35C8H

Catalytic antibody 5c8, fab-inhibitor complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQKPEQGLEWIAQIDPANGNTKYDPKFQGKATITADTSSNTAYLHLSSLTSEDSAVYYCAADPPYYGHGDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG 5C8
molecule tags Catalytic antibody
publication title Structural basis for antibody catalysis of a disfavored ring closure reaction.
pubmed doi rcsb
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 35c8H02
1CD1B 2CDEB 3ZE0E 4I77L 2YA0A 3B3IA 1N4XL 1C1EL 1DQLH 1IGIL 1BM3L 1QFOA 2NW3B 1G9MH 3W9DA 5MENE 5EFIA 2JELH 4HQQH 2VXSL 4JGMA 3HNTL 4Y16D 3LS4H 3QPQD 1XFPA 1G7IA 2HT3C 3GSQB 3T0EC 4PGBB 1G9EA 4XNQB 4OF3A 2NXZC 4FQ2H 5KBNC 4GAGL 3ULVH 5IK3A 3MA9H 2APXA 4KTDH 1S7VB 1TVBA 5IFAL 5EU6B 4IOFD 5D6DA 4OF6A 4XNZC 5F3HA 3AREC 3DOSA 2L7JA 2Q76B 2P24B 4TNVF 3WFZA 4HAGA 1PLGH 5EZIH 1VEOA 1H5BA 2YBRB 2WWKO 4O00A 5J9PA 4X9IA 2KH2B 3MLZH 3QDGB 4AEFA 1NCTA 3OPZH 1IMHC 4EN3D 1IL1B 2YUVA 3M17B 2DQCL 3BQUD 2YA1A 4M43H 3QWRD 4R2GC 4TUOA 4OLYH 4XWOC 2QKIA 3CCHA 3SDCA 3ZKXC 1T7XA 4M93C 2YD5A 4OCNC 3F5WA 3HI1A 2OM5A 1G7IB 3BAEL 3GSQA 3N06B 2LQRA 4ZXBC 3S9DB 1XT5A 3ARQA 1HXYB 1IRAY 3QHZL 2DQDL 4R7DB 1JGUH 4LSPH 1GIGH 3RGVD 2X9YA 1LNUA 5H94A 1MCJA 1ZANH 4MNQD 4E41B 4YBHA 5DRZA 2I25N 5TGBB 1FO0H 4MA8H 4LQFL 3DX9A 1E6JH 1SYVB 3SE3C 2BVOB 4TOYL 4YFLF 1NH6A 3IFLH 1NGYB 3BN3B 4HT1L 4AIOA 5CJ5A 1IGCL 1O0VA 2YUZA 1GC1C 4HJJH 5F96H 2CKBL 2Z31C 1OW0A 2UZIL 5HHOB 2E9BA 5ICYA 4YZFF 4Y4FA 1YNLL 2P43B 4GRMA 5I1IL 3DWTA 4OCSH 4OF5A 3B9AA 5GSRB 2EIZA 4BH8A 3WFEH 5C0GB 1HHKB 1AGDB 4IDJL 3AREA 4NP4L 3VE0B 4JPWH 1UB6B 1OTUD 1P4IL 2P5WE 5FCUH 4NFCA 3AC0A 2AK4B 3PJSB 5JW3H 5EZOL 4UDTB 4FQXD 2VUOA 3BEWA 1MJJA 4GRWB 1H0DA 4HPOH 4M5YL 5DF0A 3ARFC 5CEYB 2ICWB 3U0PA 3FQTB 1YQVL 3QXVA 2A6JB 5FUZL 3VW3L 3CFEB 5C0BA 2P42B 1U3JA 4YK4C 4PD4K 4U1GB 3ZDYF 3FT4B 4PPTA 4U1KB 3TBWA 2FEDD 4FQ1H 4OIAA 1FZJA 3B5HA 4XP5L 4QTHA 2X4UB 3NGBB 3FB6A 3VI4F 1XGQB 3FQUB 1C5BL 1Q72H 4R4NC 2FJFA 5IIEA 3PWLA 4MQ7B 3SKOB 1CLZH 1GGBH 4UT6L 5DHVB 3T0DA 5AZEL 1NAMH 4R3SA 1AIFA 3SJVB 4NRZB 4YHNB 3FO9B 1EEQA 3EDKA 1IC5H 3RA7H 4OD1H 3CLEL 2ZWLT 2R29H 3IB4A 2LU4A 3ET9F 4TYUA 5E8NA 3RL1B 1A6AA 3IF1A 2H45A 4PJIE 1NFIB 4NGHL 5BVPH 1C08B 4HKJA 1MWAH 3ARYA 5T3XD 3DRQB 4WWKA 3RVVD 3O4LB 2E7LC 1T7WA 5MHSE 1T5XB 4OF7A 4IOIA 3U36A 3P4NA 1V5JA 2CLZB 3JBG7 4M6MH 3H9HB 3Q3GA 5F7UA 3OKKA 5HPMA 3FO0L 5F7HA 2QADD 2BFVH 3HUJE 5IJKC 5A3IC 2XZCL 1KJ3H 3PP4L 1JZ3A 1TTFA 2W9DL 3DV4A 2MOVA 3E1F1 4OFVA 5MEQB 5JUEH 4BJLA 1ORSB 3QJFB 3VH8A 4DTGL 3UPRB 2V7NB 1R3LB 2V2XA 5JOPE 1MFCL 4JFOB 1F90H 3G04B 2BRRH 4QXUL 5C9JA 1TITA 1U42A 1Z3GH 3DNKA 5DT1L 2CH8A 3MJ9H 4Z7UE 3O2VH 3MGTB 1AE6L 2EDTA 1GAFH 5I30L 3GNMH 5C7XH 4IDLA 4KKCD 4IEFB 5CWSA 4FNLH 3ZYIA 2I5YH 4YJZL 4L3AA 4KDTA 2HN7B 1HWHB 3GMQB 5IB3B 4KRNA 3MRPA 1HXMB 4Y5YB 4GW1A 4NNXB 1QKZL 2VXTL 3UXFA 1VADA 5FKAA 1U8NA 2IBBA 1A5FL 4M7ZB 4N90E 4JR9L 3MRLB 4NQDE 5TE7H 2WLYA 4ZAKB 5GRJH 3V0VB 4HV8A 4L3EE 1B3JA 1HOCB 4LP4A 3IDUA 1QKZH 2DLEA 5DTFA 3VFVB 2HFFB 3FQXA 4G7YH 4R8WH 1AI1L 1IBGH 2OBGA 2DLIA 1A1MB 4HX1A 3EO9L 3N0PB 1MJUH 3GJFK 4S2SB 3TT3H 2NMSA 1FN4A 2D4DA 1NUNB 4FNLL 3O2DH 3ULVD 2AXGA 3KYNA 2BMKB 3GNML 3TPUB 1QTYT 3BP5A 1GAFL 2IFFH 4PB9L 5IT2H 3MJ9L 5E8OB 5FGCE 3S35X 4RIRB 1A6PA 3LKNB 3KLSA 3M17A 4QTHB 2XZAH 5T1KB 3MRKA 4LCIL 2HVKA 4YHNA 3VXMA 1MFCH 4X4YA 4JN1H 5FOBA 3QDGE 5DHVA 3VFTA 4MXQC 1A6ZA 1JPTL 4M1GL 1G7PB 1UWXK 1MREL 4DGIH 3KHQA 4YDJB 1D5BB 2XQYG 1A0QH 3QUXC 1NLBL 4P3CH 4RZCB 2OJEA 4Y5XC 1G7MA 1Q0XL 1WJ3A 1I1FA 1INQA 2UY6A 2N7AA 1AQKH 3CVIL 2EH7H 4YC2B 3I84A 4HK0B 4UZGA 1UQSB 1BFTA 4PBVC 3MRBB 1BBJA 3BH8B 3V9FA 3ZSTA 1I9RL 1GYAA 4G3YL 5HYJB 4I0PB 3LD8B 2N56A 5C0NC 3D85D 1J1PL 2ZZUT 2BZDA 3JVGA 1HQRA 2DTSA 1HHGB 4OD1L 3C5JB 4XP1H 2AAVA 2R0WL 4XC3L 1QFPA 4I18A 1IJ9A 3MV7D 4GG6A 3H3KA 1QVOB 3DSFL 4GRMB 2SEBA 4XNXL 1MCEA 1C5BH 3HCVA 4UMGA 2AJYH 2V5RA 4JRYD 2GUOB 3ULSA 3L5XH 4JKPL 3H0TB 5CINL 5GZOD 2YMXL 1KGCE 3FT2B 1BX2A 1A7OH 5DDHA 1TMCB 4AIXA 2I24N 4HZLB 4WEUD 5LVEA 5C0BD 1RUAL 4TVPD 4UTBH 3NTCL 1N0LA 4YXKL 1NSNL 4LFHG 4FG6D 1PZ5B 2ATKA 4Z7OF 4QLRA 4P5TA 3HC4H 4OZ4B 5KSUB 1NFDA 1SMOA 5I17A 4R0LA 3HAEA 1JNJA 3D6GA 5E5UB 5D5MA 3RVUD 2HJFB 1KCUL 5INDB 1QHOA 3FOMA 1X7QA 2DQEH 1LD9B 3P77A 4JDTL 3SBWC 1F3JB 5D2NB 5D7JC 4H8WC 2V9RA 4JO2L 1ORQB 4I0PC 4O02H 3T08A 3QDGD 4NCC2 3QO0A 4X6DE 1TJIH 5HVHB 1MRFL 2JJSC 2UYLB 1EDQA 4G80A 1RURH 3QIWD 1CFTB 2C3VA 4KZDH 5JQHC 1A7PH 4GS7C 4PGDA 3WUWA 2OK0H 4X7SL 4HSQA 5FK9A 2AQ1A 1JGEB 5CILL 4ZS6C 4HJJL 5DJDA 4F15C 4RFNB 5EUKB 1L0XA 4YAQB 4P23C 2GSIB 3MV7B 3MNVB 2NY5L 4HXAH 2RJMA 4PG2C 4WGWB 1JNLL 2BK8A 4QTIH 5FKPA 2OLDA 1A4KA 4K94H 3CPLB 4LQFH 2VQ1B 4HBQA 2NW3A 2FX8L 3D5OF 1OARH 4TQEH 3D85B 3VMNA 3VI3F 1HWGB 4IRJB 15C8H 4RGND 3MNWA 3T0ED 4MZ2A 2VABB 2VISA 3FRUB 5B39G 2NY2C 4KMTH 1CFSB 1RFDH 3VGAB 2GEEA 2F58L 3T2QA 2PN5A 4F7MB 5FYKE 5C0FB 5GGRY 3D18B 4XTRC 3E0GA 1CIUA 1T1ZB 2Z31A 2QSCL 1BFOB 4LPCA 3ALXA 2FGWH 3SGJC 4YHZL 5AAWA 3L95B 2HA1A 3MO1B 3PDDA 4LASH 1ZMYA 4LDLB 3U7WL 5E2VH 1MI5A 1VFMA 4NSKA 2VDLH 4JFZL 