32C2B

Structure of an activity suppressing fab fragment to cytochrome p450 aromatase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
218
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCTVTGYSISSDYAWNWIRQFPGNKLEWMGYISYSGSTSYNPSLKSRISITRDTSKNQFFLQLSSVTTEDTATYYCARGYYGSSHSPVWGAGTTVTVSSAKTTPPPVYPLVPGSLAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an activity suppressing Fab fragment to cytochrome P450 aromatase: insights into the antibody-antigen interactions.
pubmed doi rcsb
molecule tags Immune system
molecule keywords IGG1 ANTIBODY 32C2
total genus 36
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1999-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 32c2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 32c2B01
4ZS6D 2RCSL 2PTUA 5I1IL 1G7PA 1HYSD 1JZ3A 1BWWA 5E8EB 1SY6A 3VU2A 1FZMB 1S9VB 3JTSB 5HPOA 2VAAB 2VUOA 15C8H 4PJFA 4QF1B 4M61B 5DZOA 4GAGH 1JWMA 1KPRA 4R0LC 4F8TA 2IH1A 4LKCB 4MB3A 3TNNB 4JFOB 5ADOL 1VGKA 3WKMH 4NM8H 1OAUH 1J8HD 1K85A 3WUWB 4WENB 2X4NA 1CFVH 4WFHD 1CYGA 1KCSH 2XTLA 2ATPB 4Q58C 4DEPC 2XI9A 4NNPH 1OLZA 4G43A 3QUYD 5IMMB 3ARBA 4ERSL 3VWJB 1ZWIA 1OM3L 4NNPL 4PJEB 5D1QC 1YNTA 4WGVB 3CMOL 3DJ9A 3PE9A 4PJCE 3GO1H 3MTRA 2E9WA 1RJYA 2BVOB 5SV4A 5JQHC 1UVQA 3QRGL 1KJMB 1UM6L 5DRXB 2YD3A 1IMHC 3BXNA 2XN9B 5CMAB 5KG9B 1L7IH 2IPTH 1AXTH 3O4OC 5IMOB 5FGCE 4RMUA 3JV0A 5GZNC 3B4NA 3LB6D 3PV6A 3QJFB 1WC7B 4FFZL 3VGEA 5GS0C 4WW2A 1HINH 4MSWA 4PRNB 4UOW1 1VPOH 2DI7A 2Q86A 3NCMA 1RULH 4NCDA 4XPAH 4P4KA 1Z3GL 3LKQA 1IGML 1AD0A 1CE1L 2RCSH 1ZA3B 3BXNB 1GC1L 5J1TC 3RDTC 4L8SB 1DBBL 5JPMA 1T5XB 4FZ8H 4YLQT 3EFFA 4P2OA 3AM8C 1MJUH 4E42B 3WUWG 4W4OC 4GKZB 3MRDA 3T04D 2PW2B 1M7XA 5FYLE 1F90H 5EU4B 5CD5C 4OFVA 1KNOB 3IRPX 2F8VA 1LEIA 1F6LL 1ZWIB 1KFAL 1MH5B 2W9EH 3U4BH 2QQNH 5KVFH 1I3GH 4PJEE 1CLOH 4OKVA 1UC6A 3C8KA 4YFEA 4LGRB 3TBWA 2VRAA 4PUBL 5FM5M 3CZFA 4PJCF 4X5LA 3D25A 4FQPA 5IBLD 4E0RB 2CDFA 3HN3A 3UZVB 5EO1A 3KYMA 2BRRH 4ZPVA 5CJQL 3C09B 3P4MB 4NN7C 4HJJL 4N9GA 1DQQA 5GGSB 4PJBA 3D39D 2D7TH 4EOWL 1FAKT 2APFA 1OWRM 5FM5O 4E9LA 4M5YH 1KPUA 5HSFA 2FCBA 4Z7WA 4EI5D 2XACC 2F19L 1NL0H 5EZOL 2XPGB 4GG8A 4QOKD 3MYZA 4M3JA 5DJXB 4YDKH 2QHRL 3B9VA 3CIQA 5F9OH 1X5AA 3GSRB 1YEJL 5C6TH 3SE8L 3FRUA 2DQUL 2DLIA 4LQ1A 1UB5A 3LKOA 5BRZB 1FC2D 1T7YA 3DO7A 3PWNA 1PDKA 2ZP0T 5GGSA 5E9DB 2VXTH 5T5FL 3B9KB 3V2AR 3QRGH 3FHAA 2CRMA 5C9JA 2EH7H 4LCUA 3PWVA 3AREA 1D5IL 4OGAD 2DD8H 1DQMH 3U0TA 3V5HA 4WUKH 5IMLB 5IK3B 5HYSG 2WW8A 1PY4A 5IEKA 3NTCH 4CAGA 1GHFH 3BQUB 2AS5M 2XRAL 4OF5A 1CE6A 4ZNEA 3REVA 2FL5B 4DGYH 4DZBA 5T1DL 1X6NA 5I8OL 5TE4H 4K94L 1U8QA 1LDPL 2V5YA 1URLA 4WUUD 2IAMA 4LEOA 3QAZC 5C0IB 5I8EB 3PF2A 5F6IC 3R0MA 4FQIH 4I9WD 1PFCA 1FPTH 5ADOH 3ULUF 1A7NL 3O3EB 3WDHA 4JAMB 1A3RL 1I7TA 1A22B 1U92B 1DVFA 4XVUD 2C3WA 3F5WB 4JN2A 1KJ2A 5DJZB 1P4LB 3PJSA 1I8KA 1HQRA 3OMZA 2AJSH 1OTTC 2LFGA 3TBSB 3GSXB 1F6AB 4X4XA 1TZGL 4AYFA 1AGFB 4PJIE 3CDFA 3TBVA 2APVA 5DMYA 3MRLB 4QRTA 3MREA 2P5WB 2NLJA 2FWOA 5T1LD 3MV11 4JM4L 3QDMA 2P42B 1A2YB 1JHLH 4P3DB 3UO1H 1FH5H 5DRNA 3R8QA 1A6AA 3BIAX 2CLZA 3O9WA 3W0WA 4JFDB 1JYNA 1ZT7A 2A6JB 2Q8AL 4L3CA 2X9YA 3O9WC 3LMJH 3HA0A 1QRKA 4UILL 4NJ9H 1EUUA 1CU4H 4XNZC 3MNWA 2EDLA 3IYLW 4AL8L 1NEZA 1FH5L 3UJTH 3KPOA 3HC4L 1JRHH 5IMMA 1JYVA 2FX7H 1U6AH 4CMMA 4XX1E 4M7LH 3K4AA 4HUWB 2F54B 2H9GB 1A4KB 5C0AB 4QCIA 1AJ7L 1CVSC 1RUML 3O3DB 5T1KD 2WWKT 5HI4D 4P99A 3TO2A 3O3AA 4KGLA 2A83A 4NNYA 3O45B 5EH1A 3AU1B 3ORJA 3TZVC 1NLDH 5DMGD 3WL9B 2F53B 3FB5A 4HUWA 4ALAL 2VDRH 3VFWA 1JPSH 5FV1L 1FYTE 4ZXBB 4L4TB 4LSTL 5GISL 3ZE1E 5F72S 5LXGL 1QFUL 3WFEH 3NPSC 3SBWA 5JUEL 5ICZA 5I75B 3PGCA 3D85A 3HNVL 4LCWD 1HHGB 2OQJB 2A9NL 3VXUE 1WICA 1O7VA 1OQOA 4J4PA 1C16B 1ACYH 5GS0D 2HH0H 1G6VK 2EXWC 4TRPH 2NY1B 1P6AB 1MVFA 3EBAA 3IDGA 3NAAL 4R7NB 2YD5A 4LEXL 3I3EA 1BBDL 1HH9A 3BD5A 3E1F1 4G8GD 4JRXA 1GGIL 2DLGA 4CKVX 1OTUD 5DVOA 1XGYL 3L3IB 1WBZB 5KAQF 4XXDA 2NY6D 5GGTL 1EX0A 4YFLF 4NN7B 5D2LB 2A73B 4NKIL 1DEEA 5HGGS 1EK3A 3BP7A 5FOJA 4R97C 1CWVA 2J5LC 3HC0B 3WCYA 3WLWC 3ULVF 4J3SA 1VESA 4G42B 1QOKA 3REWA 1AHWB 1K3ZA 1CGVA 5IP4A 1AGCA 3ZDXE 1OT1A 5E9DE 1NGZB 4YDIH 4FA8A 2ERJC 3SDAC 3KS0H 4IIQA 5C07A 1JHTB 1YY8A 2R0LL 3VG0H 4L3EE 3AAZB 4O00A 1U2CA 5IB5A 1MFCL 3GSNL 5EN2B 1MWAB 5C0BE 1KFAH 5IJVA 1BPVA 4GAJH 4HFUL 1CFNA 4K07A 3DXAD 4O4YH 2G9HB 1XR9B 4N1CA 3DO7B 3MO1A 3MXWL 1TTUA 3VDAA 4JDTL 1L9MA 4Y8AA 5IFJB 3NIDF 1UXSB 2ZOLA 4JGUA 2V5RA 4RFEB 1UFUA 4M7KL 4HDIA 1Y0LB 2YRPA 4XVSH 2DRUA 3RX7A 5CLTA 5IQ7H 1U91B 2VOTA 2EDNA 1P7HL 3ARSA 5I8CB 1A0QL 5KSAB 5C09B 4XPAL 4KQ4L 4BZ2H 5FYJH 1IZJA 4R8WL 4UTBH 3S88H 3JSSA 3GHEH 1P4BL 3B2VL 2DN7A 5L8JB 1MQ8A 1T80A 1Z2KA 4FMFA 4HDIB 5SWSB 3DUHA 5FA4B 3BW9A 1QBAA 4N5ED 3UTTE 1ACZA 1UYWH 3RFZC 2OL3A 1VFAA 4HMDA 4JFDE 3IFNL 3QDGB 1LP9F 4LVHB 3KPRD 3FTGA 3PWJB 4L9LB 3V8CA 4JRYD 3VWKC 2ZUQC 4HD9A 3HAEB 4M02A 4XMPL 4YH6A 3S96A 1IGFH 3GSQB 1IGCL 4ZSOA 4NQXB 4ERSH 3QCVH 4XMPH 3QG6A 4U6YA 5HHQA 3BZ4B 4B50A 1FSKB 4UT6L 2XFXA 4G6JL 3TESA 3CVHH 1C5DA 1D6EA 4NQXA 3WV0A 4NRZB 1IEAB 4KU1A 5JLZA 1NCAL 2OLDA 5H94B 1LNUB 2Z93B 2FEEI 