH A;  3CWR A;  3C07 A;  5GPC A;  5EZG A;  3BQY A;  4DW6 A;  3Q0V A;  5K7H A;  3VOX A;  3C2B A;  2UXO A;  5D18 A;  3QQA A;  3HTH A;  2ID3 A;  3K8P C;  5J1U A;  4ICH A;  3NRG A;  4X1E A;  3IUV A;  3FRQ A;  4XK4 A;  3ZQH A;  4V2G A;  5FKN A;  2XPW A;  3ON4 A;  3GEU A;  2XGE A;  5J1R A;  2GUH A;  3KKC A;  3Q3S A;  3BHQ A;  2ZCX A;  2R7X A;  1T33 A;  3G1O A;  2JK3 A;  3LWJ A;  2DTZ A;  3KNW A;  2QTQ A;  2A2F X;  2Y30 A;  2WGB A;  3PM1 A;  3CDL A;  3HTA A;  5GPA A;  3CJD A;  3RH2 A;  5IP6 A;  3VP5 A;  3ZQL A;  4NN1 A;  5CQG A;  2B3W A;  3VW1 A;  2UXP A;  5J1Y A;  2R7V A;  5FKM A;  2ZCN A;  4M3E A;  3EGQ A;  2OF7 A;  3QPS A;  3HTJ A;  2R7Q A;  3DEW A;  3MNL A;  3VVX A;  3O8H A;  1ORK A;  5FMP A;  2QCO A;  2G7L A;  3FK6 A;  5IPA A;  2R7T A;  2I10 A;  4V2F A;  2OI8 A;  3G1M A;  5F0H A; 
#chains in the Genus database with same CATH homology
 3T6N A;  4I6Z A;  5FHP A;  3SFI A;  4W97 A;  1U9O A;  3O8G A;  4AF5 A;  3LSR A;  4GCT A;  5H9T A;  3WHB A;  2XGD A;  3G56 A;  2VPR A;  3V6G A;  3AQS A;  5F0C A;  3GZI A;  3BR6 A;  2NS8 A;  5D1R A;  2ID6 A;  2G7S A;  1QVT A;  2RAE A;  5F0F A;  2G0E A;  3S5R A;  3ZQG A;  2O7T A;  3BR2 A;  3COL A;  3O60 A;  5DAJ A;  3VW0 A;  1JT0 A;  3B81 A;  3IH4 A;  2QOP A;  3BTJ A;  1RKW A;  4B1R A;  3NI7 A;  4D7M A;  3BRU A;  4D5C A;  2HYT A;  5C4Y A;  2WV1 A;  1UI5 A;  2FQ4 A;  5GP9 A;  1UI6 A;  2V57 A;  3QPL A;  3VPR A;  1T56 A;  3QBM A;  1JUM A;  2PBX A;  3BTL A;  3BR0 A;  4MXM A;  2DG8 A;  3G1L A;  1VI0 A;  3HGG A;  3BQZ A;  3DPJ A;  2UXU A;  1SGM A;  5K7Z A;  2IBD A;  3ON2 A;  4M3F A;  3FIW A;  5IOY A;  3ANP A;  1JT6 A;  3VVY A;  1QVU A;  4D7N A;  2IU5 A;  2UXI A;  2NP5 A;  4ABZ A;  4GFK A;  2FX0 A;  3BR1 A;  2ZOY A;  3ANG A;  3VUQ A;  2VKE A;  2VKV A;  2GBY A;  2JJ7 A;  2XPU A;  3E7Q A;  4W1U A;  2EH3 A;  3LOC A;  3VVZ A;  3F1B A;  2TRT A;  5HAW A;  2NP3 A;  1ZKG A;  3Q0W A;  4JNN A;  4MO7 A;  3SDG A;  2IAI A;  5AQC A;  5HBU A;  2Q24 A;  2FBQ A;  2F07 A;  5D19 A;  2ZCM A;  3DCF A;  3BR5 A;  4M3B A;  3LSP A;  3HGY A;  5FGL A;  3HIM A;  3F0C A;  1BJZ A;  4GFL A;  4NEL A;  1ZK8 