3VD7A 1Q94B 2X4PB 2NY5C 1NCAH 4Y5XB 4KK9D 3PIQA 1CT8B 3GIZH 3FQWA 2N7BA 5HGDA 1VENA 4N9OB 5KANI 3QH3A 3CX5J 5HHQB 4DJMA 5JO5A 4WI3A 4F3FA 1T4KA 5B8CC 2P5WA 4CADA 2I07A 4L8SC 4QO1A 5DDHB 5I66A 6FABL 2QR0A 1JPFB 5B38G 2EO9A 4NQDD 5IW6A 4NO0D 1BLNA 2IJ0C 4HWNA 4UV7H 3WO4B 1G9ML 4P9HL 1SJEB 4Q9RH 3GBNL 4XP4H 2FSEA 2FX7L 3MA7B 2J4WL 4MA7H 1YNTA 4YXHL 3TYGL 1PZ5A 4HCRH 4GG6B 3CD4A 3QA3B 4I77H 4R7NA 3FB5B 3K0WA 4PJ8B 1WUNT 3K4AA 1INEH 3QCVH 5T1LA 4Y5VC 3VGDA 2F19H 5I17B 4MXWL 1AP2B 1F13A 4GAYB 5IESL 3MROA 1AR1D 4G9FE 1T4KB 3FN9A 3IDJB 5TDNB 1QRND 4NQTA 1F4XL 1QEWB 2HTLC 3HZVB 5DMGD 4PRNA 1MHPL 2AEPH 3TCLA 2WWKT 4ODWA 4BUHA 3NFNA 1U8KB 3S4SG 5D6DC 4EI5B 1NAMA 1ZVSA 3BISA 2DM4A 4N1EA 4XC1H 3NIFF 3RY4A 5I75B 5KVFH 5C0IB 4I0PA 4MS8C 4PRHB 1NDMB 3CFJB 4A2MA 2DAVA 3F7YB 4Z8FL 1L9NA 5EO9B 1AXTH 4D94A 1H3XA 4XCYB 3V7MA 3S34H 3QEGL 1EAJA 4HK0A 5HYSG 3C09B 4NO5B 4UOW0 3C6LA 3KXFE 3IS1X 1UYWH 2AQ3A 4Q9QL 4JFFB 4XT1C 2DQTL 4IRJA 3PWJB 4TTDD 1EMTL 1X5JA 2ZUUA 5DMKB 4APQD 4N8VA 4KQ3H 4ODSL 5FGBA 4HIJA 5FDYA 1E0OB 3ZDZE 3OXSB 1D9KA 4KVNL 3C60D 5HYIA 4JFXA 4X7EC 3O8XB 4X80L 2FD6L 3VFMA 2H26B 4MHHG 1BFVH 3WIFB 2AJSH 4QRTB 1DDHA 5I0ZA 1BBDH 1U8MB 5I1JL 5HYSB 5DJZA 2FBJH 1J12A 4LNRA 2C9AA 2DD8H 2PO6A 4ZDHB 1U93B 4JPIA 4BQ6A 2AI0L 2ARJB 1AJ7L 1GGCH 3R1GL 3C9NA 1TETL 2OL3A 1TQBB 4DN3L 2UWEB 3DIFB 4GMTH 4M61B 5FYJL 4BELD 5CJQL 3AS0A 4LMQE 1ES0B 1DFBH 4BSVB 4B41A 1I8LC 3IRZA 5C6TL 2CKNA 1JFQH 2BMKA 4LFHD 4ZUUA 4RGMB 5D1ZA 3BZEB 3ARDC 2CUHA 4K2UL 1AO7B 3I50L 1PG7H 3RDTD 1GHFH 5BRZB 3DBXB 1MFEH 5EU7E 3RAJL 1QLEH 3O0RH 2BVPA 4OQ1A 1JZ4A 4LPUA 1CXFA 4U2ZA 5TE4H 5D2LF 4ZQKA 4JY5H 5SWSA 4HWBA 4LKXA 5DR5H 5GRUL 4CVUA 5GZOC 4OZIF 5H37G 3RY5A 1H0DB 3N1PC 4YBQC 4WFHE 4K8RD 3OR6B 3NCCB 1IEAB 4HBCH 5CSGA 3KPQB 4HKXB 3F58H 3PGFL 1G7JB 3ARFB 1HH9A 1QSEE 1NGXA 1JNNH 4LGPB 4OGXH 4U1SA 1WISA 3VWKC 4O2CA 3FQUA 4P46D 4FQIH 5HYQB 1AKJB 2LABA 4JVPA 1NBQA 3V5DA 4V2BA 2JF1A 3C87A 4MX7B 4ZYKA 4RGNE 3HC3L 2YPKA 5IHUH 5HVHC 4EUPG 4OZGF 4ZXBD 1ZOXA 1BD2A 3V2AR 3QULB 1FC2D 2R2EB 4JEGB 4RBPK 1CGSH 4JRYE 1ZHNB 3DETC 1HCFX 4X5WA 5FYKD 1XGRB 2BX5A 1DLHB 1HSBB 2JIXA 2BSTB 4QHMB 3D9AH 4LGRB 1RIUH 2HT3D 2EDOA 3VWKB 4XCYA 1XZ0A 3BX7C 12E8H 3AM8C 5E9DB 4WWKB 5CS7A 5C0BE 4QOKA 4E41A 3FO2A 1VB9A 1NANH 1J1XL 2ERJB 4MXVF 3SGEI 4EUPB 1MIEH 1WFTA 5FB8B 5C0IA 1FJ1B 4W4OA 2J8UA 3SKMB 5C2BH 1FDLL 4QRRE 4CDGC 4MCYA 1A1NB 4JQVC 4EDWH 3QZWA 1C08A 4A6YA 5FOBB 5ISZD 3Q6FA 2CR3A 2Y36L 5D2LE 2W9EH 4NDMB 4GG6E 4POYA 3WHE1 4FZEH 4CU8A 3NMEA 3DMMC 4OD2A 5K9JL 5E5MA 1YYLL 4MVBD 4AJ0A 4LLVB 5KSBE 3NCYS 4NQEB 1U58A 4HIIB 4ZUWA 5HPMB 3LZFH 5SWQB 3R0NA 1F6AA 1TQCB 1VKXA 3QUML 1FPTH 4KROB 4EUPH 3EKCA 3W9EB 1A7RH 1HDMA 4KAQH 3AREB 5GGTL 1DBJL 3AY4A 3PHQB 2K9UA 2DKSA 1NUDA 4IIQC 1D7FA 2XKUA 3UYRH 4HUXA 2Q7YB 1QBAA 1T03L 4CRPA 5DJZB 4BFGA 1Y6NR 4O5LL 5I6XC 4ZNCD 5EIQA 4NOFA 3B2VL 3TVMD 5DQDL 3CMOH 1MCWW 3KYMB 4UV4H 2VNCA 1WT5C 4PYHA 5SWSE 4D9QE 2VLMD 5IHZA 3TVMA 4FRWA 3QSKB 3G5VA 5ADPL 4KH2A 3QQ9C 4G6JL 4QYOA 1U8NB 4XPTL 1ADQA 1AIFB 3EJYD 2RFXB 5MERB 2PYFB 2Y1VA 5D2LB 1MCCA 1BWMA 3V7AG 5EDXA 2D0FA 3WNPA 1QSEA 4P57B 3BKCH 3MV01 1VFAA 4MJ2A 3O41B 5D7JD 2DQUH 3RZCC 1JGDA 1ZGLB 4Z9KB 3UJTL 1MCPL 1MEXL 3T4AB 2QV2A 4O2CB 2FHBA 2W0LA 1HI6A 1FG9C 3T8XB 2CK2A 1RJYA 1S7UB 1MQKL 3LEXB 1NUGA 4W4NA 5DMKA 4KK5C 5LGKA 5ITBL 1DVFD 1HHIA 1WWBX 3WJJA 4KJPD 2EDHA 2D3VA 1TJHH 4P46C 3LD8C 3O8XA 5JNYB 4XAWH 4U1MB 5IQ7H 1F58H 5EO9A 1AHWC 4WI9A 5C0CB 5LBSH 3NIFE 3ARED 2CIKA 4OZGB 2BSRB 4E9LA 1J5OL 1BD2B 3TT1L 2KDGA 1KJMA 3PL6D 5IG7B 1I8MA 5ANMB 3V0WL 4JJ5B 3SQOH 4RMQA 3JXAA 2J6EA 1T0PB 3PGDA 3UO1H 2A74A 5EUOB 4NM4H 1CYGA 2OL3H 1KT2B 2BVQB 2ICEA 4D0BB 1AGEB 5D5ME 1I9IL 1BVLB 4HH8A 1RUKH 3SGDH 2HLAA 2JKXA 4KHXL 4NN5B 1D6VL 4Y5VB 3ZTJG 4GRLB 1S3KH 2NZ9D 5CD5C 3A6OA 1T5WB 5FHAL 1U93A 1NAKH 4ZS7H 1M7DB 4YZFE 1TTGA 4L4TA 4Z95L 2YWYA 4ZFOA 1T83C 4YHMH 2WP3T 2FB4L 5C0EB 2VZ1A 4Q6IC 3KAAA 4MLIA 3VGFA 4LKXB 5IB2A 3NFSL 1CDIA 3WNMA 3FT4A 4U1KA 3ARFD 1S5IH 4K9EL 3CLFL 5E4IA 2OTPA 2NX5E 1EEYB 5A40E 4LVHC 4I3GA 1Z0NA 1HKLH 1F45A 4ERSH 1U6AL 4AEIL 1FFNB 1TZGL 4JG1L 4HMEA 3T1FA 5F6IB 1IZJA 5DD0L 3IT8D 3IAQA 4JLRB 4Y2DD 2IADA 4OGZA 2ZPKH 5EN2A 5HGAA 4MB5A 1QSED 3VFRB 2D7OA 3LAFA 1ZWIA 3PIQB 2I60L 2ADFL 5SWZD 2IQAA 5F7EL 3I85A 1XEDA 1TIUA 2RR3A 2H32A 4PTUA 1KCRH 1AD0B 5J1AB 1UA6H 1DANT 2CJUH 2G5RA 2NY2B 4L4VA 3NIGF 5IF0A 1GOHA 4HS3B 4M48H 3MJ6A 4JG1H 4TULL 2DQJL 3VRLE 3C08H 3L9RB 2B4CH 3QFDA 5EU4A 4IHOA 1H8NA 5FO7A 5DJDB 2CUMA 4QRPE 4N90D 2DQHH 2ZNWA 3VWJA 3RDTB 4K9EH 3CUPA 1K5NB 1N2RB 3G6JF 3UTQB 4HW6A 3CDCA 1VGKA 3S97C 4JFEE 1MLCA 4DOHE 4FMFA 5J12C 1OD7A 4PJDA 1HYRC 1NGPL 1F4WL 1F8TL 4GBXC 4WI2A 4Z95H 2H1PH 2X9XA 2HG5B 3SDCB 4X6DF 3MNWB 2APWA 2G75A 1U91A 3GBLA 4ONGL 3BMVA 5ISZE 2YN3A 4KKAD 4PJ9C 5JR1L 1ZA3B 1JPSH 3BP6B 4X9HA 4OBSA 4XXCA 1FZMB 3ECBB 4QCIB 3VRJA 3VXRD 1S7TA 3P0GB 3U7YH 1LK2B 2X1WL 4PJXB 3VXPB 3QUMA 2XQBL 4XBPB 4JRXD 2AJZB 4LIQH 4JZNB 1JPGB 5HHME 1T5WA 4PJGE 1M7DA 2ITCB 3KYAA 3H0TA 4PJAA 3WN5C 4JKLA 5AZ2H 3TT1H 1D5XA 3EO1A 4R0LB 