1G7JB 4ONFH 3WFBL 5FM4A 5EU5B 4NM8L 4WWKA 5FFLA 3O4LA 3VGHA 3Q1SL 1J9CT 2R2BA 2PO6B 3GSXA 2VQ1B 3TIEB 2NTSP 4KH2A 1HQRB 5D7JC 4OI7A 3U6RB 1ONQB 1A14L 1BZ7A 1D5XB 1UEYA 3QEQE 4ZOEA 1DVFB 1QP1A 1SM3L 3BW9B 5IGXH 5IIEB 4O51B 4DK6A 1WT5A 5C0RH 5CHNB 1XFPA 1MELA 3MRKA 1ZT4A 4EN3D 2XICA 2VZOA 2WBKA 2A2QT 3UTPE 4X4MA 4AT6B 2ZSWB 2X1XR 1KT2B 2P8MB 3NOIA 3QEHA 5D7JA 1C08B 4S1RL 4QXTA 2GW5A 3LN4B 2UZIH 1AR2A 2V7HA 1LP9E 3H7BB 1HHIB 4P2QB 4YPGB 1AGEA 2O5XL 3GJFH 5EOTA 2QV2A 2ZOKB 4ACPA 4AIOA 3BPLB 1EUTA 2WP3O 5HXMA 1CT8A 1EEQA 4F7PB 4M00A 5LKNA 2CRIA 3MFFB 2EDKA 3KHQA 2IH1B 4HKJA 1KC5H 3RTQD 1A6VH 2IPUK 1G1CA 1YYMH 2WBJD 1Z9LA 1MFBH 3U30C 5J1AA 5SWZE 5KSVB 2OL3H 2V9QA 2VXVH 1C5CH 4PRHA 1LVEA 4HPYL 5DZNA 3QO1B 2J6EH 2EC9T 4PBWD 3T2OA 4DGVH 5HGBA 4XPHH 1IL1B 3L95A 1IEBA 1JPFA 4WWKD 1AGDA 4GRMB 4FTVB 1Y18B 1YECL 1K8IA 4MB4A 4P9HC 2IAMB 5DURB 2EZ0C 4K94H 1PQZB 4CMMB 5E1AB 2C7UA 1ZT4B 1WAAA 5F9JB 4P3CL 5JHLH 3VXOB 4TTGA 3L95B 5F9WC 5D2LA 1P1ZA 4NNXB 2ADGB 1QYGH 3MLVL 1RZGB 3IDMA 1JGDB 4ZTOL 1IGYB 1R3IH 2FIRT 1DUYB 1AH1A 4CNIA 1J1PL 3U4EA 4W4OA 2NY1C 5LBSH 5FYKD 2VIRB 3PL6A 4P23A 3L7FA 4GAFB 1N7ML 1DANT 2ZCLH 1HHJA 2OQJA 3QWQB 4YBQC 1OSZB 4EXPX 3IGAA 1Z0MA 4LSTH 1QR4A 3C5SB 3KPNA 3LS5H 4FXGA 5I8KL 3VFOA 2A9NH 3C60B 5HYFA 2R1YB 4KKBD 1NCCH 2Z92A 3RTQA 2PO6C 1MAMH 1I9JL 2IADA 4BZ1H 3VXNB 2Q87A 2H1PH 3RHWK 4FXLA 3MFGB 1IFHL 1QFUH 3WFEL 1T66D 3OKKB 2VE6A 1RHHB 2WSKA 3AU1A 1J8KA 4L3EA 2FGZA 1WEJL 3G6JE 4MXQD 3MV9E 5FV2A 4HWZA 4JRXB 5C0BA 4HBCL 2YC1B 2YD8A 1AY1H 4FG6C 1GZPA 4R4FH 2QADD 1OPGH 4NSKA 4PJDA 3LMJL 2ZSVA 4KKAD 4XGZA 4XP1L 1OLLA 2GTZB 4BK5A 1DTUA 2AQ1A 4UUJB 2HFGL 1PEZA 1CLZL 3MRDB 1KIUA 3DTXA 3OXRB 5D4QA 4YK4C 3UJTL 2FGWH 3BHBA 1TENA 3MBXL 1OGAE 4DW2L 3K46A 4GG6F 2HKHH 4LVNC 4NJ9L 3PWPA 3TBTB 1BOYA 1ZA3A 1IJ9A 3S96B 3DTXB 3OXRA 2EEBA 5E6IA 5EN2A 2KL6A 3U30B 3BIKB 1QHOA 1KTDA 5I1DA 1LK3L 1I1FB 1LD9B 3SKNB 3SOBL 2ZKHH 5J3HC 2EYRA 3I85A 5ABDE 3DMMD 4MJIE 5EA0L 2ARJA 1GL4B 5IV2B 1FVCB 4Z78A 3OR7B 4ZUTB 2COQA 5FYKL 1HQ4A 3B8SA 2VDKH 3MV7E 4NO0A 4HHAA 1VDGA 5CEZL 1MAML 1R5IB 4JQXA 5KSAA 1BWMA 2YPLA 3Q3GA 2KH2B 3LS5L 1JN6A 4ZS7H 4BQCA 3TT3L 1BHGA 2AJ3B 3LS4H 5J57B 4DOHE 1J12A 2ZCLL 3GMNB 2XWJB 1BEYH 4GBXB 32C2B 4IHOB 3VXRA 3B8YA 4I4WA 3I6LD 3L7EA 1R0AH 5GGVH 1OSPH 2FX9L 1A6PA 2QQKL 5ICYB 2E6QA 1BQUA 3V6FB 1KCRH 3S6CA 1LO3L 4KY1H 2G60H 2GY7B 3IDXH 2ESVB 4TSAL 4Z7OE 1B0GA 4JG1L 2VAAA 5CILH 1X4XA 2XNAB 5FGBC 3IU4H 2VDQH 5DMIL 1ZSDB 2AXGB 4YUEH 5MEOB 3D85B 3OKMB 3D69A 5K9OB 1YEJH 5C6TL 2ITDA 2X2YA 2HTKC 1R5VB 1BFVL 3TZVA 4JQVA 4N8CH 1JZ2A 3ZDYF 3TC9A 1KIQB 3N1GC 2ICCA 3P4MA 4NP4H 4U0RB 4X6CE 4EOWH 4JHAL 4K7PL 4EUPB 2PTVA 3TO2B 4QTIL 2HT2C 1BFTA 1D5BB 3GKWH 3UYOD 4Z8FL 1S9YA 1KCVH 5KSBB 2E7LA 5TQ0H 1UXWA 12E8H 4JFFB 1AQKL 1YUHB 3CVIH 1MJ7L 1INEH 2NY0D 4PGEA 5J4MA 4ZD3H 3F12B 3FFCB 2DDQL 1NJ9A 3GMOB 4IEFB 2VDOL 2VERN 4HK0B 5ESAB 1MJJB 5DC9B 1TLKA 2W9EL 5GGTA 3ROLB 1GC1H 2M1KA 3SDXE 3BZEA 4I77L 3KHOA 5HHNA 3TH3T 3U2SB 5E4IA 3ULVH 1JWSB 1JGVH 3C2AL 1J8HE 4EZMA 3SBWC 3D69B 3RUGB 3QQ3A 5FYLD 2BSTB 3RWJA 5FO8B 1G7PB 2N56A 2JELL 2NXZD 2P5WA 4OZFG 2VDML 4XPFL 4HH9A 3DMMC 3CDYA 4NQDB 1INDH 5C07E 2H3NB 3UTSA 3SQOL 3VFMB 4XCEB 4O2EA 5ALCH 2F53A 4C58B 2GHWB 2R29H 2NZ9D 3ARRA 2D03H 5CEXA 2IAMD 5DURD 4PJIF 1G9MH 5TDPB 2AERT 4I0PA 3V95A 3QIBC 1KCRL 3B2UC 3TZVD 5TF1L 1DQLH 4RZCB 3HPLA 2R4SH 2Q6WB 4H1LB 3MJ8B 1F2QA 1JFQL 2FJGA 4B7IA 1XCTA 1HI6A 4UT6H 4GBXC 2PKDA 3VWJC 4IJ3B 3BZFA 5T1LA 1D6VH 1Q9OB 1MCSA 1U8IB 3DRTA 3SDXB 4IRJD 1T5XA 3HZVB 3PDOA 3HI5H 3GSVB 4NHCL 5E8DH 4QWWD 4BZYA 4KHXL 4FQQB 2ZUVA 5JZ7C 4YXKL 5DEGA 4KKBC 3N1QC 2IMNA 1WISA 1FGNL 3RDTA 1NCTA 1KPRB 2UVEA 3FTGB 5EZJB 5GJSH 4BH8B 1CL7L 1LD9A 2Y5TB 3SKNA 1T3FB 1YPZE 3VRJA 4RGOL 5E99H 4JHZA 3PQYA 1YMMB 4S10A 5GZOD 5FYJL 2PCPB 4FG6D 2DBLL 2X89D 4TSCH 1FV1B 1FYTD 5TE6L 4MXQC 4KJQD 1AGBA 2WLZA 3ZKMD 5HVHC 3FN3A 4Z7VE 5D1XB 2NR6D 3DETD 5HGHB 3HUJF 5I1IH 1CLYH 1HI6B 4PJEA 3RWFB 3FB7A 3HMWH 1S7UA 4PJ5E 4M1CD 2BVQB 1T6WA 3RWEB 1XR8A 1EZVY 3VXQA 4FMKA 4PS4L 4JM2F 4XP1H 5KVGL 1P7QA 2NTFB 2Q3ZA 5ANMB 3O6FC 3AREC 3H3BC 5JW5A 1XR9A 3WIFB 5IESH 4KPHL 1UCBH 5IB1B 3VD4A 2BCKA 4JO4H 3BYYA 1XF4B 4K3HA 1AR1C 3EGSA 1UZ6E 3U46A 1CXEA 5ILTH 1I7RB 3CLFL 1H5BA 5MHSE 3EO9H 3QXTA 3KPRB 2Z31A 1YY8B 2R2HA 4PFEA 4PJ8B 3ROOA 3B83A 5GIRA 2GSIA 4JG0L 4HFWB 2Z92B 4YDJA 3W9DB 1KPUB 3JWOH 4YIQB 3VH8B 2DQDH 3ROOB 4O5LH 4OLZL 4NN6C 4XP6H 4ZXBC 4XNMA 3QIUB 4TUKL 3MRBB 4PJXB 2SEBA 3ZE0F 3HS0B 4M1DL 4D94A 3GDBA 1U8NB 3B5TA 4G8FA 4RQQB 4JO1H 3RU8H 4IBLT 5F1SA 3LPFA 4JFFE 1RVFH 4NC1E 3NN8A 5E24E 3VGDA 3P9MB 4RQQA 1T1YA 1ZMYA 5ETUA 5BVPH 5MEQB 1R5IA 1UB6A 3WNMA 4LCYB 5AG9A 2P45B 3WS3A 3BE1L 3LRHA 3X17A 3IAQA 1YC8A 2AXFA 3OKDA 5BZWA 1OTSD 3L5HA 1S7SB 3BPOB 1F4WH 5T3ZE 3BP5A 3HPJB 3HE7C 5ILTL 4XAWH 1YY9D 4UIKH 4M43L 4LBEA 4X8JB 1BLNB 3DX6A 4JY4B 2XKUA 4NRYA 3OKOB 4OF3A 4MQTB 5GGVY 5F6HJ 1T03H 2BVUA 1HZHH 3HPJA 3QIBB 5T1MB 4G80A 4JKKA 4PBXA 4R2GC 2B8OT 4KJYA 1M6OB 3JV6A 4RAVA 1NH6A 4Q2ZB 2ED8A 3Q5TA 3H3PH 3WJLA 2R9HD 3K2UH 3W39A 2AAVA 4I13B 1K5NA 3TPKA 3ABZA 2ENSA 1UGNA 1DSFL 