A;  4ME9 A;  2X6O A;  3BR3 A;  2XB5 A;  1U9N A;  1JUS A;  3BNI A;  1A6I A;  2HXI A;  3VW2 A;  4AC6 A;  5F1J A;  3V78 A;  5CXG A;  3B6C A;  3EUP A;  4GCL A;  2HYJ A;  2QKO A;  2PZ9 A;  4ACI A;  2RHA A;  2Y31 A;  3AQT A;  4JKZ A;  3HTI A;  3PAS A;  4M3D A;  2HKU A;  4M3G A;  3Q0U A;  5J3L A;  3HE0 A;  2YVE A;  1Z77 A;  5K7F A;  4HKU A;  5FKK A;  2HXO A;  1Z0X A;  2XPV A;  4I76 A;  3LHQ A;  2X9D A;  4AC0 A;  4YZE A;  5CXI A;  3PPB A;  3KKD A;  3TP3 A;  1QPI A;  2O7O A;  5EFY A;  2OER A;  3BTC A;  4JL3 A;  3ZQI A;  4MK6 A;  2ZB9 A;  3MVP A;  4PXI A;  5EYR A;  4CGR A;  1RPW A;  2G3B A;  3G7R A;  1RKT A;  5F08 A;  4L62 A;  3KZ9 A;  2HQ5 A;  3NPI A;  1JTY A;  3LJL A;  3NXC A;  3TP0 A;  3ZQF A;  3BT9 A;  2WUI A;  2TCT A;  2XGC A;  3QKX A;  2FJ1 A;  3JSJ A;  4G12 A;  5HSZ A;  3IH2 A;  2REK A;  1JTX A;  3BJB A;  3NNR A;  2G7G A;  3WHC A;  2QWT A;  2GFN A;  3IH3 A;  2RAS A;  4GCK A;  3LSJ A;  2XRL A;  5F04 A;  2UXH A;  2NS7 A;  4AUX A;  3BCG A;  2XDN A;  4KWA A;  5IOZ A;  2D6Y A;  5FKO A;  4B3A A;  5CW8 A;  4JYK A;  2IEK A;  2FD5 A;  5FKL A;  3VIB A;  3CRJ A;  3VOK A;  4UDS A;  3CCY A;  5K58 A;  3RD3 A;  2DG7 A;  1JUP A;  2ZOZ A;  4D5F A;  3P9T A;  5F27 A;  2NX4 A;  2W53 A;  2Y2Z A;  3FK7 A;  3B6A A;  5EZH A;  3BTI A;  2GEN A;  2QIB A;  2OPT A;  2YVH A;  3CWR A;  3C07 A;  5GPC A;  5EZG A;  3BQY A;  4DW6 A;  3Q0V A;  5K7H A;  3VOX A;  3C2B A;  2UXO A;  5D18 A;  3QQA A;  3HTH A;  2ID3 A;  5J1U A;  4ICH A;  3NRG A;  4X1E A;  3IUV A;  3FRQ A;  4XK4 A;  3ZQH A;  4V2G A;  5FKN A;  2XPW A;  3ON4 A;  3GEU A;  2XGE A;  5J1R A;  2GUH A;  3KKC A;  3Q3S A;  3BHQ A;  2ZCX A;  1T33 A;  3G1O A;  2JK3 A;  3LWJ A;  2DTZ A;  3KNW A;  2QTQ A;  2Y30 A;  2WGB A;  3PM1 A;  3CDL A;  3HTA A;  5GPA A;  3CJD A;  3RH2 A;  5IP6 A;  3VP5 A;  3ZQL A;  4NN1 A;  3VW1 A;  2UXP A;  5J1Y A;  5FKM A;  2ZCN A;  4M3E A;  3EGQ A;  2OF7 A;  3QPS A;  3HTJ A;  3DEW A;  3MNL A;  3VVX A;  3O8H A;  1ORK A;  5FMP A;  2QCO A;  2G7L A;  3FK6 A;  5IPA A;  2I10 A;  4V2F A;  2OI8 A;  3G1M A;  5F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...