1BZ7B 4WTXA 2CDGB 1A1MA 1B6UA 5JIKA 4GRWF 3ULSB 1KC5L 1NFDF 1U0QA 1I7UB 1F6LL 4WUKH 4F57H 5FV2A 4HC1A 2ZOLA 1T1ZA 3KYOA 1VPOL 4Y1AB 3GMRB 4PJ5A 4LPVA 1BQSA 4J4PD 3RU8H 4MD5B 3MLWL 3QUXD 1VFAB 1CLYH 1INDH 2J8OA 1U8QA 4U7KA 4PJ5E 1ORSA 3QJFA 3VH8B 4AEHH 1AGBA 4D9LH 4IRZL 3EGSB 4X8XA 4W68A 1NEZG 3MRMA 2PYFA 3ULUE 5C09A 3MJ8B 5DJ0B 1QBLH 1SY6L 1AR2A 2Q3ZA 4EOWH 4QRQA 4QT5A 3PABB 5DGQA 4MAYA 5FYJD 4NKMB 1RI8A 5L6YL 3CXDL 1OHQA 3ETBF 5KZCD 2YXMA 1G7MB 3V4VL 4XVUC 1F11B 3RNQB 4ELKA 4JHBA 3C6SB 1J8HD 4PG2A 3BDBA 4P5KB 2HT2C 3RVWD 5C08B 5D1XB 3BPLB 4G6JH 3ZHKA 4NKDB 3O2WH 4IOSD 2VLKD 4ALAL 1HI6B 4AK1A 4WV1A 4EUPA 1NCCL 5DQDH 5JDJA 1AR1C 1KJ2H 2I9LB 1A9EA 4NQCA 5HHPA 3KJ6L 2PF6A 4PYGA 2WBWB 3GK8H 3BHBA 4PG9B 3VH8G 4MJID 1T03H 3JTTA 1MAML 4K7FA 2DL2A 4QWWD 2EE2A 4HUVA 4H26A 5IEKB 2OSLB 3NA9H 3VCLB 3JV5A 3WEXA 4NRYB 3O6FD 1JYNA 2PCPA 1MSPA 4HWBL 4MCZB 2VAJA 4RRPA 4OZFA 2GITB 2VABA 5HBBA 3WD5L 3O6FA 1QRNB 1WTGT 4LEXH 4J7RA 2M26A 2H6PB 4ODHH 4LKCA 4O9HL 5FF6B 4HX1B 3VXRE 3K81A 3L3HB 5J3HC 1T5XA 4C55A 3B83A 3U2SA 2CLZA 4DQOL 1DUYA 4XRCA 3O4LA 2H2SD 3EJZC 2VZUA 4W4OC 5HHMD 3RWGB 2YEZB 3VFWB 4HWEH 3GSOA 5JXED 4WU5B 4G9FA 5EWIH 4Z78A 1ZHBB 3O6MH 5FA3A 5JORB 1E6OH 2VLME 5C0JB 4N0FB 4U4BA 4BM7A 5KG9B 1CICD 3THMH 1E27B 3HNVH 3QXAA 5IHZB 4G6KL 1J1XH 1XH3A 3MGOA 4PJAE 3EZJB 5EO1A 4GKSA 3VXMD 1MLBB 1I8KB 3L6FB 3WN5A 1HSAB 3O3AB 5ESQB 2FEEL 3OKNA 3T0EE 4BZ1H 1ADQH 3T3PF 3EFDL 4C56B 1GGIH 1EJ6A 3QUXA 4WWKD 3WFBL 4AENA 1X5IA 4N0UB 3G9VA 3MFFA 5IGXL 4XNUH 4L3CA 4PRIA 5FYJE 2ZNXA 4GW1B 4NO2B 4NNXA 1RUQH 5HD8C 4JGJA 2ZSWA 3UTPE 1PG7W 3GMQA 4WRLA 1QNZH 3MUGB 4JM2D 5I15L 4Y16B 1Q9OA 3AMLA 4LNVA 4JFDA 1IEBA 4DKDC 3N50A 3ALWA 4AIZB 4OGXL 1S7RA 3INUH 4F37K 4E41E 5CGTA 5DZOA 4XCFH 5TDPB 5E56A 5FDWA 4P9HC 1IQDA 1WFUA 2LVEA 5BS0B 3HI1B 3VRIB 4M7ZC 1GZQA 4E42A 3KPQA 4HKXA 4YNYA 5C08E 4HKBA 2IH1A 3WO4C 3DRQA 1TVHA 1R3IL 1KN2H 4U1SB 4CW1B 2QL1A 4U6XA 2Q86B 5E99L 1FH5L 1AY1L 2ZG2A 3MJ8A 1II4E 3BKYL 5E4EB 3LQMA 3LCYA 4UQ3A 3MGAA 3SJVA 4AEEA 1NUFA 1OCWL 1CXIA 4DFIA 3MXVH 4P2OC 4ODVL 4DK6A 1XCQB 3KJ4C 4PJ9D 5FO8A 4P2RD 2APTA 4NO5A 3LOWA 4OLVH 4IOIB 2CPCA 3SN6N 1TCRB 1NFIA 1YN7A 5CP7A 4LCUA 1KACB 3LHPL 3ZKNC 4YHLH 1NQBA 5CJQH 1VERA 3Q0HA 4OFYD 1YQ2A 5GGTA 2MHAB 1LO5B 1E4WH 1MUJB 1UEYA 1KN2L 3QISA 4R96B 3L3IA 4UDUB 4B7LA 2OTWA 3E6HB 1I4FA 4F7TB 1NMCB 2P47B 2MTPA 4M5ZH 3WE6A 4OCXL 4K71C 3UTTA 4JM2C 3PV6A 1DL7H 3RWGA 1FC1A 4PGCB 1B6DA 5AUMB 2Q1EA 2AJXH 3SDAC 4PGEA 2ZJSL 5F7LB 2ZCKL 2FHCA 2OJZL 5INCA 3C2AH 1P7KA 3B8SA 4TNWK 3K2MC 1SHMA 3CMGA 5TJWK 1CDBA 3L3HA 4FA8A 5L9DH 5EOTA 3DURB 3K4DA 5KVEH 2A73B 2XWJA 2B0SL 1UJTA 3ARPA 4OCRL 3T0BA 4QOKB 4LHUA 2E5EA 3MSPA 3S34L 3HZMB 4JFQB 2P44B 1V7ML 4JY6A 3U4EB 1BQUA 2DLHA 5IMOB 1UGNA 1XF4A 4PR5B 5KSAA 1ZEAL 4HPYL 4KRMB 4OLZH 4L9LC 5DK2B 3UTSA 4OCWH 5IJKA 4RQQB 1N6VA 3RX7A 1IE5A 4PBXA 3KPLA 3NGBC 3NCFB 1B90A 2AEPL 2FYYB 4KDTC 1PKQA 3HR6A 4D2NA 3GRWH 2DQGL 3RJQB 1E28A 4QRPB 3PDOB 3LSOB 1KPUA 3OKNB 4PD4J 5ICZB 1WZLA 3MR9A 3TBYA 3OF6A 1SQ2N 4DEPC 5CEZL 2W60A 1RJZB 3OF6D 4WJ5A 3IDNA 3TVMC 2V5MA 2AK1H 5IBTH 4F7PA 1A02N 4CJ0A 2R1XB 4MXWH 4RGOL 3MRNA 3O6ML 4JZJA 4UAOC 5EWIL 4FQLL 1NGXB 4HJ0C 4C83B 1XIWB 2IG2H 3HUJB 3LKSA 3NAAH 3BIKB 3VFGH 2A1WH 3P73A 4FQHA 1JF6A 4DW2H 4WWID 3QO0B 4YHYC 2EO1A 4XPGL 4L8SA 5MI0C 4JRXE 2P5WD 2VXVL 3W0WA 3TNNA 1LK2A 1IFHH 4MJ5B 1BWWA 2KQMA 2NXYC 2QTEA 3P77B 1RZKH 2E27H 4NHUA 2B1AH 4EBQL 3CFBA 3OX8B 4N1HB 5HDBE 4PJBB 5CBAA 1QFWH 4P4KA 1QSVA 4TUOB 5E24E 2H6PA 5HVWA 1RD6A 4M7LL 2CXKA 5DJ8A 2YPVH 1C12A 3GBMH 3CCHB 4WTZG 5C6WH 3K1DA 2F53D 3QFJB 5HHXH 1GGUA 1NCCH 3FB7A 2ZUWA 3S3JA 5JHDA 1PD6A 1BIIA 1X6NA 4R4FH 2C5DC 2F5AL 1FE8H 1MJ8H 3WHE0 5C0AE 1LHZA 3MV9A 1GZPA 5E2VL 4F7MA 3LMJL 3ZSSA 2X89D 3CFKB 2D03H 5JHDE 3SKOA 4OGAC 2FGWL 4Z7WE 1K4DB 1QA9A 3IGAA 5B39B 3UX9B 3ULUD 4JN2B 3PWVB 3D2UA 3QWOA 2X4TB 2A83A 2VLJB 1OTUC 3JUZA 5J6GB 4YGVA 5DUBA 4LRIC 4OUUB 4POZD 4GKOA 4MZ3A 3LPGA 3PP3H 2LAAA 1VGKB 4NQED 4AEHL 2FRGP 2KZWA 1I7ZA 2XOTA 5EUOE 3SDAA 3GBML 3UTPD 4LOUC 3U79A 4OLUL 4MSWB 2P5WB 4CADB 3L3OB 2XPGB 1IGJB 4QTIL 4U1LB 4F57L 1JRHI 4S0SD 1JHKL 5TQ0L 1H15A 4WUUD 5EB9A 1XF4B 1WK0A 4PR5A 4HUUA 1WC7B 3H7BB 5SV3A 3VE0A 5HHOE 4PJXF 3RVWC 4CGTA 4HIEA 3MPCA 2VKXA 1D6EA 2Z9TA 5KAQG 2MQCA 3BPCB 3REWA 4I3RH 2HH0L 4YAQA 5HHOA 4LSQL 4PLOB 2IPKB 3K2UL 5GSVA 4O02L 1ZLUH 2VN7A 2XIDA 4Y4FC 3TGXA 4WHTA 1M6OB 6CGTA 2VE6A 3MOAL 1NGWA 4EI5D 4HGWA 3IFNL 1A22B 4QWWC 1A4KB 3MOBH 2ZUYA 3B9KC 3QUZD 4KKBC 2X4RA 4XP9L 2M8XA 1ORQA 2AK1L 4JZOB 5IBTL 3ARDD 3W2DL 4MDIB 3S37X 3SDDD 1ED3B 2W0FA 2IQAB 2DJ4A 5EUKA 1F00I 1JWMA 5C0ND 3QQ3A 3RTQC 2IANB 5K9QG 3RUGA 1JGEA 1OW0C 1NGPH 2GI7A 4F9PC 5LCVL 4P59H 2DYPB 2V9QA 5EPMA 1NCDL 2EYSA 3GMPA 5I71B 4H0HB 5JW5B 4FXKB 3L5IA 1U8OA 3QQNA 4OT1L 4IRSC 3O6KL 1H3GA 4KROC 1CWVA 3Q5OA 3RWJA 5BV7C 2VSDA 3QXTA 5TPWH 1ZEAH 4YDLC 4FQXC 3L5XL 2IANE 2B4CL 5JHDD 1ZVHA 1T7ZA 2Y7QA 1IAIL 3V6ZA 4PUBH 4TULH 2VLRA 4O2EB 5C0AA 5A2LH 2N1KA 2OTUA 1WEJL 1WCBA 5C07D 1QD0A 5JDSA 4M9OA 4RISL 3HMWH 3Q48A 4M1DL 4K8RH 3TNNB 4P2OD 5EU6E 