4KZEH 3KNBA 2DL2A 4H5SA 3WFDH 5F7DA 3I2CL 4MAYB 5MEQA 4KQ3H 2FB4L 1XCTB 5DJ6A 2Q8AH 4BH7A 3RJQB 4X80L 4Z18A 3DUUB 5LJYH 5TQ2L 4BA8A 1MVUA 1WQVT 4JFFA 5F7EH 3N85L 1EEYA 5EOCJ 5FK9A 3HG1A 1OWWA 4OM0L 5E99L 1LILA 2JLLA 3VD5A 1N8ZB 2BVTA 4N5UA 3M1BA 5GJSL 1BMGA 4LLYA 4JFOA 4BFIB 5A16A 4WUUE 4GT7A 3PP4H 4DOHB 4ZFGL 2CKBA 4MZ2A 3G6AA 2J7LA 2WNGA 4F7MB 1HYRC 4XCEA 3LOWA 5FDYA 4Z6AT 1JZ5A 2NZ9C 5HYJD 5E6IC 1FNSH 5EU5A 5DUBB 3O4LD 4U0RC 4F7EA 4X0KB 4Q9RL 5IW1B 1OGTA 2MFNA 4XAWL 4OF0A 4NKDA 2W59A 5L6YH 5MI0C 2LAGB 5A3IC 1ZLSL 5BJTB 5TE4L 3MJ9L 4P2RA 4TQEL 4XTRD 3P0VL 1NC2B 3QDJA 1OY3B 1NCDL 2QSTA 4Y0GA 1IAKA 3MV7A 3O41B 1RZ8B 2R4SL 5F88B 4Q6IB 2D7NA 3I6LE 1RZJH 4Q7DA 5C3TA 3BKMH 5C0BB 3VDCA 4MDJA 4CVUA 3ARFC 3TO4A 3BUYA 4F2MB 2LV4A 3QZWB 2PR4H 3CZJA 3V6OA 4ODWB 5IUSA 2DM7A 3MCKA 1Y6NR 3O6LL 3W11C 2VLRD 1VSCA 5K9JL 2DM2A 2NY4C 1G9ML 2VO5A 3FRPA 3MXVH 4X5XA 3RL1A 3BGAA 5JW4M 3U1SH 3DO3A 3H3KA 1U8PB 2X4QB 4PRHD 4NZUH 4Y4KD 4YBLC 4YC2B 2Y25A 4KDTA 1JPTH 3FOLA 4MQXC 2Z31B 3SKUD 2NY2B 3U36B 1QRNB 1KTDB 4QXWA 1D3CA 3RDTB 1MIEH 4S1DD 1E4XI 4WV1B 4XNXH 5DEGB 3CLFH 4HWBH 2CDFB 3OKLA 4MXVF 1A9BA 4HFUH 4O4YL 2XZZA 1N0XH 3LB6C 3QG7L 5C2UB 2AQ3A 5HPMB 4U6VL 4OI8A 1X7QB 4Z8FH 2X41A 2CSPA 1S7TB 5DFWH 5KVFL 5D1QD 5C07B 1HEZA 4HCRL 2ADGA 3OAYK 5J6HA 4JKPL 3GJFB 2R56L 2AJ3A 4OI9A 1XIWD 4M9OA 2IFGA 1NKOA 1DQJA 2CKBL 3ZKND 2Z91B 1U42A 3QZWG 4B41A 3ELAT 3ME0A 4L8CA 4X83A 3LEVH 4XWOC 1EERB 3C5ZC 4MMZC 4R97B 1A7RL 1A21A 1F8TH 3PL6D 4P23D 5JTWA 3ZL4H 4P48A 1JMZA 3ZKQD 5IEHB 3TH2T 4XZUB 1ZTXL 2R0KL 5JXAL 2ZCHH 1LO2L 2XQBL 4CU7A 3BH9A 4H1LH 1BX2A 2ADFH 4NN6B 4JY6B 3AXLA 2OR9L 1MCBA 3EFDH 4RX4A 3BWAA 5HHMD 1R3JB 2AK1L 4ZS6C 2LVEA 1E4KC 1FZOA 2HTLD 3G6JA 4OZFA 4WU7A 5IKCA 3V6OE 3OAUH 1J0YA 5D7SH 1SJEA 2W0PA 3VFVA 1MRFH 1VA9A 3FQTB 1FZOB 1REIA 4NGHH 2VR9A 4UDTA 2CLVA 4GG6E 2ZSWA 1HNFA 4XGZB 4PBVC 5SX5H 2GUOB 4NO0B 4NCC2 1IC7L 2AJVH 4N68A 1MWAH 5GISH 1CD0A 3VRIB 4NQCD 5FA4A 1S9XB 3QUMH 3M8OL 1MCCA 4G9FD 1ONQA 5T1MA 2H2PD 3VXOA 3CC5B 1QSFB 5FYLH 2OTWB 5GSVA 5LCVL 2IQAB 1BD2D 1MLCB 1YY9C 3RGHA 2DYPD 3P2TA 5IW6A 5CJ5A 3FONA 4EVNA 3WKNA 5GGUA 1INDL 2IH3B 3QNXA 1VFMA 2D7PA 3NFPB 4L1HA 4N0YL 2BNQE 1CLZH 4U1JA 5CKGA 4ODTL 1DBJH 2UWEE 5F96L 2LU3A 2NXZB 1UACL 2H8PB 1NAMA 1IQWL 1GPOL 1DBJL 4D8PA 2YD2A 2MQ3A 5F7YC 1XF5A 4I3SL 4N90E 1X6LA 1NJ9B 1S78C 4GBXD 4UV7L 4LVOB 1N3NA 1CD1A 2MCG1 3P40A 2PYEE 1A1MA 3TPUA 5KOVC 3GIVB 5JR1H 3VXRD 5ISZB 1SJHA 1K4DA 2XA8L 1KT2A 4I8DA 3TVMC 4PRPA 1YEFL 3GK8L 3GBML 3BI9X 3GNMH 5C08D 4BUHA 3MRNB 3V4UH 1NMBL 4G6FD 1YEIH 4U1SA 4PB9H 1MF2H 1X5GA 1JPFB 4OTXL 3BISA 3PHOB 5F71A 4ELMF 3RZWA 4FXGB 2XWBA 3ZTNH 5EOCL 1MCHA 1BD2A 4G7VL 3IFPB 4X6CF 4ZAKB 4OCSH 5LWYH 1U8HB 2YK1L 1TITA 4XP4H 2YWYA 4M6AA 3NTCL 3Q6GH 3BPLC 4UT9L 5DK2B 1R3IL 4JKMA 5J1SC 4GXUM 2B2XH 3U0WH 3BX7C 3U36A 1EIBA 5DJYB 1SQ2N 4FFYH 4QXGL 3V5DA 1MI5E 5J8OA 1JI1A 5IBLC 3PGCB 2YMXL 3UJJH 1NGZA 3L5XH 4LNRB 4DKFL 3GMMB 4NWTH 2HJKB 3ARED 2V2XB 4TUJB 5TPWL 3F7RA 4X5XB 2DQCH 2C1PA 5F70A 3ZKSD 4XH2A 4PPTA 3EYFB 2BX5A 1KG0B 4ORGB 5GPRA 3GIZL 1SYSA 5DXWA 3SGKA 1A7RH 3QDHA 2D7TL 1A64A 1QSVA 5CEZH 3L3IA 5C86A 2PCPA 4ETQA 4LSQH 3S36X 5FF6A 1M7DA 3GJEA 4LSPL 4F2MA 2JK5B 1SYSB 25C8L 3QUZD 4ODHH 4D0BA 3OF6D 2AJXL 2V2WA 3C08L 4MWFA 5DA0B 3Q5OA 1I1FA 4OZ4A 2HLAB 2NYYC 2XKSA 1TTFA 2ZKHL 1G9MC 3EOTH 3NMEA 4IOIB 2OI9B 3PG2A 4E41D 4ZTPH 2P49B 3IGAB 2HVJB 2C3VB 3MBEA 3THML 5C3LD 1A7OL 3VFGL 5JA9A 1AFVL 1SEQH 3KYNA 4M4RA 1S9WA 1F2XK 1A8JH 1MWAA 1HOCB 3KYKL 1QG3A 4NZRL 4XXCA 1SY6L 4Z7NE 2F5AL 1BFOB 4I3GA 5T3XD 5C0RL 4PJGF 1BX2B 4PLJD 4YXLH 5I1HH 3PIQB 4KRPC 3BAEH 4JPWH 1JPGB 1MI5A 3E8UL 3D6GA 5SV3A 3HNTH 3S35X 4OCLC 1T0NA 3IDIB 1WBYA 2XTJB 3B9DA 4Y16A 3OZ9H 3QHTC 3KJ4C 1Q0XL 1UB6B 2GJ6B 6FABL 5C09A 5GGQL 2MSPA 2Z35B 1OAXL 1DQJB 5DUMH 3CSPA 2CIIA 4QNPE 3JWNC 5DJ0B 2FIKA 3PQYD 1AE6L 1Q8MA 1ZGLA 3GFUA 1IARB 5I8KH 1EH9A 4OCXL 4G8FB 5GRVK 3KPSA 3MO1B 3BZEB 5DJ2A 1F3DH 3DYPA 2VC2H 4G6JH 3GM8A 1QBLL 3ILPB 3K4DA 5KJRH 1AIFA 5IBUB 1S78D 2EICA 1UYWL 2XY2A 3DI2B 3VXPA 4DGIH 1CT8B 2WAHA 3I9GH 4JY6A 3MBED 3LKOB 3VH8A 3MX0A 5GRUH 3DGGA 4CL7A 4PGDA 3P11L 1FNSL 3GUTA 5C0FA 3FB6B 1I7TB 3VFRB 1JGUL 2P44B 4OFPA 3NA9L 1NDMB 4R4BB 2OP4L 1U3HD 4JY5L 4DAGH 4AEIL 4HC1A 1RD6A 4L8BA 2AK4D 1MCWW 3PWLA 3QQ4B 4RMWA 5HHOD 5C0CA 1KXVC 4R96A 4XRCA 5BZDB 1NMAH 4P9ML 1BVKA 1OCWH 3C8DA 5GHWH 4XT1C 4K8RL 3WFCH 3MRGB 1ZS8A 5JMOC 2XZCH 2AJUH 4HJGB 4QRPA 1S5IH 2P8LA 2MQCA 2X70B 3P77A 4MQ7B 1KJ3H 1DZBA 3QUKA 2FB4H 1UZ8B 3P9WB 3ECBB 4NZRH 5MENE 3QXWA 5KVEL 4HF5L 3VFUA 3QXUA 2NY3C 4M62L 4ZFOB 4HKJB 1VERA 1QSEA 5DS8B 3MNWB 4XC3L 5D8JL 2V9RA 3TCLA 4AEFA 1I9IL 2AJYL 4PJXA 4DUWA 1FSKC 2VLJB 3O2WH 3MLWL 5C07D 1JUFB 5B3JE 1JNHA 4F15C 4M9PA 4YDIL 1F3RB 1FN4A 2EZ0D 3H9YA 2VLME 4LU5L 1FNEA 1CIDA 1KN2L 4RFNB 3KPQA 4I3RL 5M7QA 1YN6A 4JPKH 4TVPL 4X7DC 1SMOA 3IJYA 2YWZA 3EOAA 4YNYA 1FVDA 1T1WB 1AO7D 3E0GA 2JB5H 4Y5YC 3BP7B 4UMGA 1KGCD 1M7DB 3GJEB 1BZ9B 3O3DA 3TO4B 1YEEH 3F7PC 1OAYH 1CS6A 5BXFB 3P73B 1KG0A 4ODVL 2F54A 3T4YB 3WEXB 3BRDA 4TOYH 2EDYA 5TPWH 4OLUH 1RZ8A 1MPAL 1EFQA 2EYSA 4L29B 1MFEL 3MRCA 4WY7L 4FP8L 1FAIL 4DTGL 5HYSB 1P4IL 3FQWB 2DKUA 1YMME 2VXQL 4N8PA 3QPQC 5GRYA 3STLA 4NJAH 1BREA 3MV01 4J1UB 5E2WL 3D2UB 2LU4A 3JTTA 4RA0C 1G7MB 2I9LA 2YZ1A 5C7XL 4XP6L 1HK6A 4JO3H 5B3JF 4OZHE 4POUB 4X0KA 3RVVC 4F15B 2EYSB 5LWYL 4PGBB 5I30H 4PJ5B 3L1OH 1RZIB 1KJ2L 1TETL 4HH9B 3L3JA 3GHBH 1H8NA 2WIMA 4OZIA 4PJ9A 1FRGL 1RUMH 1WWAX 5KG9A 3VRLF 4OT1L 1K4CB 2NX5D 4UT7H 1Q38A 1V7ML 3O3AB 1KACB 2PXYD 1AKJA 2O5ZL 4X7TA 3HE7B 2J8UA 4F57H 4HGKC 4E5XB 5DF0A 4Z76A 3EYFA 1UCTA 5C0EA 5KVDL 4TSBH 5TFSH 1ZVSB 2NY4D 4L5FL 5IFAL 2BOCA 4DVRL 3PGFH 3OXSB 1UA6H 3WYRA 1OP3H 1Y0LA 4RBPK 3UYRL 5CJXA 2ZOLB 4LNVA 4RGNB 3WFZA 3BH8B 2VYRE 3NCJH 2EECA 2X4NB 1OF2B 3T0EA 2A6IA 1Q9LA 2NXYB 4U1IA 3LEYH 4PG9B 3AREB 4RISH 4KVNL 2BDNL 3ILPA 4WFFE 3MRHA 3WJLC 4O58H 5AWNH 3VE0B 2YD6A 4I2XA 2W65A 2D7QA 4FQ1L 3T08A 3OJ2C 3IJSA 2XYCA 3D0VB 8FABA 2GK0A 5F3BB 1TZGH 2WUBH 5ITFB 3VRLE 4H20H 1TPXC 4NIKB 1Q94A 3LQAH 3S4SB 4L8BB 4RRPA 2AKRB 2HYMA 1U8OB 4NHCH 3NPZB 1QVOB 5D5MF 1G7LB 1CGXA 3ARGC 3DXAA 3KPLB 5HVHB 1B3JA 3TA3C 3VDBA 1Z5LA 1UJ3B 4JZOB 2UYLA 4MXWL 1I1AA 4XNQA 2NTFA 4OCWH 5I0DA 2H9GA 5ECJE 1GGIH 5KSBA 3DUUA 2YKLH 3FQUA 4D9RD 4FFYL 4NQEE 1QTYT 4ZO8A 3WIHH 4JO2H 3S3JA 1WZMA 4FTVD 1XGUB 3PWNB 1D5IH 4L3CB 3S37L 3DX7A 1VGEL 3CFCH 4XHJD 4K23H 3OR7A 3RNKA 3QIBA 4M7ZB 2VUYA 3L3GA 1MUJA 3O4OB 4OQTH 3ZTNL 3D0LB 2XQBH 4WDIB 3E6FA 5DQ9B 2BVPA 3MNZA 2I24N 4AIZB 4X4XB 1SBSL 5GSVB 1NGXA 4PGCA 4QHLB 1EBPA 2A83B 2C3HA 1BAFL 1Y6MR 3QWOA 4JE4B 3GK8H 2AEPH 4C83B 3MROA 1E4XL 1T5WA 3IDYC 3SPVB 3VGAC 2BVEA 1I1YB 5C9KA 1AJ7H 1I8LA 3EYQD 4FQHA 5DVKA 4YWGH 1MCDA 4Y1AE 3EJZD 1NUNB 1QSFD 1U8QB 3VD9A 5D70H 4WI8A 5J11B 4RGNC 5FKAA 4HJ0D 4GQ9L 2ZPKH 1XF2B 4BK4A 1YYLL 1KCVL 1T2QH 5JDSB 3V6OC 1CGSL 1E4XH 4U2ZA 4FQHB 4B0MM 3GSUA 4JHAH 4K7PH 3IKCB 1PW3A 4XBPB 4RA3A 1NSNL 2L7JA 1AP2B 1I8MA 3W2DL 5AZ2H 4OCMC 3L3KB 1HINL 3Q2CA 5DT1H 3SDDA 3KXFB 5IBTH 3CH8A 1FCGA 5EPMA 4N0YH 4U6TA 4PRNA 4KTDL 2C1OB 2J88H 3KLAA 4O2EB 3EOAB 3SGKC 3ULUE 4BH8A 3DRQB 4RGOH 3LV3A 4K3DL 4K23L 1RULL 4LLYB 4BFIA 4LIQH 1FZMA 1S9VA 1LO0H 4S1QH 5EWIL 4GUPA 4U1GB 1J10A 1JNHB 4RMQA 3U2SA 3WHXA 4OUUA 1ULVA 1IKNC 2XWTA 1PYWA 3Q6FA 4KRLB 1U8LA 3WJJC 1FPTL 3U7YL 1R0AL 3AROA 3H9SD 2EO1A 4OAWB 2VZVA 5E2UL 3SGDH 5DJ6B 5D7IF 2H45A 4LRIC 3IVKA 3QULB 1CK0L 4AENA 3UDWA 1FBIL 2CGRH 5H2BB 4CN1A 2ADJB 1P9MC 1U8MB 1RFDH 3RWEA 1CTNA 2YSSA 1J87A 3CFDA 1P1ZB 3QULA 1HHKA 3PGDB 5C2BL 4HUMB 1RHHA 2BXYA 4H0IA 4WI5A 2VDNL 5IOPB 5DJDB 5E5RB 4PJFF 3TT1L 4EI6B 2BXZA 5F1NB 1MCPL 4PJFB 5T5FH 1EJOL 2Y9RT 3TJHC 4PP2A 3CCHA 1QLRA 2C4FU 3MLRH 3UPAA 3WMSA 1F58L 3NIGE 2HFEA 1EVTC 3D0VA 5IW1A 2ZWLT 1CXHA 2ZCHL 1TJIL 4ELME 3SDYH 2Y5TA 4YHZH 3WS6A 4YFLI 3CLEL 3QIWC 1QBMH 3BKYH 2R8SH 2E7BA 4LSVH 4LGSB 43CAB 4MX7A 1ERNA 5I71B 4G3YH 3IB4A 4RWYH 1EO8H 3AS0A 2IANB 3T0EE 5CD3A 5F7EL 2A6IB 4BSWB 4PTUB 2YZ8A 4WCYL 5I1GL 5F44A 5IVZB 5IVXA 4MNGA 2XIDA 3DV6A 1QLEH 3T65B 3SGEI 2BOCB 3VG9C 1I7ZB 4ZG1A 3QUYB 2VDLL 1EHXA 4BQ6A 3HC3H 1ZEAL 3X12A 1Q9WA 1U3YA 5IMKA 3MRIA 5E0QA 5C0EB 4KKLD 4FNLL 1YPZA 2GI7A 4LCCB 4CGTA 3UJIL 1ED3A 1WBYB 3JXAA 4PJFE 3ULUD 3V8OA 2D31A 1KYOJ 1FLRL 3LKQB 5CGYC 1MI5B 4AQ1B 3K1DA 4JB9H 1HSAA 2VMFA 1EZVX 1ITBB 1JNLH 3NH7L 1B0GB 4OZIB 4HAGA 1PBYA 2G75B 1JWUB 2FSEB 4MJ6A 3VW3H 4PLJC 3ZT5A 1JE6A 5F97E 5MP6H 2VABB 5ACMA 4OLYL 2P48B 4NYLA 4I4WB 3V7AE 4X9FA 5HHQB 5KTEL 5MEPB 2VWEE 5DYOA 2CQVA 1DLHA 5HYIA 4PJCA 3A6BH 1SEBA 3ARDD 5F3HB 2V7HB 3PL6C 4P23C 4UUJA 4OCWL 5E2JA 4OD1H 2W9DH 3MLYH 4KMTL 1F00I 4JM2C 4NO3B 4MAYD 1OAKH 1A6ZB 4HHAB 4GLRH 2QSCH 3ULUH 3UTQB 3HMXH 4E41A 4Y2DC 1UZ6F 1BZ9A 3T2QA 3EYQC 1T1ZB 4DJMA 5D6CB 4EI5A 4LIQE 4QT5A 2YPLD 1JWUA 4MJ6B 3O3BA 1K6QL 1R24A 4L4TD 4NC1C 3KLAB 2CRYA 3VXMB 2QQLL 2YEZB 2YUVA 5FOBB 1Q0YL 2BMKA 2DQIL 1KJ2B 4UAOB 2P7TB 2IJ0C 3CD4A 5BS0B 3F65A 3VXTA 3ZE1F 5MEOA 2DLFH 4OF7A 3SDCA 4J1UA 4WV1C 4JDZB 3BRFA 3FOMA 2FR4A 1KENL 3OR6A 5HI3C 4LCWE 3GSUB 5F9DC 2N7BA 3MRQA 2KPNA 4JDVB 4LVHC 4S1SH 5EUOA 2R23A 1FZKB 4KPHH 1WZ1L 3N85H 4HXBL 5HDBE 4AY0A 5AWNL 1F13A 1KB5B 4WHCA 2X89A 3C6LD 4OZGE 3L3DA 3V52H 3DYMA 4AG4H 4IS6A 1MCKA 3MUGA 3QH3A 3HHRB 2XQYK 4R4FL 5DQDL 1MCEA 2P8LB 4L3EB 1XIWB 3GMRB 4KZEL 1CFTB 4HKXB 4Z7UA 5HDQL 2P47B 2B4CC 1DANU 4JY5H 1B0WA 4OGYH 4H88L 1H3PH 3ULVD 1GGCL 4NM4L 4NKMA 4LDEB 2EH8L 3WHXB 1K4DB 2EKSB 2W60A 3L1OL 3FCTB 1ZHNA 1ETZA 2FBJL 5I30L 4WFFD 1RUPH 2WM0A 4YJZL 4KRMB 3U7WH 1NLBH 1VACB 4K94C 5BS0E 5C0DB 5KSVA 2P4AB 3O9WD 4R7NA 3CFJB 3QNZB 5CJBA 5I1JL 4U2YA 3CPLB 4P46C 4PV8A 1L0QA 1RZKH 5GRJL 4OCXH 4JPIA 1UG9A 3ULUL 4UIMB 3MGTA 3O2VL 3CU7A 1IVLA 1LMKA 3WE6B 4ODWA 5E03A 1IGCH 4U1LA 2I25N 1J1PH 1YUHA 2MKWA 5JOPE 5DDHA 3S98A 3V5KB 2X70A 3P77B 2BZDA 2RB8A 4FZEH 2VNCA 4H26B 3MLSH 3U7AA 2E9JA 3MV7B 1SVCP 3VFWB 3NIFE 3I02A 3PV7A 3FB5B 3P73A 4A2LA 4GRWF 3RWDA 3NABH 3B2VH 2VLJE 3C09C 3GMPA 3P4NB 4O2CA 3O6ML 2XG5A 5IW3A 2A9ML 1H3WM 5BCAA 3DX9B 3FJTA 3S36L 4HIJB 1A0QH 4I48A 5EUOE 3LSOA 4C4KT 4DGVL 4P9HL 3FO0H 4MHHG 3WN5A 4PRAB 1DBAH 5EZJA 5CEZD 3P3YA 2VZSA 4PRIB 3K8KA 4ZYKB 4NPYB 3O2DH 3F7YB 3MXWH 2ZUQB 4HT1L 3FMGH 4G9DA 4G5ZL 1C5DB 1D6EB 2JCCA 4YO0B 