3V6FB 1EFXB 4PGCA 1UC6A 5IFHH 3SE4A 1S8DA 3D1MC 4LHUD 4KJQD 4KRPD 4NQEE 3WDJA 5F7EH 4WVRA 4WNQB 5IR1B 2EICA 3LKPA 1RZGA 3BXNB 4IMLA 4YO0A 2ILLA 1KFAL 1MCIA 4RWYH 3H8NA 3TIDA 1DL7L 4L29B 3O3DB 5DC0A 4U05A 2VOTA 2R4SL 3C5ZB 4KWUA 3FT3A 2P8LB 2KQNA 3JWOC 3RHWF 2YD2A 2YUWA 1MFDH 3I6KB 4F2MA 5JA9A 4I0PD 2DQFB 3H9SB 3IXTA 5F7NC 4QRPA 3D48R 3KYKL 4OGYL 3QUYD 4P2RB 2R15A 4L8CB 1A0QL 5F9JA 1ONQB 1TQCC 1ZT1A 4NUJA 3BN9C 4ZOEA 1KCVL 1P6AB 3L3OA 3AB0C 5FIEA 1MFBL 3BIBX 4OLVL 3BZDA 3JUYA 2ZCHL 3RTQD 3H42H 1KENH 3MV11 4PRPA 3V8OA 4YXLL 2NNAA 2XZAL 1EFQA 4OUUA 1A3LH 4PRPD 5D7SL 4Y4KC 3DO3A 4WW2A 5DHYA 5IT2L 1C7SA 5EU3A 4PB9H 4MLSA 3QNYA 3C5JA 1RUMH 3WDIA 3P9WB 1OP5K 3WSQL 4YFLI 1EEUA 2W9LA 3D3VA 1I7RA 1LP9B 4LLAA 2A0LC 1FHGA 2BRQA 4PJIB 4U33A 1AI1H 1IBGL 3TFKD 1RAMA 5I16A 3RWFB 1IAKB 5FFLA 4JJHA 3GJEB 3WNNA 2OL3L 1MUJA 3GMMA 4UQ2A 5JIHA 2C1OA 3D69B 2PW1A 4XVSH 1TZHA 5D8JH 1I4FB 2Q7YA 4OV6F 4DWHA 2NX5D 2XYCA 4HG4K 3QXDB 1OP3H 3VMOA 3P0YH 2NQCA 2ZUQB 3OX8A 3CC5B 5JLZB 1GC1L 1FG2B 2MQ3A 1CE1L 4P5TB 3VD5A 1F58L 1HZHL 1I8IA 4XNUL 4XX1G 3CFBB 3FB8A 3G5ZB 1B2WL 1C5CL 1BAFH 3WNOA 2I5YL 3BQUA 1QR1A 5C0AD 4LVNC 4HKJB 5ACZA 1KJ2B 4J23A 1DN0A 1WWCA 1V3MA 3KG5A 1EX0A 1L6XA 1WICA 1MOEA 3SDCD 1J0JA 3WL9A 3VGBA 4ODXA 1JTPA 2K7PA 3QIBC 3GMOB 1MEXH 5EBGA 4OGAD 2AEQH 4K23L 1T20B 5GGUB 2GTWB 1S9KC 3CJJA 3O11A 2DJSA 4LP5A 1IZKA 1ZHBA 3GSXA 4PLKC 5K9OA 3MZGB 4G6FD 4FQJH 2DM2A 5D1QD 1U3YA 4MGXA 1CE6A 1FGNL 4A6YB 5HYSA 2BFVL 3IJHA 5KSVB 2AXHA 1MCDA 3J7HA 2CKBA 1DLHA 3L5WA 1G7QA 2NY6D 5IBLC 1AFVL 3B5TA 2HKFL 1CICC 3T77B 1X5HA 5DSCB 3CMOL 3UPAA 1H3PL 1HQ4A 2CIKB 4KVCL 3HE6B 4XCNB 3LN4A 3QCUL 5LGJA 5BMFL 3P9MB 3OV6A 4F9LC 5D71L 4O9HH 1B0RA 1G84A 5HHOD 1LQSR 5DK3A 4Y4FD 1YMMB 1U8QB 3UAJD 1JWUA 4KAQL 5F3BB 5SV4A 3IDYB 5DMJB 2VLKB 3PL6A 3QUMH 3MRQB 1J18A 5K9OB 4LCWE 1UM5H 3DXAD 4L1HA 5LAXB 3BP4A 1MAMH 4WO4B 1Z2KA 3QCUH 1CLZL 1UJ3B 1LK3L 5JPNA 3CXHK 5I1KL 1IARB 2OS7A 3VXNA 4UUJB 1HSAA 2IAMA 5C07B 3S36X 3RVUC 4FZEL 3VFNA 4ALAH 4AZ8A 1QSFE 2HVKB 4P2OB 5E0QA 3FFDA 1DJSA 1EO5A 3S36L 3MJ9A 1ZS8B 4EDWL 4TUJA 2BNQD 1YPZE 3OGCA 4X6EB 1W72B 1R24A 3HG1B 3VA6A 1SY6A 4QXTA 2YZ8A 3HAEH 4XZUB 3S35H 3BP5B 2FECL 3NFPB 4P49A 1RZFL 5F1IA 4HIHB 1G0YR 2HT4C 5F1NB 4M5YH 4HPOL 4G8GA 1QOKA 2HMIC 1CGVA 2RAMA 2WINA 1U41A 1X44A 1ZA3A 2X4QA 3FZUD 4MQXD 3C8HA 4XRCB 3SDYH 3FO2B 4HD9A 3G9AB 3VFWA 4OZFB 3P4LA 3M45A 1XR8A 4LCCA 4FXKA 1INDL 1YDPA 3M8OL 4QGYA 1YMHA 4XVTL 3E8UL 3U0PB 4G8IA 4BFIA 1C5CH 2X6MA 5H35B 5C0DB 2HRLA 3VI3E 1HZHH 3GM0A 5EU6D 1BQHA 3UTSE 3BZ4A 4MNQE 1UXWA 1TZHB 1A6VL 5CHNB 2ITDB 3SPVB 1RK1A 3P0YL 3QDJD 4WU5A 1BMGA 4CVWA 4EN3C 1K4CA 2HT2D 4BFEA 2R2HA 1XR9B 4XVUD 1FZOB 5DRWB 1K9TA 2Y6SC 4TOYH 5D8JL 4Z7VB 5L0QB 1JF5A 2VLKE 3F58L 3QUYC 4DKEH 5D7JA 3O9WC 5E7FA 4U7MA 5I73C 3HR5A 2IMMA 4RAVA 5DI8A 1G0XA 1OTSD 2PETA 3WV0A 1NGZB 4U0QB 3O3DA 3BW9B 4HIEB 3DX9B 3FQNB 4TNWF 2FECI 1CTNA 1QP1A 4K3HA 2A9NL 3H3PH 4OV5B 1JK8B 2QBWA 4UILH 2J1KA 1KNOA 5TE4L 3I75A 4N0UE 4Z7QE 3KPPA 5F6HI 1MFEL 1F4WH 2F74B 1JUFA 3HNSL 4Z77A 4JFFA 4YXLH 3IAGC 4JFEA 4ISVB 2R2CA 4JY4B 1SEQL 1KENL 3KLHC 4UIKL 3V5KA 5D1XA 2CRYA 3DHJA 5C8JB 2VQTA 1MFBH 3UMTA 3MLRL 3S88L 1I1RA 3CVHA 4YHIA 2P5EA 3HC0A 3VXSA 5JPMA 4GMTL 2XTJC 3WJLA 5MEND 5IVNA 2AJ3A 4Q74A 1KB5L 3QWOB 2X9WA 1AHWB 1H5BC 3H3BC 5HDQH 3KPOB 5J0BA 1OAZH 1U8HA 4JREC 3D39B 2GSIA 1JWSA 1FL6B 4LLUB 4PJFF 5I1JH 2HTLD 3HE6C 1FSKC 2HWZL 3LKQB 1BFVL 4MDJB 5T1LB 2FD6H 1CFTA 2C3VB 4Z7WA 4L4TD 4ZUTA 3RUGE 3VMPA 1RV6X 2BY3A 1N4XH 1T0NA 3ME0A 2YPLE 4G8FB 4MMXC 4K8RL 4N5UA 4Z7QF 2ESVE 3OG4B 1IAMA 5CEXA 3KPMA 1TZGH 5ELIA 1XGYL 1I3RA 4OZHA 4B7IA 4R90H 5TF1H 1IGTA 3QIUB 5AWNL 1LP9E 5GGSA 5DS8B 1Q9LA 3EW3B 3CLFH 1KIQB 1S5IL 3O6KH 3U6RB 4HGWB 4JPKL 4OT1H 3LKQA 3CFDA 3HUJA 1S78C 5EC2A 1AD0A 3BIKA 3DECA 4PB0H 3RWCA 1Z9MA 3ARGD 2Z35B 1I3UA 4PBWD 1SBSH 2XY2A 1CTOA 5SWZA 4RMWA 4ODWB 1U91B 1NAKL 1OAKH 5CCKL 4GSDL 5EC1B 4M1CC 2HJKA 3REVA 4PRBA 1S3KL 1HILA 4QKXB 4JDZB 3EYFA 1D6VH 2IALA 3M07A 4TUKL 3PE9A 4XP9H 3S4SB 3IYLW 3MOBL 4KV5E 1EAPA 3A67H 4P99A 2XG5A 3ISWA 1JGVH 3IGAB 5B39A 4JVUA 4P2RE 3QCVL 1INEL 1C5DA 3GO1L 3K2UH 4NM4L 4X4ZA 5DMIL 3W0WE 4D0CB 2R2BB 4KJYA 5I2IB 3TO4D 1KIQA 2D7NA 2RFXA 4PV9B 1G9NH 3WFDH 1ZLWH 1XF5A 3QI9C 3KVQA 5T5FL 3F6IA 2PO6C 1QRKA 2JTDA 1INQB 4WTWA 5DK2A 1ZHLB 2MQ0A 5I9QB 3QQ9D 4PJHB 4YHOL 1QBMH 4AH2B 1XGPA 1U8LB 1IC4L 1SJEA 4GO6B 2FJGA 5IQ7L 1FFNA 1NCUA 2VAAB 3HZYB 3T1WA 4PJGB 5FYJU 4BUGA 5I9QC 4OLUH 1RJYB 2EECA 4Y4HC 2XWBB 1RZGB 4YO0B 1F3DH 3OKLA 4ZO7A 3WXWH 2IPTH 4MD0A 1MWAA 2BNQE 1J7VR 3NCMA 2AEWA 3ILQD 4QRRD 3D3VE 3U0TB 3VD3A 2NXYD 3MRCB 1X5AA 2OR9H 4WCYL 3UPCA 1MAJA 1OL0A 4WV1C 5JTWA 5E8PB 1W72A 5CGMA 4X5XA 3UJTH 1OWWA 4X7CC 5D1QB 5CLWA 3FJTA 1ZS8A 1HKFA 4NIKB 5IMLB 4KK5D 1AP2A 5B38A 5TH2B 3HAEG 3ZDZF 1G7LB 4JZJB 4QHKI 4NWTH 4WU7B 2VR9A 1U9KA 4UBDD 4M7JL 4DOHB 5GGQL 3WCYA 5JPMB 2R4RH 1CU4H 2FJGB 4I9WE 1T0NB 2QQKL 1HHHA 1RHHA 4XPTH 3BVNB 4XNZB 1RFDL 2YWZA 1RQ5A 4I5BA 2B2XL 2VITA 4HFUH 5IOPA 3BH9B 4UV4L 3DUUB 4MNHA 1MCSA 1OARL 4TQEL 3DPBA 2FX8H 2HFGL 4M7LH 