1BGXL 1RIUL 3KXFD 3KJ6L 5B39B 4OM1L 3NCBB 1IM9A 2CRZA 2PW1A 1KB9K 3D39E 5BO1H 1NQBA 2C5DC 3QUYC 5D7LB 4KI5D 4LSUL 5A2IH 4PJGB 2DQTH 1AQKH 1G6RL 4F9PC 1DUYA 1IGJA 2FNBA 2AGJH 3FN0H 1ZT1A 3OPZL 3MACL 3EAKA 2WUCH 1H3TA 3BQUD 3AY4A 3CXDL 3IFOA 3KWWA 3FO0L 4KRPB 1D5BA 3P4NA 3CFBB 1FVCA 4G6KL 1J0HA 4OCRL 5DQJA 5D1ZA 4Z77A 2F74A 4GLRI 4FQXC 4K8RH 3WFCL 3WS6C 5E8OB 1U0QA 2ZUTA 5JIHA 1WBXA 4NC0B 4RAHA 2HJFB 1IAIH 3DVGB 5EBWB 2P5WE 5IWLA 2J3SA 3QEQA 4HZAA 5C0JB 4QXGH 1G0YR 5CINH 2BNUA 1BIIB 1IEAA 1CL7H 5EB9A 2R0ZH 5E2VH 2OMBA 4HPOL 4RFEA 1KLGA 2IGFH 4DGIL 4XMKL 3HZMB 4P5TA 2ICES 1AR1D 4G6ML 1ITCA 2EC8A 4ZSOB 5E8DL 5LGJB 2FJFB 4TULL 3T2PA 5ETUB 4YDLB 5IG7A 5ICYA 3HE6C 1G7QB 1DBMH 1QQDA 1HDMA 4BKLA 1A9EB 2Q7NA 1F6AA 3MPCA 2B1HL 4Y2DB 3P30L 1I8KB 4BYHA 1TZHB 4EDXB 1CD8A 4PB9L 1S9YB 3DBXB 4R3SA 3V4UL 5I16A 1UH2A 4Z7WB 1YDPB 1U8NA 4RFOL 3MJ7B 3PNWB 2Z35A 1IC5L 2DICA 2EO9A 2VN4A 3Q3GB 3TV3H 4U05A 1OAXH 4ZFFA 2JIXB 5I19H 3T0VA 5D72H 2LTQC 5JPNB 1MRDL 1QZ1A 4HKXA 5DHVA 5FIEA 3MJ7A 4M7LL 4TPRH 2I60L 1MCIA 3H9ZA 3W9DA 5FB8A 1QR1B 1HSBA 4G8GB 3QIUD 5ALBH 3GMLB 2RFXA 4YDVA 3LV3B 4KTDH 3LQAC 1TJGL 4WFHE 1LDSA 3DROA 3E8UH 3QDGE 3VXPB 4ZODA 3J8F7 3LKSA 2FRGP 2ZUWA 3ZO0A 5IROC 4Y4KA 1G0XA 1ZA6B 1QSEB 2X10A 4KROB 4XB7A 3FO9B 4UINH 2P24B 5C6WH 3DWTA 3A6CH 1JHLL 2PETA 3UO1L 5CAYB 3LDBB 1CR9L 1A1OB 3VG0L 3W82A 4GKNB 1GGBH 1MHEA 4M5ZH 4WJ5B 4JANB 1MJ7H 3ZHKA 5CZXC 5SWZD 4AEHH 25C8H 3T8XA 4PYGA 1AY1L 1GC1C 3MRNA 5IWLC 3ULSA 4JLRA 4WW1A 3T4YA 1TNMA 3RZCD 3FQNB 4E5XA 2IAMC 1NFIB 1A7QL 3ALWA 4K3JL 5D6CA 2KQNA 4LOUD 4YE4H 1IL1A 1W2KT 2Z4QA 1FNAA 4NKIH 4AMKL 1YEDB 4JHWL 1H0DB 3HG1B 1VEMA 5C0AA 1NFIA 4QXUL 2R15A 3FQRA 2FECI 3QJHA 2OJEB 3LKRA 3QIBD 3VRJB 4X6EA 3QFJA 1FFNA 4UOW0 4NGHL 1JIBA 4U6HA 4JFXA 2YXFA 4D8PB 3FO2A 1XGPA 5FA3A 3TA3B 2H8PA 4OF6A 1GAFH 2UWEF 2PYEB 3V5DB 2K7PA 2NXZC 2HVJA 3QO0B 4OJFH 3W5MA 1Q9OA 3FQWA 4P5KB 3TA3A 2LABA 2WINA 4P5MA 4L29A 3P0YL 1LGVA 5JIPA 3VXUA 2Q86B 2ZSVB 4YDKL 3QCTL 5FUZH 5BV7B 3P4LA 3VA2C 1JHTA 1OB1B 3WN5B 2YC1A 5J9PB 1W0WA 1MHCA 4UBDC 1DN0B 3IDMB 3OX8A 1KYOK 3O11B 1WWCA 1UQSB 5FO7A 3IFOB 1HILA 3KPPB 4H20L 2HAZA 3I02B 1WGOA 3QPQD 4NQCA 1J0JA 1VENA 2J6EL 5HGAB 1FL5A 4PJHF 3C2SA 5C0AD 4MD4A 1A6UL 3KYNB 4AL8H 1WFOA 3M07A 4JEGB 1R5WA 4WI6A 3QB7C 4ZO7A 3WNKA 1CF8L 2ATPA 4U6YB 3F58L 4P59L 4TUOA 2GK2A 3HZKA 1T22B 3PHQA 3HUJB 4UIMA 2IG2L 4KXZI 2HWZH 2WINB 4IM8A 4U1IB 1T7WA 4WGWB 4OZ4B 1G7HB 4CADB 3C6SA 1KIRB 3BH9B 5KSBE 4PJXE 3TA3D 4FQCH 4KK9C 3RY5A 4CVWA 3SDYL 5E7FA 3MXVL 5BV7C 4HFWA 4UB0L 2AABH 3T77B 2X5PA 5FYLL 1FYHB 1RPQA 4FQXB 5EU7C 3DXAE 4LLQB 1KN4L 1N5AB 2XN9E 3NIGF 5IR1B 3QQ4A 3BN9C 2VKXA 3IRZA 4J3WA 5EO1B 3KJ4B 4V1DA 1I8IA 3ZDYE 2GT9B 2VDNH 1L6XA 3IETB 5D1QA 1CZ8L 1WUNT 5C0ND 1DBKH 4GW1A 1RZ7H 3MOBL 4XI5C 5EC1B 5EIIB 4CVZA 4Z7WF 1KV3A 4XMLL 4TVPD 1N64L 4NQEA 3W5NA 1H3XA 2CK2A 3TYFA 3V5HB 1RK1B 4N0CC 4NQDE 5JIKA 3T2NH 3FRPG 1MWAL 4WWKB 4LQFH 2DMBA 2YA0A 2E27L 3S34H 2F54E 3D1MC 4Y4FA 4G6MH 5CUSL 5E7BA 4F7TB 5I66B 5HGHA 1DBML 3MJ9A 4KTEL 4U1JB 4KHTL 1LWRA 3Q5YA 5E2VL 3OR6B 5E08H 1MHHA 3BZ4A 1JP5A 2VR4A 1NAKH 3S37X 4MNGE 1F6FB 4XBGB 4CJ0A 3AB0B 4YHIA 4QXTB 2DQEL 2QHRH 1QHPA 5I1AA 4NDMB 2EIDA 3EYUL 3SJVD 1F97A 2XXCB 4AT6A 1YEEL 3V4VH 4ZDHB 4N9GB 4DUXA 5CINL 2OL3B 2I9TB 4EN3B 1S3KL 3CXDH 2D4FA 5FCUL 2YN3A 4XZUA 5ISZA 1MCRA 5CFHA 4Y5YA 5MERB 3GM0A 4AMKH 4IOSD 1DFBL 2X05A 1C5BH 2GUOA 1J5OL 4LSUH 2FHCA 3F6IA 1XZ0B 2R0WH 4D3CH 4JKPH 4UU9A 5L9DL 3QI9B 5I74B 2QJDA 4OIBA 1U8JB 4NFDA 3PNWA 4JFZH 4X4ME 3KJ6H 5F7NC 1FNEB 2V17L 4OFKA 1G9NC 1G6RH 3QEGH 4WEUD 4NQED 3LN5B 1LO4H 4N8VG 4PJAE 3DUSA 1TXKA 2PO6D 2DWEA 3QO0A 4NT6A 1J1OH 1MIEL 3W0WD 1NKRA 4JGJA 2FJHB 4RDQF 3WUWA 5BO1L 3MGTB 3CAFA 4KJYB 5JHDE 5F93C 3TCLB 5KVEH 4JPIB 4K7PY 3L5WB 3HTLX 3D39A 1PAMA 5D7KD 4UIKL 4NRYB 5DC0A 4GQPH 4ZXBA 4J4PC 3VFUB 1W72B 4F8QA 4QHUB 1NMCB 3HRPA 4WDIA 4V1DE 3LKRB 2DIBA 4KFZC 4G8IB 1TVBA 2MTPA 5GHWL 3LZFH 1BD2E 3RTQC 3BE1H 4HULB 1U36A 3RWDB 4Y16C 3LIZL 5DMGC 3MUHL 4WU5A 4MA3B 3NGBB 5I1CL 1TQBC 5I15L 4G42A 4PV9B 3IDYB 4K3GA 4G7YL 1K8IB 3EJYD 2WV3A 5E2TH 5B38B 2Y07H 2NR6C 4HGMA 2HFFB 3VXRE 5ISZE 2VAJA 4MMXC 3FQXA 3HUJE 4TTDD 2O61A 1J0ZA 4LNRA 5GRUL 5LQBL 5EFIA 1OVZA 5KS9F 3WFBH 3ZKNC 3NAAH 3U79A 3MLSL 1G6RA 1MSPA 4KTEH 4WWKC 3CU1A 3MGOA 1KB9J 4PY8J 5C09D 4LCWA 4Z95L 1PZ5B 3DNKA 3VXSD 1ORSB 4HUUA 2B1HH 4DCQA 5KJRL 1GOHA 3FFCE 3ZKXB 5EU6E 1ZA6A 3BKML 1XF5B 3VWKA 4J4PD 4AIXA 4WUUA 4XB8A 4NN5C 1HXYA 4GAYA 1JWMB 3MODL 1GGYA 5GZOC 2Y1VA 3BSZL 4KJPC 1K2DB 5CP3H 3EZ8A 1JZ8A 1KJVA 4NKDB 1QPXA 3RIFK 2X4QA 2F53D 3R4DA 4HUVB 4QYOA 1H3PL 2ZJSH 3BD4A 3CCHB 2X9WA 1KJVB 5JDJA 5E4EC 1ZLVK 3ESUF 1H8SA 2Y7QB 1K2DA 4PRIA 1OGAD 3BDXA 3QIWA 1NLDL 2Q1EA 4YR6A 2OZ4A 1JF1B 1FO0A 2JJVA 3GHEL 3PUCA 5DQJB 1T89A 2HJLA 1NAML 1WBZA 3O11A 4OD2B 4PS4H 3P9MA 3ZE0E 2F5BH 1UWXH 3MGOB 5C0CD 5H2BA 1PSKL 1RU9H 5IQ7L 4BSWA 2A0LC 5KS9E 1VKXA 3H42H 5T33L 2AGJL 3DX8B 5EC2A 3FB7B 4WI7A 2VB5A 1RJLA 3EYOA 4LVNB 2XFXB 4L5FH 4OZHF 5DHXB 1FGVH 4W4NA 1MFCH 1W72H 1Q0YH 3G5VB 4NBZB 1FV1A 1UKQA 1FORH 2B0SL 4NUJA 4ODXB 2JCCB 3VWKD 1RZFH 2XPGA 4GG8B 4GRWE 3F7YA 5FOBA 4GW4A 5GIRB 3E6HA 1H9VA 2WLYA 4UI2A 4ZYKA 2RR3A 2VH5L 3NZHL 4ODHL 1N4XH 3BWAB 4LLAA 5DD0L 4JREC 2UUDH 4LK4A 4M1GH 4QKXB 3OJDA 4EI5C 4CU8A 5D1ZB 4DZ8B 5ID0B 4UV4H 5E6IB 3SCMD 3HI5L 2H41A 1QD0A 5KZCB 4YHYC 2WWMC 2DLEA 4LMQE 4PREB 4FQQA 4DQOH 4XI5D 3UBXB 1S7VA 3MCLL 2V6HA 3C5ZD 4PRID 4A2MA 3P0GB 4IOFD 4XAKD 2GJJA 3MLPA 4N5EC 4JM2A 5F89B 5IMKB 4BH7B 3RVTC 3UJJL 4V2CB 5EC2B 4C56A 1CTOA 3MV8A 1GHFL 1LNUA 2Z93A 1NC4A 4M6MH 2X4PA 2JKXA 4OJFL 3VFVB 2EYTA 2F54D 1G9NL 4WUKL 5CZVH 4OD1L 3SHSA 5JORB 2P5EE 3SE4C 1RIHH 1J05A 5E2TL 5GSRB 1CDGA 2QBWA 5A2JH 1SJVA 4XP4L 1OAYL 1I75A 4LCCC 2ICWJ 5HI3D 4FRWA 1HKLL 4F3FB 2BC4A 1T7XA 5ITBL 1YEKH 5E9DA 4OZGB 3RY6A 2ADIB 3C5ZB 3CXHJ 1FO0L 2C1OA 4URTB 4UQ2B 1U8KB 3EO9L 3IDUA 3IS1X 5D96C 4QRRB 4YHMH 1JYXA 1MHHB 3S97C 5D9SA 5SWSE 1FZJB 3GMQA 4U1MB 1V7NH 4NCC1 1XF2A 4H88H 1MJJA 5JOEA 2PTTA 1MNUH 1YDPA 2GIYA 3FT2A 4HUXA 1NBVH 1EO8L 2W1NA 2FH6A 3QUKB 5FHAH 1JGEA 2LVCA 4P2RE 4QRQB 4H0GA 2LQRA 4YX2L 2BNQA 2EEAA 3HS0A 2K9UA 4QHMA 4NKOB 1DLFL 1VGKB 4PV8B 2QL1A 1WFNA 1I7UB 2VISB 5KN5A 1FG2B 1U8LB 4H25A 5ALBL 2X42A 3L3GB 4GRMA 5BJTA 1CE1H 2EXWD 3QAZB 3FOMB 4LSVL 4LRNL 2WBJC 4KRNA 2I60H 5DMIH 4GUPB 4WTZA 4IMLA 1MRDH 1MCPH 1E6OH 4L4VA 2YXMA 3CJJA 5D2NA 2EDJA 3WO4C 5E9DD 1UWGL 3O4LE 4H25B 1NBZA 5D1ZC 5I1EH 3VH8G 1A3RH 4Z7VB 3LAFA 4M8QA 1U95B 2J8OA 3TWCH 2E7CA 3M8OH 5F1IB 2EDRA 2RJMA 3DSNA 3PGDA 35C8L 5J13C 3HAEG 4LOUC 3HKFA 4HH8A 1R3KB 4G6FB 4ELMB 3F12A 3FFCA 1E6JH 3GJFK 3TLRA 3TCXA 3SDXA 5D2LF 5EOTB 5FEBA 4Z95H 2FD6H 4LQFL 5FUOL 5HI4C 1MFAL 2NXYC 5EUKB 3HG1D 1OARL 2OSLA 5CSZA 5D6DA 5HGAA 4Y4KC 3ZYOA 2XKNA 5FUOH 1KGCE 3UTZB 1BQHA 2JCCE 4KROD 2APWA 3DV6B 3HAEH 4W6XB 4JJ5A 2MKLC 5BQ7A 4XVJL 3OJVC 4M1CC 1NMCC 1QACA 4XP5H 1ZHBB 3QCUH 5B39A 4EEEA 2J8UE 2MPAH 4XCYA 1OAUL 2DI9A 1OGTB 1TCRB 2OBGA 3L6FA 1OAQH 5SWZB 5E95B 4XPFH 1NFDE 1RUQL 2ICWA 1W0WB 43CAA 1I85C 4X4YA 4JREB 4MSWB 4GG6B 1P7KB 1DLFH 1BFOA 3SDAD 3BAEL 4JPWL 1HXYB 4M5YL 5IHUL 5ALCL 4L8SC 3WO4B 3K8LA 3DX9A 4I77H 4GSDL 4IRJC 2RQ8A 3WL9A 3X11B 4DVBB 2ZZUT 4J6RL 1Q9LB 1V3LA 4LLWA 2X4RB 1CGSH 3WIFA 5D1XC 4LLDA 1QSFE 1EEUA 4LPWA 1UH3A 3BHBB 3NA4A 3THMH 1QA9A 3LEXA 3FQXB 2O61B 2B5IB 1FNGA 5FYKU 4ZTPL 1DL7H 4HLJA 4HCRH 1S7UB 3UPRA 3L5IA 2VLKB 1SMAA 4JFZL 1SEBB 2VDLH 3GJFA 3LEXB 4PJDF 4XNZB 5K9QI 3VWJD 3K8MA 2L4OA 5IVXB 4U1KB 3CH1A 2X6MA 4HWBL 2ESVE 4GW1B 2EE6A 4IRSA 1J5OH 3U0TB 3H9HA 1WTGT 4OD2A 3UXFA 1FO0H 5L7XH 3N1PC 3QXVA 5C92A 4DZ8A 2VABA 3VFNB 5JOFB 3OKYA 4OQTL 3GKWL 1QVOA 2GSGB 4LSQL 2CDGB 1BP3B 4QRTB 5I73C 3VXUD 1IGMH 1P53A 3OHXA 5AYUH 1ZV5A 1P7KA 4APQD 1NUGA 1QRNE 3I3DA 5I1AB 1KEML 3O6KH 3GI8L 2DQCL 1ZE3C 4Y5XC 3IJSB 4K8RD 5JXEA 1FFRA 1MOEA 5J89A 4KKCC 3OAZH 3D2UD 4I2XB 4HIIB 2P24A 1NUDA 1ZK9A 3V6ZB 3TYGL 5I66A 4JG1H 4MZ3A 4OB5H 1MEXL 4NZTH 3QA3A 1OP9A 4K71C 5HHVL 4XVJH 2CXGA 2FHBA 5DJ8B 5A2LH 2HT3D 5C2BH 5I6XB 3I50L 2FZ3B 4PLOB 3BH8A 1T6VN 1UXWB 3RKPA 1UZ8A 3U9PH 4P57B 4LGPB 4ZO6A 2HRPL 2UYLB 5L8LB 4B7LA 1N59B 5DRZB 1NCDH 1RZ7L 3MOBH 2ATKA 1JN6B 2GT9A 4MDIB 2DYPB 3X14A 3ARYA 3G5XA 2JJWA 4LDLB 3TZVB 3BD3A 4RIRA 2ITDB 4L3ED 3T3MF 1WV7T 4JDZA 3FRUB 4R4BA 3MROB 4M6OH 5DD3L 2IANE 5BV7H 1B6UA 3EOBB 4O02L 3M45A 2BSTA 2LTQB 4L4VB 1MAJA 1ZSDA 2VDPL 2XA8H 1CL7I 1F4XL 1FN4B 3VFPB 2MQ0A 3VMNA 3OJDB 1R24B 5HI5D 4S11A 3VGGA 1G7QA 1A6TA 1DQQB 1L7TH 4OCYH 3K3QA 5T33H 2AK4B 5HHOB 1QEWB 3KR3L 4OSUH 4UINL 3SDDB 5M95B 4R4ND 2IG2H 4L1DA 5HHMB 1IT9H 2RGSA 4QO1A 3GBLA 2O5YH 4LASL 4F58H 5C08E 1OPGL 1A6ZA 2A6DA 2E7HA 4Y5VA 3MRGA 4OFYA 3LN4A 2VXSL 2BERA 2FYYB 4S1SL 3FONB 3MJ6A 3WUZA 3HZYB 3K2UL 3FT4A 1KTRL 4UU9B 4RWHA 5IB2B 1TZIB 3TVMB 2FBOJ 4MD0A 4P2CG 5JXEC 1FJ1A 5IJKC 5ACLA 1T2JA 2DQGL 3WXWL 2D2OA 4JJHA 2VJXA 4IRZH 3T3ME 5TDPA 4U6XB 3D3VE 1A3LL 3TGXA 1WEJH 5I2IA 5DJCB 5JW4N 4AIZA 4QF1A 1RI8A 3DHMA 4CDHA 2ICWB 3DPBA 2Z31C 4YHKH 4P5MB 5E6YA 5F1OB 3OG6B 3PHQB 2FJHA 5DO2D 3ARBC 5C70A 3BSZH 4M93C 1KJMA 2NY7L 3QDGD 3HRZA 5LBSL 4DEPB 1W0VA 4PJIA 3PWUB 4ONHB 4Y8DC 2AV1B 5ERWA 2ARJQ 3IXTA 1IEHA 2W0LA 3LDBC 3EDEA 2K3TA 2G5BB 2IQ9H 1N7MH 5ESAA 3AS3A 3MLVH 4QHKI 3MA7A 2VZUA 4I48B 2VLRB 5C08A 1KLFA 2VQTA 1JK8B 4D0DB 3IJHA 1R3KA 4ELMA 4IRJA 1UJ3A 2XTJD 1LO2H 4UDUB 2Y23A 5B38A 3LIZH 4X6CA 3MCLH 2M26A 3DVFA 5J9PA 1HKFA 4LKCA 3EOYG 1TDQA 1WCBB 2CUIA 4KZDL 4X99A 4LU5H 3MCG1 4JVPA 4UAOC 1DE4B 1IEBB 3T0AA 3E6HB 3H0TB 3UTTB 3C60A 4N90D 5ITFA 1ES0B 1S9WB 1K8DA 2VH5H 5J6HB 2CKBH 2YPKB 1S5HB 4XPHL 1F4HA 3GSWA 5BRZE 5L2KE 5F1NA 5IK3A 1KN2H 4U1LB 1FYTA 1CR9H 1D9KB 1MREH 3JZ7A 5IESL 1W72L 4I0KA 5IB1A 3MLXL 1BGXH 1A6VL 1RIUH 3HUJA 3MLWH 3QDGA 2RIKA 4XNXL 1U41A 3O2DL 1U8MA 1J0IA 4IHOA 5GXBB 2B1AL 3H42L 4WHDA 2FIKB 4LSRL 1DCLA 2X44D 1I8IB 1IC4L 1KLUB 3UC0H 2HJLB 4JFHD 1I1CA 2HJFA 2VL5B 4JRYB 4POZC 3QYCA 3UTSD 4TPRL 3S35L 1EGJA 1ZVSA 1WCBA 2UZIL 1NAMH 3QUZA 2M2DA 3S5LB 2R1XA 4G9FB 3TM6A 3ARDC 4HEME 2G5RA 1OCWL 4WHYH 3KDMB 1XAUA 5DJAB 3O81A 3T77A 4D0CA 4HW6A 2WK2A 1FFOB 5CEYB 1MCJA 1T1XB 3VFSB 4HJ0C 5JA8B 1YC7A 5CJOL 1K4CA 2ZJSL 1V7MH 2A38A 1TQCB 1SHMA 2R69H 4D9QE 2AEIT 1NBQA 4NHUA 3KG5A 2Q7YA 1FL3B 3CDCA 4NO2A 1NAKL 1E4WL 