4J2XA 3HPJA 1AH1A 3BKJL 1OAQH 4JHAH 5E8PA 5E94B 4CN4A 1UG9A 5I1CL 4OKVB 1WSST 1JNLH 5KN5A 1AD9B 4EBQH 4OLXH 4H1LB 4OV5A 2WWMC 4PTTA 4K07A 4PY8J 5LGHH 4APQB 4PJHE 3UBXG 4A6YL 1KG0A 4XPGH 1A7QL 4HKBB 4KZDL 3V5DB 2F8OA 1L4IA 1IAOB 3GDBA 3LKRA 3MLTA 2CLVB 1X5KA 5FYLL 1U2HA 3KPLB 1R3LA 3V4PH 3ESVF 5CP3H 3VFPA 4Y2OA 4RGOH 3G04A 3PXHA 1FGVH 3TWCH 2V7NA 3KPPB 4CVZB 4ZMAT 1MIEL 1ZA6A 5CEZH 3BJ91 4J3SA 3T3ME 3NCYP 4YUEH 2EXYD 5AD0B 1KNOB 3T3PE 4POUB 3RKDD 4QY8B 3LQAH 3O45B 3VXQA 1LO2H 1ND0B 4NKIH 3KLHD 5IWLC 4RMVA 1WTLA 5B4MC 2E9IA 1DBBH 1MIMH 3GSRB 3MYJB 4LHQB 4X83A 5EOQH 3RPIB 1PY9A 3SDXB 4HIHA 1R5VB 4D3CL 1A7OL 1MRCH 3BDYH 2V6HA 2PTUA 2VLRE 4Z7WB 1NCWH 3VXRA 4KGJA 5DQJA 2BC4A 5IQ9B 5L88H 4PV8B 5BW7C 4UINL 1HDMB 3Q1SH 1OTTD 1T7YA 3QIWC 3PHQA 2UV3A 4LSTH 3FONB 5J06A 3FO9A 3DSFH 1UCBL 2ENSA 1ERNA 3AGVA 4OUOA 2R0WH 3U9UA 1T6WA 1W2KT 3OR6A 1TJGL 1JNNL 5D7IF 3LB6C 4WDIB 1I85A 2VKWA 3RTQB 1QLFA 3RNKA 2NY7H 4ORGA 5I73B 1J8KA 3PHOB 2ESVD 3I9GH 4G3YH 3ELAT 4YDVA 2QEJA 5AAMA 5L2KA 5L0QC 2PW2B 1SBBA 4QHMA 1TNNA 2ATKB 5HGGS 4PJCF 4UNUA 2CRMA 5J13B 2DM3A 4HWZA 1E4WL 5KSAC 3BIAX 1EXUA 1N59A 5IEKA 3B2UC 4DGIL 1AXIB 1ZHNA 1RULL 1YN6B 4MAYD 3QT2A 4RZCA 1ETZA 3LQAC 2YHGA 3QZWB 4QHNA 4CUCA 1E4XH 3SDDC 5D9SA 3L3DB 5A16A 4I2XA 3PWUA 1MCFA 4DEPB 5FM5O 1QLRA 1S7SA 3ARUA 5C0CD 4LCUB 5DJ6B 1PQZA 5ESQA 2DD8L 1OLZA 3WL9B 3O2DL 3HZVA 3WLBB 2Z92A 4ZTOH 4Q9CA 4PJCB 3EO9H 3QXAB 1NKRA 5F88B 1H3UA 3ROOB 3OKOA 5JHLH 1X3DA 1SYSA 1CK0L 4XCEA 1CL7I 3INUL 2MHAA 3L5WB 3O6FC 4ODSH 3OJVC 3M1BB 4WW1B 3J8F7 4GXUM 2FIKB 3RDTC 1HOCA 2NY6B 3L6FA 4R7DA 4WUUB 4Q9QH 1QNZL 4GG8B 5E5RB 1W8NA 1QLRB 1S7SB 4NZTL 4OIIL 2VXTH 3MREA 4DZ8B 4XPHL 1KB5B 5IVXE 2VLLA 4OD3H 1UH4A 4XHJD 1Z9SA 1FYTA 5J8OA 4HIXH 3MRHB 4TPRH 3V95A 4H8WL 3U0WH 3OAUH 1LEIB 4HFWA 2E6QA 3ILQC 5D93B 4UU9A 4B0MM 4POZC 4NQVB 5MEPB 1L7IL 4NNYA 2ZKHH 1Q1JH 4Y7MA 3TJHC 3VD4A 4RIRA 2EDEA 5AD0A 1WBXB 4Y4HD 2BNUA 3PWNA 2BC4B 5F1KC 5IQ9A 2VXUL 3MRFB 3SO3B 3B2UD 2NXZD 2NCMA 3G6DH 2B39A 1MHPH 2P24A 2GTZB 4MS8D 4LF3B 3TA3A 1YY9C 5KOVC 3D3VB 3ILPB 3TA3D 4PLNC 5TDPA 1IGYA 5C0BB 5JUEL 2ICWA 4AQ1B 5E9DE 1S7VA 2DI7A 2XZCH 3D0LB 3PP4H 5DQJB 5C70A 2LE9A 1Q8MA 2J5LC 3FO0H 2AJUH 4PJ7E 3N85H 3HG1E 1A64A 4JRYB 1A3RH 1KBGL 3BRDA 1KIPB 4NO0B 4P3WA 4I13B 1MRDL 2XWTB 2F53B 1CG9A 3L7FB 4UQ3B 1FZKB 4U49A 1GOGA 3TYGH 2DDQH 2FX7H 1W0VB 5IMMA 1YECL 4ODHL 3NA4A 4IJ3C 3WD5H 3DV6A 4WHYG 4DGYH 4G42B 4HWBH 4ONHA 1Q9WA 3T2OA 3GSWA 4NM8L 1I8KA 3PWPA 1PZUB 3VDCA 1QPPA 2YK1L 4NSKB 1GGBL 3ALPA 4UT6H 3GK8L 5GGUA 1DBAL 3ARBA 3O11B 1NCAL 2XTJB 4NUGL 1YPZA 4U3CA 2DMCA 3ARGB 3V6OE 4JFZH 3QB7C 5DRZB 4OZFH 4U1IA 1KEGH 1OD9A 2ENYA 3NPSC 5FYKU 4Y2DB 25C8L 4D8PB 4P4KC 2HTKD 1O7SA 3GSUA 1JIBA 3SGKA 1M4KA 5DO2C 1EEZB 3DI2B 3PGCB 3CSPA 3R8BB 3V4VH 3BI9X 3FO1B 2QSCH 5FUZH 1YY8A 5IW3A 2XKNB 4RAUA 2EDQA 3AUVA 4MJ6B 5GJTL 3QDJB 4LSSL 4NPYA 4QCIA 2XACC 1FBIH 5DFWH 3MA7A 3S3SA 3GSRA 4NN7C 1M1SA 4LGSB 5GGRB 2Y7QB 4PJAB 1MHEA 2G75B 3KR3H 4KY1L 1EH9A 1TZIB 1HN1A 1BZ7A 2QR0B 4GAJH 15C8L 4I9WD 1JGLH 4OI9A 3KLAB 4N1CA 3VGGA 3AB0B 4N8PA 5DMYA 2PW1B 3RU8L 2FSEB 3SCMB 2EE6A 5CZXD 3DXAB 5FYKH 3EDJA 4NN6C 3BPOC 2WQRA 1B4JL 4L8BA 3ESUF 3FONA 3RBSA 3NZHH 1DSFL 1BZQK 2W91A 2YD9A 5CSZB 1FORL 1CDUA 4XNMA 1DQQB 1CS6A 3VXTB 3TNMA 3HHRB 5HHVH 5I1GH 2AVGA 3D39E 3FB8B 2WM0A 3HG1D 4OZHF 2OK0L 3VXUE 1RURL 2QHRH 1OGAA 1QRNE 4KK8C 1G6RA 4PLKD 4HJGB 3RIFF 1FO0L 2KL6A 4KXZI 2XQBH 1OSPL 3CDFA 2EIDA 3PABA 3HUJF 3QXUA 3CUPB 1A6UH 3IDYC 4U1LA 5KVGH 1A3QA 4FFYL 1JGLL 3O3EB 5ANMA 4JDTH 3KPSA 3EYQD 3NCBB 4GFTB 5TE6H 1G0DA 3KR3L 4KY1H 3T0EA 1JWMB 2BXYA 5HI5C 3QHZH 3GMLB 1H9VA 4WFEE 4D0DA 3DYOA 3WS6A 1LO3L 4MDIA 4XVJL 5AEAA 3HC4L 1F8TH 1UB5A 2B4CC 4M8QB 4NCC1 1EO8L 5GQBA 2VR4A 4HGMA 4B53A 4HAFA 5B3JE 1P4LA 2P46B 1NMBH 3MRGA 4OFPA 4WV1B 2UY7A 1CD1A 2CDEA 2X09A 2VE6B 3DO7A 1CCZA 3FCTB 4J6RL 5CEXB 4TRPH 4WW2C 4XB7A 1T1YB 3C6SA 4AM0B 1OTTC 3RI5K 1UH3A 3F7VB 1NEZB 3H6JA 4KI1A 2YA2A 4JKPH 3CFDB 5CINH 1NGQL 5EZIL 1D9KD 5DRWA 2IH3A 1G7HA 1IKNA 1JVKA 4ONHB 1DBAH 4I8DA 1K4CB 5ID0A 3MBXL 4EQ3A 1FFRA 4FQQB 5IFAH 5SWZB 2YK1H 5I1EH 3P9LB 1FNLA 1XGUA 3R0MA 1S7TB 3IDXH 3RWCB 4G6FB 4OZHB 3JVGC 4KZEL 4F8QA 1WCBB 2IAMD 4Y8DC 4X0KB 4Y19B 2EDNA 4LLQB 4HQQL 5CAYB 4HFWB 5DJCA 5E6ZA 1P5UA 2BVTA 4GW4B 4JDZA 1ODAA 1DQLL 3EYUH 4PP2B 4N0CD 3AAZB 3MRIB 1MY7A 4Z7NE 3SE3A 4ZUVB 5E1HB 3MUHL 1CICB 5CUSL 3QDMD 4R0LC 4K94C 1KLGB 2VDQH 5T3XE 1AQKL 2CMRL 3CVIH 4UT7L 3ZO0A 3LN5B 5T1LD 4NNPH 1J1OL 5JMRA 3NFPA 1J10A 2O5ZL 3QI9A 4C56D 1EEZA 3PGCA 3BGFB 1F6AB 5IB3A 5KANG 1JPTH 3UBXB 1XIWD 3MRFA 3L5HA 3HC0B 3NACH 4U3HA 5D6CB 1WBXA 3MUJA 4QXGH 1I3VA 4LCIH 5E5MB 1OP5H 2OXGA 5A3ID 1FL6A 1MHCA 2DWDB 2GFBB 4WHTB 4YQXL 2HFTA 4NHUB 4KQ4H 2IFFL 4M8VA 3I02A 2XG4A 2A9ML 3EOTH 4JO1H 1L7IH 3VFVA 4OQTL 1W0YT 4JFPB 4MJIB 1T80A 2JK5A 4KHXH 4MA3B 3U30B 5LG1A 2O5XL 1OVZA 2ATPA 4DCQA 2VDNH 4XB8A 3QJHA 2GJ6B 1OP3K 3VFSA 3PWPD 5BV7L 3MRJB 4WO4D 1CG9B 4JR9H 1FSKB 5GISH 3SKUD 2VXQH 4J1UB 2Q20A 2AABH 1FZKA 3HR5B 3SQOL 3TZVC 1DANU 2JCCB 4XH2A 5CJOL 5FECA 1X4ZA 4PJBF 1J5OH 3QULA 3KPRA 5D93C 2E7BA 5HJ3B 1ACZA 2DLGA 3MODL 3PDOA 5MEOB 3PWPB 3VG0L 1MELA 5DUBB 3KPRE 3QUKB 2Y07H 1D5BA 5DHVH 1TJHL 3W81A 3X11A 2HYMA 2N4IA 4LMQI 4GMSH 3RZWA 1KPRA 1K3ZA 1NJ9A 2EYTA 5KS9B 2Z91B 5FK9B 2ARJQ 5JZ7C 1MQKH 2H41A 3VXSD 3O8XC 4FMKA 1Y0LA 2J8UE 4ZUSB 2MPAH 5J13C 4OAWA 3BKMH 4LEOB 1MCPH 2EIBA 5DD3L 3TPKA 1XF1A 4ZOCA 3AM8A 3CVHB 3QNZA 1EXUB 1HHJA 3TO4C 1RULH 2OXHA 1QFWI 1TCRA 3DMMD 1JHTB 3CK0H 3QDMA 2BVYA 3UDWA 2L7UA 4PS4L 3PL6C 5F9WC 4EN3A 1XF2B 3MCKB 1P7KB 4KK8D 3X12A 1JNHB 1N3NA 2MWCA 4IS6A 4E0RA 4MNGE 1R5WB 3TBSA 2V17L 3WXVH 2IF7A 4LLWA 4L4TB 3DX7A 3WE6B 4MA1C 1CD9B 4HCRA 2NY7L 2AV7A 3QQ4A 4U6HB 4LEOA 1DBJH 5GGTH 2NTFA 3KYMA 4AMKL 1BIHA 3CLEH 1X4XA 1HHKA 1FPTL 3RA7L 3QEUA 4LVHB 5JQ6L 1RUPL 3LZFL 2Q6WA 4LPYA 4ZYKB 3T0XA 2CUIA 2IWGA 3QNYB 4ELMF 4XP6H 1IEBB 3T2NH 4XBEL 3MUZ1 5KJRH 3ULUC 4OCLC 3M1BA 4M6NH 2IQ9L 3O3BA 1UJ3A 4WW1A 4XP5H 3VRIA 3RPIA 3LIZH 2J6EH 2W9EL 1A14H 4WENB 4ZFGH 3BDYL 1PSKH 1CGXA 2YZ1A 2YS4A 3LVEA 3MRRB 3QG7H 4CW1A 1CD8A 1NLDL 3UJJH 1NMCC 1VACB 1AXSA 2R9HD 1FLRL 1XZ0B 4DCQB 4OLWL 2IEPA 3DUUA 4R26H 3LQAL 2O5YH 2OX5A 2A38A 3KPRD 3GB7A 4HUNB 1MQ8A 5GS2D 3VXNB 2O5YL 3BO8A 4JFED 2Y4SA 4YFDB 3EHBC 5TQ2H 3D9AL 3I02B 1NPUA 3SGEH 3UJJL 4YDKH 1FGVL 1RY7B 4OBRA 3VXSE 5FCUL 1CGSL 2PKDA 4ORGB 1PSKL 4ZFGL 1MCBA 5F21B 4YPGA 3WFEL 4OFKA 4KFZC 5EO1B 2YKLH 5CKAA 1PBYA 4LLVA 5EOCJ 2IQ9H 5IHUL 1BQHB 3NCEB 1A6AB 3FB6B 1AGCA 4XPBH 2UZIH 4JO3L 3UZQA 2IGFL 3X3FL 1JF1B 5ACLA 1HH9B 3BESR 4HF5L 2W0PA 3KDMA 4FQIL 1S7XB 1WGOA 2OTWB 3E6HA 3KNBA 5TGBA 3W39A 1D5ZA 4L3EB 3ZKQD 4NO3B 1YDPB 3MV8A 1JMXA 2VDKH 2C4FT 3NZ8B 2HFEA 5I1CH 3QDME 4MA8L 3ARRA 4ZUVA 1RK0B 2R0KL 3RWHA 1ZLSL 3VFMB 3WXVL 1LO4L 3K3QA 3AAZA 3VRLF 4HFUL 4Y16C 3MFGB 2VC2L 1JCKA 4PJCE 5FF6A 1WAAA 2UZXB 1ZLUK 1QLEL 3EZ8A 3ZYJA 4PS4H 2AERT 5CEYA 4PJ5D 3QHTC 3HI5H 3DVGA 4M7JH 3RWFA 2VRAA 2HRPL 3C9NB 1GHFL 4WO4C 3CK0L 4PJCA 4TTDC 2XNAA 4G7VH 4WHDA 4M03A 4DN4L 4A2LA 3ARZA 2OP4H 3O2DA 3TC9A 2C1PB 2X05A 1FYTB 3EYFB 4RMRA 3OKMB 1FO0B 2LVCA 4BA8A 2KUTA 1DFBL 1EZVX 4HKZB 3QIBB 5I8EB 5C9JB 2MPAL 2ARWA 4PRID 3SO5A 3CC5A 2Z4QB 1A8JH 4DN3H 1KIRA 4RMSA 4ZFZB 3WXWL 1E4XI 4DVBA 2FHFA 4P5TC 4LOUD 1OF2B 1IGFL 1U8JA 3IDIA 4JE4B 2GHWB 5IB5B 3ARTA 1BBDL 3KPSE 5E1AB 1QYGL 4XXCC 1PFCA 3ZL4H 4YHOH 3HNTH 1KXQE 4X80H 2JELL 2NR6C 4HHAB 4KUZL 1I9JH 2NY1B 2PW2A 1P7QB 4DUXA 3CIQA 4FXLA 1BM3H 1F11A 1IGIH 3NFNB 4KQ3L 1C1EH 4M3JA 3P4NB 4PJFA 1U8IA 4KV5F 3HZKA 3GSXB 3DLQR 5CIPA 1SM3L 5FCSH 5L7XH 5E8NB 2R0LH 3BT2H 2XN9E 1T04A 1JGVL 3QEGH 3B8YA 4NKMA 2H8PB 5MENA 3FOLB 2P5EE 3HI6L 2BNQA 4PJXA 3S5LG 2VLJE 4LBEB 4OTXH 5IBLD 4RRPG 4C57C 3I6LD 1OPGH 1L7TH 3HA0A 4XC1L 3LH2L 5EBWA 2VLRB 1KLUB 1SBSL 3QH3B 4C56E 5JHDB 4GJTB 3DX6B 1JNHA 5J6HA 1GZPB 2F5BH 5FUOL 3NACL 5ITFA 3WIFA 1UM6H 3BVNA 1F5WA 5C0AB 1R6VA 3U30C 3WFHB 2Q76A 4L9LB 1DBML 2R39A 5K9KA 5IFJA 4F80A 1HHJB 1RJLB 4PJ7A 5EA0L 3IETB 3S5LB 4JG0H 3MACH 4BYHA 5TF1L 3RWIA 1J1OH 3OKDB 4JGUA 4NNPL 1JPGA 1MNUH 3GIVA 1RU9H 2AK4E 2F19L 2UWEE 3G6AA 1JUFB 4J4PC 1RIVL 2UWEA 3DIFA 4M61A 4D0CA 2J4WH 3OXRB 4MA7L 4YXHH 4PRIE 4Y2DA 3KXFD 4F58L 5DD5H 4Y4KB 4Q9RL 2HJKB 5CP3A 5C0CE 3H7LA 3SDAB 5E6IA 3GUTA 1NGWB 3PWPE 5DFVC 3KXFA 3RWDA 1CBVH 3T0AA 4C83A 3JTSB 3TIDB 1R0AL 2BY1A 1EAPB 3UC0L 4GH7B 5DJAA 3TN0B 4GQPH 1D6EB 1BFOA 4YHPB 2CIIA 1AGFB 4NYLB 3ZE2F 1TPXB 4QRQB 5GSVB 4EXKA 1SYVA 5FXCH 4PRPB 2ZG3A 3L95A 3MO1A 4HWUA 4GOSA 3BGMB 3U7AA 1NGQH 3L3GB 2VDLL 5CSZA 5F9JB 1HK6A 3S88H 4Q6IB 2X4OB 5BV7B 2DI9A 3MBEA 4LASL 2OSLA 1IQWH 3UZEA 3VCLA 4XHJC 4X4XB 3SCMD 2BCKA 3TBTA 3OXRA 3TH2T 5TFSL 3SCMA 1KIUA 3CGTA 3EOYG 1NANI 3BRGC 1KIPA 3QRGL 5DQ9A 3IDGA 2E3VA 1ZAGA 4LSUH 2DLFL 3V5HB 1V05A 4NKDA 1DBKH 5GHWL 4JRYA 1RZIB 2P5ED 1HHHB 1RHHB 2DBLH 1TCMA 2EYSB 5I8CB 1YEHL 4XVJH 1LO3H 3TNMB 1RZ8B 5ECJE 1BLNB 1KIRB 2XN9A 1EZVY 2E7MA 3HAEB 2NY0D 4KMTL 1QA9B 4CJ1A 5E08H 1AGFA 3PQYD 2A9NH 3DJ9A 3WUWB 5TDOB 2CDFB 4X99A 4JPVH 4QOKE 1G7PA 1BF2A 2D7TL 2ZUSA 4N9GB 2X70B 5DS8A 4ZXBB 4YHKH 2VWEC 4JLRA 1M05A 4R97B 5DJYB 2YBRA 5JW4N 3MNVA 3OGOE 4KRPB 5GGSB 4DKEL 1FYHB 2QHRL 2OTUB 2X1OA 1TVDA 3ULVF 1MCQA 5LJYH 3K46A 4PGDB 5E9DD 5HHVL 4U1IB 4LBEA 1U8IB 2R8SH 1OB1B 4LSVL 5HXMA 1P1ZB 1ZT4A 1MHEB 5GS0D 4QGTA 1A7PL 1MJ7L 1T04B 2F9BT 3OAYH 1ZHLA 4JKWA 5E2UL 3NZ8A 2PR4H 1RZKC 1M71B 3MJ7A 4XVTH 1JI2A 3M8OH 5DJCB 3EOBA 3HFMH 4LRIA 1FFOA 4HC1H 2DQEL 3NIDF 3D2UD 3SKJL 1IGMH 3FRUA 3UAJC 1M7IB 2HAZA 3L1OH 3VDBA 5IVZA 3PNWA 2G5BA 5KTEL 1KB9J 2Y06L 3E3QE 4MHHI 3UTSD 4Y2DC 3L7EA 1FV1A 5DA4A 4UTBL 4I2XE 2C1PA 2PUQT 3A6CL 1FZOA 2Z0BA 3CSGA 5F6HJ 2PYEA 1IQDB 1V3JA 5FA4B 4NRXB 3AXLA 1CF8L 2ADJB 2NPLX 3NH7H 4IJ3B 3S36H 4XNMB 2Z4QA 25C8H 4JHWL 1KEGL 4ESKA 4Z7WF 2JJSA 1CGUA 3UJIL 5LAXA 2VLKA 3PL6B 4D0DB 5IP4A 4Z7NF 1YEFL 2EDYA 4JM4H 3TEUA 3QIUA 5E1AA 5DD1H 2Y5TB 2FYYA 3ZKMD 3QIUD 4XP1L 5D7KD 2J88L 2WBJD 4DGYL 5JXAL 1J1PH 3F12B 1GSMA 3BRFA 5IMKB 1PJ9A 1DUZB 2GJJA 1EGJA 3BPOB 4YDVB 1HE7A 5JLZA 1H3PH 5DYOA 1VCAA 2YD3A 3AY4C 5I1HL 3VWJC 1F4YH 1T89A 3N85L 3OB0K 2VSCA 4P2YA 1DQML 3AROA 4JQXA 4P4KD 1GPOL 1XCQA 1FGNH 1F97A 