1HOCA 2CK0H 1KJ2H 1TETH 3EHBC 3ILQC 4NUGL 4QOKA 1CLCA 4JRXE 4XNYL 5DJ2B 1RFDL 2EEDA 4G8EA 1EHNA 2YA2A 2FATL 3TN0D 1A1NA 4X7SH 3UDWC 1N5YL 2XXMB 5SX4H 5T3ZH 2B20A 6FABH 5E2UH 1YA5A 2ZUSA 4YGAB 4JN1L 5FKAB 1PVHA 2R0ZL 4W70A 4QGTA 4LF3B 4XNYH 4L9LA 3OZ9L 5LQBH 3C87A 2DMKA 5KANI 1DN2A 4GH7B 5E5UB 1HHHA 4Z77B 3CXHK 4NOFA 3D18B 2YBRB 4OLXH 1GGCH 3LKPA 1P5VA 5L2KA 3ZSTA 1KTLB 3QI9D 3H2WA 4X7EC 2FX7L 1IC4H 3ARXA 5BZDA 5J1AB 2JELH 4XVSL 1T0PB 4P46D 1W72A 5I0ZA 3KPOB 1ZVYA 43C9B 5JLZB 2CLVB 2VSDA 4JFED 4BFEA 2IBZX 2F5AH 2OR8A 3MBEC 3GUTB 3MLXH 1ZHKA 1IKFH 1D9KC 1A1OA 1FE8H 4IDLA 1A1NB 1PX4A 5AD0B 3IXAB 1A6UH 2EXYC 3SJVB 4JFDA 4NRXB 3MRJB 2BY0A 4GXUN 2NY1D 1QKZH 1M6OA 1XGRA 4MCYB 1L4IA 3FO9A 3QDMD 4NWUH 2DDQH 4X9HA 3HE6B 3B3IB 4G5ZH 4K7FA 3TBYA 43C9A 3LKSB 4GMSH 1I9IH 2Z31D 4ZUWA 2V17H 2DTSA 4C56D 1F4XH 3BMWA 3O0RH 4JHBA 3T0BA 5BXFA 1LE9A 2VLRE 3BT2H 3IFPA 3BP5B 3QQNA 2GFBB 4JQXC 4XC1L 5KSAC 1Z0NA 2OTUA 3NCYP 5FB8B 1HCVA 3LKPB 2YPVL 5DHVB 3QPXH 3FQNA 1BFVH 1I9RL 3FAXA 5EU3B 5TDNA 4D9LL 1AXSB 2PF6A 4HK3N 5GQBA 5DSCA 3WXVL 1L6ZA 4NWTL 3OWEA 3HNSL 1U9KA 4KZDH 3VXNA 3NCFB 4FXKB 3CFCL 2DTMH 1KPVA 3I50H 2OTUB 3VFOB 4G6AD 5BOZG 2CMRH 3QO1A 2DQEH 1ZT7B 2A6JA 4RAUB 4KK9D 3PWPE 4R90H 4WHTB 4O9HH 2YMXH 3OV6A 2VZ3A 4K3EH 3SKOB 4JVWA 1YMMD 1FFPB 4JFEA 1T20B 4MX7B 4K55A 2PXYC 4P5TD 3WDIA 4RMVA 1UM4H 1ORSA 1FYTB 3AB0C 4JFDD 3AVEA 1NL0L 5EO0B 3K2MC 3QHZH 1UEMA 4BFBD 4G8GE 4Y7MA 3BP6A 3F62A 1JNLL 3NH7H 1QLRB 2DMCA 3WLWD 1DQDL 2C4FT 3V6BR 1DE4A 3RVVD 3RPIB 1YEFH 2YPLB 4E41E 1I9RH 4I1NB 5L7XL 3QUZB 4KC3B 4V2BA 1NMBH 1N2RB 1A4JB 4M7LT 4XXDB 3CFBA 1AI1L 3BKJL 2N4IA 3BT2L 2IC2A 2KUTA 3EO0A 2W91A 1UXSA 4PRDA 2QQNL 4CDGC 4QRRD 5AAWA 1S7TA 4NFBA 1OTUC 2D0HA 1S7XA 1G7HA 2DBJA 2BDNH 5TDOA 2OI9C 2FEDC 4PLKC 1M1SA 4NOBA 1SY6H 2HG5A 3NCJL 5DD6A 4HXAH 3BJ91 2AW2A 4OSUL 2APTA 5E8NA 1UWEL 2DM3A 4H8WH 1DLHB 1OT2A 3A67H 4I3SH 4Y4FC 4JM4H 4TUOB 3EFFB 4P2OB 4OZIF 1I3VA 1BIHA 4F58L 2X4RA 2R2EB 3F58H 4P59H 4APQC 4Z7OF 4DKEL 8CGTA 3CX2A 1TJGH 5DVMA 2J8UF 3TV3L 4N0UE 4PJDB 3CFEB 5CGYD 4OBSA 5LGHH 4YXHL 4MA7H 4HWZB 4ZPVB 1FFQA 3RVXC 2J6EA 1JF6A 4D0BB 4UDUA 3F5WA 4EI5B 2F15A 5TGBA 5HJ3B 2ATKB 3AMKA 3D25B 1FRGH 4KKLC 4LAQH 3SN6N 1PKOA 4FQ2H 5J3HD 1YPZB 3MUZ1 4O02H 1HHHB 2XY1A 3TFKC 5BV7L 5F8QC 4LLVB 5DTFA 2WWMD 5JDSA 4JN1H 4Y4HC 3ARWA 1NEZG 5LAXA 1KUMA 4KVCL 3T0ED 2FD6L 2W9DL 1BJMA 2N1KA 4HIHA 1U91A 4OV6F 5J11C 4TNWF 2OZ4H 1KXQE 1CK0H 3BQUA 5T1DH 4GFTB 4F9PA 3TO4D 3ZE2E 2IGFL 5ELIA 1B4JL 1KB5H 4LP5A 4M3KB 2ZG2A 4P4RA 3OAYH 1KEGH 4LCUB 1DEDA 1MPAH 4GO6B 4Y4FB 3U0WL 1D5MB 4KV5F 4FFWC 1G7IB 2DD8L 2DWDB 3O6KL 1EJ6A 3OB8A 4UNVA 4M7ZC 4LIQL 2R29L 1CGYA 4RBPH 3TYGH 3VW3L 3ARDB 5JMRA 1QFWH 2DF3A 5D5MA 1J18A 4L9DA 1NCBL 4YZFE 4NNYB 1S7QB 2FO4B 5SWSA 3OPZH 3LEVL 4IRSD 4QXUH 4V1DB 3QPXL 2R1XB 4G9FA 4LPXA 2Y6SC 3WFHB 3WS3B 1MY5A 1ROWA 4JLRB 4WW1B 1V8HA 5IB2A 5DR5L 4YE4L 4QHKJ 3T0EC 4WO4A 4ZFZA 3RY4A 3ZL4L 2C3GA 3HZYA 4FNLH 3BP4A 4CJ1A 2DYPA 4H26A 1NEZB 4YAQA 1MCOH 1MFBL 3H9SE 3X3GL 3MOQA 3MUGB 2MJWA 5JR1L 1ODAA 1FQ9C 1FG9C 4QRPE 1N3NB 1J7VR 4NYLB 1T7ZA 2DI8A 1V7NL 1YN7A 1UADC 4LKXB 4JPVL 3DXAB 3KPLA 2FH8A 2GTWA 4F7PA 2D7MA 4FQLH 4OM1H 1OL0A 4B53A 4P9HH 1DL7L 1DUZA 4PRIE 4WHTA 3DROB 3BKYL 1FNLA 1NCWL 4U3XA 2XZCL 3VFPA 1SBSH 2CLRB 2XWBB 3GGWB 3FCTA 4OLVH 4FFZH 4I0CC 5AEAA 3DMMB 4HUVA 4WW2C 3EDJA 2B4CH 5ITBH 1RUQH 2EDDA 4XBEL 1AHWA 5IB3B 1QFWL 3QJFA 1X3DA 5BQ7B 2CDEA 5I2IB 1QFWM 3UAJC 1RIHL 1KCUL 1B0RB 4IRJB 2ZCKL 5ACZA 4PGZA 5CZVL 1JK8A 4D0DA 2WIIA 4LCWB 1WAAE 4X6DA 2YRLA 7FABH 3LQZB 3H8NA 4MA1C 4J12A 4HIXH 5HDBF 5D71H 5CD5D 3OGCA 3FT4B 5EFIB 5F88A 1CICD 3CFKA 4DFIA 4PJAF 3ARQA 1CQKA 3EO1B 4N8VB 1KCSL 4AH2B 3TT3H 1U3HC 2P5ED 3CMOH 4X8XA 4JDVA 5EUOB 3RZCA 3QDJE 4PV9A 4XPGL 4NRXA 1OARH 2YOCA 3O2VH 1HEZB 3GI9L 4PB0L 3SPVA 1EGJL 2C3VA 4OKDA 2DB8A 3AS1A 5I9QB 1AKJB 3SGDI 3DSFH 3OQ3B 4P4KB 1A02N 5B8CC 4LAQL 4S1QL 4JZJA 3NZ8B 5INDB 4MCZB 4OIIL 2XTJE 3MLZH 2F58L 1UM5L 1EAPB 4WTZG 4WEBL 3RA7L 4YXHH 1NDGA 1FIGH 2OR9H 5A16B 4LLMA 4YHPA 5IF0B 2APXA 5DQDH 1IRAY 3CX5J 4NM4H 3I6GA 4AG4L 3H9HB 3HI6L 1UVQB 2X09A 4MA8H 4ODBD 4U33A 5TQ2H 3HZVA 3PDOB 1S7RB 4U7KA 2ADJA 3T0WA 4UTAL 3IS0X 5GS0H 1P9MA 5F7KC 4A6YB 4Y19B 4OF8A 2HN7A 4XCNA 3VXSE 5GS0L 5FAAA 4HXAL 3RKDD 5FYJD 3O3UN 1GZPB 3VG9B 4DVRH 4ISVA 2R56H 4OUUB 3U48A 1NFKA 3CMGA 4RZCA 2IBZY 2G2RA 5JPMB 1BVLB 3DV4B 5ENWB 2Y4SA 4LHJB 3ZDZF 5IJVB 3PQYB 3NIFF 4OCYL 1YEHL 2XZAL 1K6QH 3C9NA 4CUCA 2BSRB 1J0KA 3CSYB 2AJXH 2BOBB 4UNUA 5B39G 4JFHE 3E6FB 5DQ9A 1F3JA 3MR9B 1HWGB 3DSFL 4N1HB 1IM3B 1DBAL 2V7NB 1MLBB 5E6ID 5SX4I 1SYVB 3SCMB 3MSPA 2A1WH 2I07A 1CGTA 2Q76B 3KGRA 2NY2D 3INUL 1VGEH 1QO3A 1OD9A 4QT5B 5E2WH 2XQYG 2Z91A 1I7ZA 3C5JB 3KYMB 4PG9A 2BCKB 1F5WA 2IBBA 3RKDC 4Y19A 5BRZD 1PLGL 4YK4B 3TJEH 3RIAF 3SDDC 2YPLE 4Q6IC 3WNLA 5F89A 4Y88A 5BOPA 4KKAC 4W81A 5EC1A 5EIIA 5KSAD 4BKLB 5DJ8A 5HHVH 1I1AB 3UBXA 5IROA 1Z5LB 2NCMA 1MFDH 1MH5A 1RZJL 2YK1H 3NIDE 1BVKB 4M6ML 3RWFA 5C0CB 3F8UB 2BVPB 2HMID 2J8HA 1BQLH 4J23A 4CBPA 5IQ9A 4PGJA 5I18L 1LP9B 5MP6L 1JTTA 2ENYA 3GGWA 5L0QB 2V7NA 2CIKA 4XPTL 5E8PA 2Y06H 