2AV1A 4NC2B 1BJ8A 4FQJL 4LRNL 4P2QE 4EXPX 4WEBL 3OL2A 4M1GH 4PGEB 2NR6D 5BO1H 5B3JF 4X6DA 1QVOA 4QNPE 3U46B 5D96B 3O4OB 4K23H 5EO0B 1GL4B 3STZA 2ZG1A 1RIHH 3QFJA 1XGQA 4F7TA 5ESAA 1FNSH 4JAMB 2Q8BH 5DJ8B 5CFHA 1KT2A 3QFJD 3KYNB 2AXGB 1PQZB 1OAXL 4R96A 4UTAL 5K9KB 5IFJB 3HMXA 1OSZA 1TLKA 2ZKHL 3KPRB 1U92B 1NDGA 2EDJA 1D9KB 4LARL 1F3DJ 2YC1A 3OZ9L 1MVUB 4JVWA 5FUCE 5K59E 4HIXL 3CDGB 5ENWA 1UWGH 1YMMD 4G6AD 4KXZH 4NRYA 3MUGA 1J0IA 3HS0B 4W70A 1T0MB 1U95A 5BJTB 1CLCA 4IOFC 3TLRA 4XCNA 3H9SD 1WZ1H 2Z91A 3HE6D 3P9MA 5DJ6A 5TE7L 4ORZC 1RMFH 4X5WB 3N1QC 2V9TA 1A5FH 3HE6A 3MMEA 4E5XB 2ADGB 4AL8L 4P0DA 3IRPX 4PV8A 4AY0A 3C8KA 2NW2A 5D2NC 1AKJD 4WUUA 1GVIA 4NT6B 2YUXA 5T3ZH 1KLFA 3O81A 2FX9L 1JGDB 4IRJC 1PDKA 4OZGE 2XZZA 3CH1A 3DYMA 3UPRA 4ISVA 3OZ9H 1L0QA 4PJEB 2ZCLL 1A9BA 1MI5E 1ITBB 3IJYA 5DUMH 1FL5A 1AE6H 3O2VL 1P69B 1T0MA 4QHLA 2DOCA 2Q8BL 1NL0H 4GAYA 5E94A 1SJHB 1RIHL 2BRRL 4QXUH 5FHBL 4MA3A 4M9PA 4YIQB 3W0WD 2M2DA 1YJDH 1A6WH 2OMNA 4P2RA 1V7NH 3RNKB 3GMRA 4PJ5B 4HV8B 2X44D 1D9KC 3F7YA 3ILPA 2WINB 2C3XA 2W9DH 4RGNC 3P0VH 5F1NA 3L3DA 5IMKA 4PJFE 5A16B 3KYKH 4OGYH 1IAOA 4NRZA 4P2QD 2CRZA 3U4BH 3GMNA 2QHLA 4ZO9A 3QO1B 2UUDK 3PQYB 4S11A 5I1HH 2IAND 4M6ML 1HCVA 2VQUA 2WW8A 4X0KA 5B3NA 5D96C 4R3SB 5JMOC 2IANA 2EDKA 3B9DA 2R1WB 3FL7A 3RX5A 4G43A 5FUCC 5C07E 1ZE3C 2D31B 3UP1A 1KULA 1JZ7A 3DYPA 4UB0H 3VDAA 4NZDA 4P9ML 3FN0H 3BWAA 4XMKH 4YE4L 1FN4B 4EI6B 1TJGH 3QDMB 5CZXC 2J88H 2OR7A 5TF0A 4KGLA 5GIRA 3QIWA 1KLGA 3B9KD 4KKBD 3PWUB 1C7TA 4NQXA 5GS1C 5LXGL 3HMWL 1QRNA 1WEJH 5ICYB 1YMME 1UCBH 2HG5A 1YEFH 5IK3B 2JJUA 3BO8B 1EO7A 3C5ZC 3D69A 2DIAA 4LSTL 3W11D 1BOYA 5EIVA 1QG3A 3Q1SL 4QRTA 4HUVB 3S3PA 4NKOA 4JHWH 1DQDL 4BSVA 3ZE2E 3P30H 3KDMB 4PY8I 1MRCL 4LVOC 4GBXD 5KSAD 4F8TA 4FFWD 4F7CB 2X4NA 5EOQL 5IB4B 4XWOD 4P3DB 2W92A 3ZT5A 3VW3H 4HS6B 3CFCL 3ZDYE 4HK3J 3BGMA 1A1OA 1C5DB 2DWEB 2C4XA 1LO2L 2Y06H 3D85A 4JKMA 4HEPG 4F2MB 3MGTA 3U48A 3QHFL 2IH3B 5EZOH 4PRPE 2WP3O 3I6GA 2CK0L 4G5ZL 4KJQC 3AXLB 4KRPC 4APQA 4YDLB 4XCCH 1FP5A 3TWCL 3REVB 3UROR 5HYEA 3FHQA 4RGMC 4HLJA 4JPWL 4NRXA 1IEAA 1RZIA 2PR4L 2NTFB 2P45B 3MOAH 3RNQA 4ELKB 3V52H 1QEWA 4PJHA 1UENA 4OCSL 4ZSOE 1UXSA 5L2JB 5I1IH 4K3JL 4R4BB 3PHSA 5BJTA 3G08B 4OSUH 4EIZC 4KHTL 3TJEH 1DE4A 3F6LA 3UYOD 4L3CB 4PRIB 1JE6A 4DK3A 1M05B 4KROD 4Z7UA 4HT1H 4S1QH 5I76B 4PRHA 4UIMA 1EHLL 4RMUA 5TQ0H 4OLXL 1S9WB 1JHKH 3MLYH 4P5KA 4ZD3H 2FJHB 1QO3B 2VAAA 3HZYA 5I0DA 1BP3B 1BQLL 5LWYH 2JJWA 1OAUL 3RKDC 3N9GH 5HYQA 4P5MA 2I07B 4YHKL 2Z8VC 3U46A 2AEIT 3AU1B 3BUYA 4R9HA 1OAYH 2B2XH 5GRYA 3TO4B 2DQDH 2Z35A 3GMMB 3PDGA 3CSYB 5A43C 2R4RL 2DBLL 5GS3A 4ODUB 4CMMA 2YRLA 4MNHB 4J3TA 4APQC 1T66D 2R1YA 3WIHA 4Z78B 3IU3A 3VGAC 3BH9A 4JZNA 1K6QH 4M43L 4M6OH 4Q0XL 1JHLH 1TENA 3KS0H 4XNQA 1XCTA 2X4SA 5D7LA 3LMJH 1I1YB 3PG2A 2WWMD 2ZSVA 2OR9L 2B20A 5EU6A 2F5AH 5EH1A 3VFOB 1NBZB 1PLGL 2QKIB 5HHXL 2IPTL 3HZKB 1DR9A 2BSSA 1FCGA 4GBXA 4PGZA 3MZTA 2P8MB 2YPVL 3IFOA 5KS9E 1MCWM 1IL1A 5C0FA 3DO7B 2FZ3A 3H9SE 3ZMRA 5ANME 5J56B 4H88H 1IC4H 2CLRA 1BD2E 1CXEA 3L9RA 4WFGD 5GGSY 4HZLA 2CLVA 4OFDA 4ZXBA 1IFHL 2VXSH 4NKOB 2XA8H 5CEZD 2DI8A 4Q9BA 3DARA 2W1NA 5T5FH 5DD5L 2V7HB 1WFOA 2W0KA 1RZ7H 3QUKA 2JIXD 4UNTA 5ID0B 4K3GA 1RIVH 2QSQA 3VFGL 4MD4B 2IG2L 1WFNA 2L4OA 1IVLA 4FQLH 2J8HA 1G6RB 3JZ7A 5KZCB 2AXJA 1UH2A 3EJYC 4Y4KD 3OKMA 4M62L 3KXFB 3RWDB 2KZ1B 3MACL 2P8MA 1MF2H 4Y4KA 3S37H 3RP1A 5IB4A 2EXWC 4U1JB 4HHAA 3KLDA 3QI9B 1QSFA 4GSDH 2ORBL 1OAKL 2UYLA 2DJUA 1M71A 5F97E 5IUSA 1UM6L 1ZKAA 4NJAH 5FUOH 5I1LA 5EZJB 1RZJH 1Y18A 2B1HL 3T09A 2EZ0C 2XTLA 1YNTB 1OF2A 3CAFA 4NJAL 3HLAB 4CL7A 4K3EH 1OGAB 3FOMB 4JY6B 4K9EC 3VG9C 4OTXL 4UNVA 2WAHA 3RY6A 1QO3A 4HPYH 3BSZL 2CDGA 2VZVA 2DRUA 1G7LA 2EE3A 2PNDA 4X4XA 1EA9C 1X5GA 4X6CF 2R69L 3U1SH 5I1DB 3HPLA 1WITA 3TJHD 2R0LL 3BT2L 4X6FA 1YC8A 4Z7UF 1ITCA 1KLUA 4K7PH 2YRZA 4DZBA 3GJFH 3SY0B 5KVEL 4G43B 4NHCL 8FABA 5GGVY 1H5BB 5CIPH 1IAII 2IALB 2BNUB 1FNEB 4P2OA 4CN1A 3C2AL 4N9GA 4JREB 5CJXA 1I9JL 4AM0A 2VZSA 2ZJSH 3HN3A 5EBLA 4KUZH 3WLWC 2FJHA 4H25B 4QHKJ 2RCSL 3BPCA 1HHGA 1L9MA 5J57B 2VDRL 2YD7A 5DLMH 2MCPH 2HWZH 4R6UA 1W8OA 4YHYB 5CBAB 1WIOA 1T1YA 1YEKL 5IG7A 1I8MB 4H5SB 1IKFL 1T1XB 3WDHA 3DUHA 2NY1C 3KPSD 1XF5B 1OAZL 2BDNL 1TZIA 1V8HA 1KJMB 4WIQA 4N5ED 3UTQA 2E8ZA 2GY5A 4WI7A 3DUSB 1KB5H 1OQOA 4W81A 2XNAB 2HVJB 2Z93B 3EAKA 2ZP0T 3JV4B 3LHPH 1KCLA 3RIFK 1D5IH 4EVNB 5DFTA 5SX4H 4MJ4A 2AXFA 3HKFA 4UIKH 4Q0XH 1FL5B 1T1WA 3GHBL 2WUCL 1CN4A 1I1YA 4KI5D 4RAVB 1QPXA 1UZ6F 4U0RB 1MI5B 1JK8A 1G7QB 1Z5LB 3HI5L 3MCLL 4RSVA 3D2UB 5LKNA 3H9ZA 3FQNA 5E99H 1I1AA 4YH6A 1QQDA 4N8CH 2E6PA 1KXVC 2V7HA 1OAYL 2NXZB 3E6FA 1YEGL 5EN2B 3CFKA 5HGAB 3O6LL 4RFOL 4J12A 3QZWG 4JCMA 3RWEB 2HJLA 5KSAB 2CLRB 3ZKXB 3MRBA 1YYML 1O7VA 4FZ8L 1LEIA 4QXTB 3DX7B 2E8YA 2RBLA 2DF3A 5BVJA 2QJDA 5JIIA 2GCYA 2FIRT 3IU4L 2ESVB 2GSGA 3P2TA 3AS1A 3I3DA 2R1WA 4PJBE 4L4TE 3SCMC 3Q6FB 5DWUL 4MAUH 4UUJA 1N3NB 4IS6B 3RVXD 4E0RB 1A6VH 3X3FH 2IGFH 1REIA 1CFQA 1RUQL 1P9MA 2A6JA 1VHPA 4EI6A 5CP7B 5L2KB 5DVKA 5ALCL 4LF3A 5D72L 4BQ8A 3K74B 1GGIL 1HINL 1ZSDA 3V6BR 4CN6A 4HH9A 2AW2A 4YDKL 1XIWA 2Y9RT 4BZ1L 1H3TA 3P11H 3TPUA 4GQ9H 4S2SA 1EJOL 1AHWA 5EIIA 3BP7B 3K7UA 2DS4A 1BVLA 1VFOA 1HH6B 3OJDA 1GGTA 3B4NA 5GRWA 4LU5H 5DEZA 1WQVT 1LEKB 3QDJE 1NLDH 1YEIL 5I8OL 2Q8AL 3LDBC 1OM3L 4LCCC 3P30L 3B6SA 4UBDC 1DQDH 2J6EL 1IEHA 4BH7B 5CZVL 4RWHA 4IIQB 3JV6B 5F72S 2R2EA 5F93C 4DQOH 5I1KH 3I75B 4XBEH 1LK3H 4XP6L 3T2NL 4OZIA 3WLWD 1PX4A 1A21A 3SBWA 1UM5L 5LXGH 3VJ6A 3WLBA 5ILTL 4QNPF 4FTVD 2VUYA 3IDMB 3TZVA 4AMKH 2Z93A 4X7TB 5DI8B 1SEBB 4PRDA 2EZ0D 4PREA 4ZTPL 3QYCA 4UB0L 3MLUH 4QOKD 4CU7A 4EN3B 4YDJA 4H5SA 1I7TB 3MV8B 4K7PY 1MVUA 4Z76A 4KTEL 4JFFD 4KVCH 3MR9B 1BVZA 2Q6WB 5HYJE 5ESAB 4IMKC 4PGJA 5C86A 2GTZA 1A6TA 5KSBF 4X6EA 4NFDA 3DVIA 2F53E 3V79C 5DGRA 1E4JA 3TIEA 3QEQE 1V3KA 1CXKA 5MEPA 3L3KA 2AXFB 1MPAL 5TDNA 2LU7A 1A7NL 3OKYA 5I18L 4Z6AT 3HPLB 1PGRB 1SY6H 5AYUL 4LSRH 1UACL 1S5HB 4KKLC 1CE6B 4PJGA 3BKML 4GKSB 1I1AB 3ZE0F 4OI7A 2MSPA 3WN5B 4OKDA 5MEOA 4F7EA 1CFQB 2D7QA 5EOTB 2UWEF 5DUML 4GMSL 2NXYB 3JWNC 1J87A 4ELMA 1VFUA 5D70L 2HKHL 2VYRE 7FABL 1G7JA 3ARFA 2AV1B 1EERB 2Y07L 4GLRH 4KDVA 4N0CC 4PJIA 2FDBP 3HB3D 3TIEB 4BSJA 1CZ8H 3O6FB 5IMLA 1ED3A 2EIZB 2ESVA 3Q2CA 5C0GA 4FXGB 2WUBL 4BH8B 4XHQA 1XIWC 1N7MH 2C1OB 3QQ3B 3N1GC 4DZBB 1OLLA 4MX7A 2NY1D 4RA3A 4OZHE 4S1SL 5C09E 2BOCB 1KTLA 4PRAB 4WUUE 4YHPA 1YUHB 5CEZE 5C1MB 3FQRA 1A4JB 3D87B 4XPAH 2EYRA 4G8EA 4K3DL 1YPZF 2BNRA 5FB8A 2MCG1 3U7YL 3G5YB 4YWGL 4JFOA 1N5AA 1KCSL 4FQCH 2P7TA 2AJVH 4PY7A 4JO4H 3VWKA 3FCTA 4UQ2B 5JZ7D 5LQBL 1NMAH 2VERN 5CKGA 3WSQH 2A9MH 3EOTL 3CZFB 2BSTA 4OZIE 3TBSB 4L4VD 4W6XB 5DQ9B 4Z0BL 3V6FA 4KJYB 5D1ZC 5I2IA 5CZKA 4UTAH 4H1LA 5D7SH 1A3LL 2VISB 3VFSB 3LKRB 2GT9B 2WIIB 4TSBL 5HGHA 3SE4C 4QXGL 2O93L 3QUXB 4XWGL 1HEZB 1I3GL 3C5ZA 2RB8A 1KCVH 4LRNH 2O61B 4L29A 4HDIA 3RX8A 4RDQF 2F8VA 1G6RL 5KW9H 1FFPA 1KN4L 1LEGB 3F7VA 1KUMA 4YEEA 2X1QA 2BVOA 1GPOH 3FT3B 5DJ0A 3RIAF 3MMEB 1DEEB 1DQMH 4P48A 1X5ZA 2AQ2A 2C7UB 2F54E 3UTZB 3QWQB 1F4YL 2Q7NA 2VDQL 2V2WB 2CJUL 1UA6L 4HK3N 4NBZB 5SX5K 2XRAH 4DKAA 3CNKA 3LN5A 3EYUL 4QHUA 2YSSA 1CFVL 3T0VA 4O4YH 1KFAH 2B5IB 3MLVH 4S10A 5T3XL 1K8DB 4X6FB 3VXRB 4G6MH 3OKDA 4NN6B 3NVQA 1R5VA 2OZ4H 4WY7L 4KMQA 4MQTB 4RISH 5IB1A 5DD0H 3DRTA 4I5BB 1K2DA 3GI8H 5EBLB 4ZOAA 2BHYA 4PUBL 4AEIH 4MAYC 1J88A 4YBLC 1AO7D 1IAIH 5I76A 3QBTB 3QDGA 4L9DA 1P4LB 3W9DB 3RVTC 1SJXA 2KPNA 1R3KA 4WU7A 4GUPB 3U9UB 4X6CE 5TH2A 4XMLL 2VDMH 3EOAB 1WWAX 4RX4A 3GMLA 1KTKE 3RGVA 3P4MB 1X5YA 3NFSH 4WFFD 3A6CH 4GXVL 1NMBL 2FB4H 3LKSB 5LCVH 4EKXA 1VGEL 2YEZA 4YHML 1BF8A 1EO8H 5E6ID 5ERWA 4YX2H 1VDGA 4HS3A 4R7NB 3V5HA 2P5EB 4H1LH 3VGEA 3FAWA 1WC7A 3H7BA 3LKPB 3KGRA 2AJ3B 2JCCA 3FQRB 4OM1L 2H9GB 4QRUB 4U1HA 5D5MF 2E7LA 3SKJH 5TE6L 1LE5A 1AD9A 3TH3T 2XN9B 4AG4H 5KVDL 1S9XB 1X5XA 2G9HA 4XMPL 4FFYH 2PTVA 1A6UL 1S7WA 3IFNH 5KN5B 3WIIL 4K55A 4DGVL 1UWEL 4JJ5A 3D0VA 1BPVA 4LSQH 4CVZA 35C8L 3C6LB 4FTVE 5E03A 5I1GL 3TO4A 3V0WH 2FEDC 5JOFB 1HXYA 1BIIB 1P5VA 1GH7A 1V3LA 2BSSB 1MHHA 3NZHL 1DSFH 1NAMB 1ZVSB 1P53A 1XR8B 4LCCB 1B4JH 4V2CB 3MLPA 5CMAA 5GGVH 2BNRB 4GW4A 2VH5H 5FYKL 2QADB 1RJLA 2M1KA 4PJ7B 3G5YA 4HKZA 3JTSA 4JN2A 2QLVB 4S1DC 2WZPD 2VJXA 5FAAA 4OZ4A 3TN0A 1VA9A 1N6UA 2QQLL 4GAJL 5E2TL 4ZPVB 3QEQD 4YGVB 4FQPA 4G42A 3ES6A 1FYTE 4FABL 1FAKT 3HE7B 3GUTB 3FQWB 2DIJA 2XZQH 1RVFH 1YEHH 4AQOA 2CGRH 4O2EA 3LEYL 4ACPA 4GRWH 1EUUA 4I3SL 3BKCL 4LSUL 1EK3A 1YPZB 2DKMA 3CSBA 4HS8L 4CMHC 2B8OT 3WFCL 2R1XA 4I18C 3NN8A 1LO0L 4X7DC 3K8LA 2APBA 4NOBA 3GMNB 2D03L 5ICXA 5ADPH 1FE8L 1K8DA 1MJ8L 1RK0A 3BE1H 1WBZA 5EZJA 1E28B 3MV8E 2R9HC 2J5LB 3RZCB 4L8SB 2MMXA 1UT9A 3T0WA 2BNQB 3QFDB 3BWAB 2BP3A 5EU4B 5FO7B 3OSKA 5T1MB 3KPOA 5GS1B 1IT9L 1U8HB 2Q3AA 4LLDB 1U58B 4HIIA 2BSRA 4ZOBA 4ZUWB 4LHUG 4XZUA 3AU1A 3SGJA 2B1AL 1A7RL 4KI5F 2X4RB 4JANA 5AYQA 4FQHB 4P5MB 4HUWA 4NQSA 3WNKA 1YECH 3FT2A 1GCFA 4NZRL 1RZ8A 3JSSA 5H2BA 2H2PC 5IW1A 1ZT7B 1MH5A 1N5YL 1MRDH 3ARWA 1KBGH 3WS3B 1YC7A 4G8EB 2EYRB 1PEWA 1UFUA 2HTKC 4TSCL 4FN0A 1FDLH 4NQUA 4QYOB 2E6JA 1S7RB 2DTML 1K5NA 1N2RA 1ETZB 2ITDA 4YIQA 3FKUS 4QF1A 3ARBD 5D2LA 1DBMH 4TNVK 4BK4A 5IHLB 4LHUB 2FNBA 4GBXB 4Q58C 1B0GA 1JJUA 1U8PA 2DQGH 3GRWL 1UWXH 4KMLB 5ADOL 5T33L 3RVTD 3G6DL 1LP9F 3H9HA 3Q3GB 4WI4A 4XXDA 3S98A 43CAA 3T4AA 1FIGL 5EC1A 1U92A 4LDEB 2YPKB 3PWVA 1Q1JL 2AP2A 4PJ9A 2ADIB 3VFTB 3QXDA 2X5PA 1Q9KA 1R5IA 5EOCL 1CLOH 2V5TA 5CLTA 4X6CB 2ICES 4TPRL 5DJXB 3LRSB 2NLJB 5HYJA 5HGBB 4J8RB 1E27A 2I9TB 3MX0A 4XPHH 1G9NC 2IADB 4NZTH 4OIIH 2B0SH 2C7UA 5T1DL 5F7KC 5E2WH 1BQHG 1U95B 2SEBB 4TUJB 5L9DL 3BZFB 3BFOA 4JB9L 2VLJD 3MREB 2I26N 1CK0H 5HVFB 1MCKA 4Y4HA 2X89A 4HBCL 3PGDB 5E8DL 3X3GL 1RZJC 3SDDB 3T3MF 1MY5A 3G6JE 3RPKA 4OCXH 4EEEA 3QI9D 3R4DA 3VXUD 1Q0YH 4C56A 5DD6B 2XKNA 4RAUB 5J12B 1AC6A 2R56L 5EU5B 3WO3B 1WIPA 3VFUA 5IVOA 1IGFH 5T5NF 1DUZA 4JY5L 1CXLA 4RX4D 3RL2B 3VXUA 1OTSC 5EU7C 8CGTA 4WFGE 4O58H 1NBVL 3OAYK 2WLZA 1MLBA 5E8OA 1K8IB 2F54B 1IAIM 2IPUG 3KS0J 2GUOA 4LLUA 1ONQA 1ZT1B 3I50H 1UKQA 5GRZA 2V5SA 1E4XL 5E70A 1HNGA 1KTDA 5E4EC 1AQDB 4C58B 4JM2A 2OP4L 2YD1A 5I16B 3I6GB 1KPRB 1NJ9B 4G7VL 4ODVH 1LP9A 1DTUA