4XC1H 4K9EL 1VEOA 3K1KC 4LHQB 3VGFA 4L3AA 4R2GB 5MI0B 3VFTB 4LBEB 2PUQT 4NFCA 4FQJH 3O45A 2OXHA 3M1BB 4KK8D 4H0HB 2P5EB 3VGAB 3GMRA 3EHBD 3ILQD 4KVNH 4AQOA 4X7CC 3L3KA 5E5MA 3L7EB 4WTWA 2B5IC 2X7LA 4UV7H 3VRIA 1CDIA 1ZEAH 2XZAH 5CS7A 2B0SH 1JYWA 4WFGE 3FT3B 1A6WH 4P2QA 4LPCA 3MA7B 1CLYL 1Z9MA 2JB6A 5L9DH 2X4OA 1IQWH 1GPOH 1BQHB 4HV8B 5C71A 2VN7A 1U8JA 2F5BL 4KJWD 3BP4B 4JKWA 3U0PB 1EHLH 3UEZA 5KW9L 3LKNA 4QTHB 5IFAH 3QDJB 1MFNA 2NW3A 3DVNB 3EJYC 1R5VA 2X4UB 3QUXD 1PEWA 1N6UA 1WJ3A 4ONGL 4U1HB 1UM5H 5BS0A 2FECL 5F6IB 3WJJA 3CLEH 1T89C 2BMKB 3GEWB 5TE6H 1BBJB 1OB1A 5HVWA 5IM7A 1IILE 3DRQA 1DUZB 5EUOF 5A2KH 3P11H 3BGMA 1N6QL 2ESVD 4WEBH 3RA7H 4WI3A 5EPMB 4FQIL 1EXUB 5D2NB 3B3IA 5CKAA 2XN9A 4JZJC 1T1ZA 1RUKH 4MCYA 1B4JH 1KB5L 4IMLB 1S7SA 5DRXA 1FBIH 4HUUB 4DCQB 4HS3B 2WMPA 4GW5B 3CVHL 3STLB 2E27H 1KSRA 4U1NA 5DI8A 5F7WC 1CBVH 2PYEA 4KVCH 5GS2D 4HEPG 2QSCL 4LVEA 2D9QB 4I0PD 2FJGB 2FYYA 2IAND 1VFUA 2BNQB 5CGTA 4H1LA 3U82B 2ZCKH 1TJHL 3QHFH 4JR9H 4WNQA 1E6JL 4G7YH 2XG4A 3JV4A 1H0DA 1BECA 1RVFL 3E2HB 4Z0XA 4HIXL 1U93A 1A9BB 1CDHA 3G9VA 4PG2C 1JI2A 2VDMH 4WV1A 3TNNA 2HRLA 4PJ8C 2EYRB 2J88L 1EAPA 5F6HI 2Y07L 3HNTL 1KCUH 1JRHI 3LZFL 4PGBA 4UTBL 1NCWH 5ICXA 3SQOH 5AYUL 8FABB 1T04B 1SYVA 4I18A 1EV2E 4KKNA 1TMCB 2GKIA 5EO0A 5H35A 5EULV 1C7TA 1F3JB 1YJDC 2IPKA 4AZ8A 5D7LD 4GMTL 1C12A 4Q97A 3EGSB 5J0BA 5AZ2L 5DMKA 2XZQL 4GRLD 4YX2H 1E28B 4NSKB 2OSLB 3MRFB 2O93L 2OM5A 5GRWA 5E1HB 1U8IA 3DRTB 1YYLH 4N0CD 3M17B 5C1MB 1B2WL 3TNMB 1AI1H 5T3XH 4PTUA 1F90L 1RAMA 4J3OC 4HMEA 2BVQA 2AEQL 4ZD3L 5DR5H 2IANA 2DIAA 3QEGL 4YWGL 2AP2A 2HN7B 4XCNB 1G7LA 4Q0XH 4LHUB 4NQCB 4A6YA 1AO7A 1J88A 2CD0A 1MCOL 2GJ6A 1P84J 5JHDA 3D9AL 1NFDF 3LN9A 3BPOC 3GIZH 1OHQA 4YUEL 3BDBA 1IQDB 4OLWL 5T1KB 2VL5A 4JRYA 3OKMA 3LY6A 5EU7E 1TJIH 2DBLH 4TSCL 3BGFB 1B6DA 1TZHA 5FUZL 1B90A 5GGTH 1PKQE 4X7FC 2GSIB 5JQ6H 5K9JH 2ADIA 1ZANL 1L7IL 2IPTL 4PJHE 3ZMRA 3ZZ1A 1NCBH 2EE3A 5GGVL 1ND0B 4RMSA 2ZG3A 1UENA 2EIZA 4L4VD 1AIFB 2XV6B 4NQVA 5E94A 3S37H 2B2XL 1CGWA 3OKEA 1RK1A 3QHFL 1QBLH 5JW5B 2GCYB 1LO3H 3KPSB 4KY1L 4TRPL 2OCFD 3WIHL 5BW7A 3HZMA 2QQKH 3CSBA 1OP5H 4RGNE 4HJGA 3ALPA 1N64H 1XGQB 3HI1B 4GRLA 5JO5A 3IETA 3KPTA 2IH3A 3H7BA 5D1QB 3QUXC 1HH6B 1UKTA 1GJIA 4C56B 5KSBF 1QSZA 3MJ9H 1JF5A 5CJXC 1HN1A 4YFDB 2NX5A 1EEZA 2YPVH 4U0QB 1MF2L 2E9BA 1AD9A 5C0GB 3SDCC 1JPSL 1AKJD 4DQOL 1A7QH 4K3JH 3CC5A 1I3RA 5INCA 5D7JD 4EIGB 3MMEA 5HGBB 4JM2D 4Z5RA 1A7PL 5CZKA 1H15B 4UOJA 5EZLB 1LK3H 2GJ6D 4IRZL 5DD0H 1AC0A 3HLAA 2WUBL 1IGJB 2R2BB 2AI0L 3RGVD 4C57C 4ZUWB 1YN6B 4NQDA 3BWUC 3CFEA 1GVIA 3ARZA 4XTRC 1KN4H 2E9IA 4DW2H 2P1YA 2B39A 5D2NE 1MHEB 3A6CL 2W9LA 5JIIA 3VJ6B 4NQSA 2AABL 1IAOA 1YMHA 4YGVA 5D7IE 1SEQL 5IBTL 1W0VB 1O5DT 2V5TA 1ZHKB 3ULVL 2CLZB 1JUFA 2O5YL 4MNQB 5DHYA 2X40A 3ZE2F 3ROLA 3OKNB 4Y4KB 3WFDL 3U0PA 1C08A 4A6YL 4FXKA 1S9KC 4BQ8A 2GITA 1IGYA 5T5NG 3TBSA 2F8OA 3T09A 1G6RB 1O7SA 4KV5E 3PJSB 5HY9B 1WCQA 1INEL 2X7LB 4Z0BH 4U6XA 3RP1A 1JGLH 4Z5RB 4I0PB 2Q8BH 5AUMB 5KVDH 1A7BA 5INCB 5CEXB 2GFBA 2PNDA 1S8DB 1A7PH 5F1IA 1I9JH 1CXLA 3IDJA 4R26H 2H2SC 4P0DA 4Z7VA 4MA3A 1JV5B 4CW1B 5ESQA 1NDMA 1VEPA 1WITA 5CBEA 4YC2C 2NY0B 2V2XA 4X7SL 1N5YH 5F9WB 5A3ID 1Q72H 5H8DA 4GRLC 2BNRB 3GB7A 5E00B 1RZJC 1GSMA 5KSUA 4G8IA 3MRPA 5AD0A 4FP8H 1WVZA 5D7IB 4APQA 5HYJA 5BMFL 2W92A 1V3KA 4KJQC 3ZKMC 4MJID 1CFSB 4MJIB 1KIPA 2R69L 3IDNB 3RUGF 2YD1A 4MAUH 3C8HA 2DJSA 3RL2A 1N6VA 2PYFB 3AAZA 3B9EA 3D2UA 3QNZA 5D7IA 5HYJB 4ZOCA 4LLUA 2YR3A 4JO1L 1G1YA 5KSUB 2VITA 4Y1AA 3QDJD 1EDQA 1LK2B 4Z7NF 1E4JA 3SE8H 2EKSA 3MRCB 3MV9D 1FL5B 3DHJA 5ESVB 4JPKL 4NQCE 5EZOH 3IF1B 2DKMA 1RMFH 5DD1H 3OAZK 3B9AA 5IHBA 3MACH 5HHPA 4Q9CA 1B88A 2VDKL 1LK2A 4X9IA 4WJ5A 5TH2B 5FDWB 2DAVA 5CIPB 3HCVB 5FYKH 5C08B 5CCKH 4R2GD 5DJYA 2AEQH 1XEDA 4OKVB 3KPSE 3S3SA 4XHQA 4CADA 5D8JH 1RZFL 5I75C 5KBNC 4GAYB 4PJ7F 3VXUB 3KLSA 1FL3A 4NO2B 4S0SD 1N0XL 4XBGA 5CP7B 1KC5L 3O6FA 3WLBA 3GSWB 2G2RB 3DECA 4D9RE 3N9GH 2YPKA 1U2HA 5EU6B 3UTPD 4YO0A 1K8DB 4KAQL 3MRMB 3HMWL 2VLLB 3FO1A 1T04A 4KI1A 3AMLA 1TTGA 2CIIB 3MBXH 1NMAL 3OXSA 4MS8D 3HAEA 3ZHDA 1R3JA 5JW3L 3X3FL 3FO2B 5IVXF 3GBNL 3O8XA 3JBG7 2VXUL 2GEEA 4R7DA 1NEUA 1BM3L 1VPOL 4BUGA 3RVUC 4MA8L 4PTTA 2CUMA 2OXGA 4S2SB 5HGDA 1ZKAA 1BJ1J 1BF2A 4OFYD 4HWEL 5IJKA 3EO0B 5GS3A 5AAMA 1KLUA 4PJHA 2HLFD 5L2KB 1YPZF 1BQHG 3Q1SH 4KK5D 4DAGL 2VQUA 5ID0A 4ONFL 4F7CA 5IHZB 5A43C 3OKKA 1HDMB 5BVJA 2IF7A 1H5BC 5IR1A 2R2CA 3IAPA 4JR9L 5I8CA 4KHXH 2FATH 2QADB 1KBGL 2W38A 1A5FH 5DK0A 4LSSH 1D6VL 3CNKA 4M8VA 1RZKL 3C6SB 5IKCB 3VJ6A 4OZGF 1XGUA 1KLGB 5C7XH 3BZDA 5DK0B 4YHNA 1WZLA 1X5LA 1HNGA 3QXDB 1T4KB 1QEWA 2GAZB 2NY3D 2VXQH 5GGUB 5D71L 2NLJB 4XAKE 1VADB 4HPOH 1Q0XH 5F7FA 2AK1H 2C9AA 1A5FL 1BLNA 4TULH 2HVKB 2FX8H 1RK0B 2E5EA 2X4TB 3MQIA 2CK0L 3TWCL 4XHJC 1QLFA 4YDVB 1CXFA 1PG7W 5E8EA 1HSBB 4UNTA 4XMKH 5CEYA 1ADQA 5JXAH 3O8XD 5CJOH 2NQCA 3VMOA 2QR0A 4XBEH 4X5WB 3GBNH 3SE3A 4CMHB 3LKNB 3QQ9D 4HWEH 2QR0B 4J8RA 4W6YB 3FFDA 1AGDB 5FO9A 4HG4K 4L8DB 5KW9H 4LASH 3QH3B 2VXUH 2FO1A 1HWHB 4GKOA 2XNAA 3X3FH 4HPYH 3O9WB 5E5MB 4LSRH 5EIQA 2WUCL 5A2FA 2ORBH 2OK0H 4P49A <